Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6355.430ON62960623150.0
Suva_2.5385.430ON62960618960.0
Smik_4.6325.430ON62760618940.0
YDR365C (ESF1)5.430ON62860618460.0
NDAI0B056405.430ON66964314070.0
KAFR0E039105.430ON62558713371e-177
NCAS0F033505.430ON63960813031e-172
SAKL0G02442g5.430ON62359612861e-170
TDEL0E019505.430ON61760912641e-166
Kpol_1016.85.430ON63759412611e-166
KLTH0F16148g5.430ON64662012461e-163
CAGL0L11638g5.430ON60861312411e-163
KNAG0C049405.430ON64262412211e-160
ZYRO0F09944g5.430ON61161011891e-155
TBLA0A065405.430ON65961311811e-154
Kwal_55.214445.430ON64462811691e-152
Ecym_47905.430ON63058411501e-149
TPHA0H017805.430ON62241110711e-137
KLLA0E21165g5.430ON6274519701e-122
AER259W5.430ON6194219591e-121
AFR468W4.77ON68925742.4
TBLA0A088904.77ON69839707.5
CAGL0E03069g4.77ON75425699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.635
         (629 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   896   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   734   0.0  
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   734   0.0  
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   715   0.0  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   546   0.0  
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   519   e-177
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   506   e-172
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   499   e-170
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   491   e-166
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   490   e-166
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   484   e-163
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   482   e-163
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   474   e-160
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   462   e-155
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   459   e-154
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   454   e-152
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   447   e-149
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   417   e-137
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   378   e-122
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   374   e-121
AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic ...    33   2.4  
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    32   7.5  
CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [226...    31   9.3  

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/606 (75%), Positives = 460/606 (75%)

Query: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPXXXXXXXXXXXXXXXXXX 120
           KDARNNKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVP                  
Sbjct: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPSDYVSSSDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER 180
                                SGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER
Sbjct: 121 GESEVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER 180

Query: 181 IAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDA 240
           IAIFPS             GPPKELFQ            SVGTDSDGDIGINDLYEEGDA
Sbjct: 181 IAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                VVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360
           TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD
Sbjct: 301 TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE 420
           FKAYLA             AKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE
Sbjct: 361 FKAYLASDSDESDEQVDEDAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE 420

Query: 421 GENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVADEE 480
           GENEKPIEGQDETTI                                       HVADEE
Sbjct: 421 GENEKPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHVADEE 480

Query: 481 EIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVED 540
           EIKNNAKSKA              GSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVED
Sbjct: 481 EIKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVED 540

Query: 541 TFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKRKHSDNGNDV 600
           TFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKRKHSDNGNDV
Sbjct: 541 TFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKRKHSDNGNDV 600

Query: 601 AKNGDS 606
           AKNGDS
Sbjct: 601 AKNGDS 606

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/606 (64%), Positives = 421/606 (69%), Gaps = 2/606 (0%)

Query: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MA DK EKES+DARFAGI +DPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAVDKLEKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPXXXXXXXXXXXXXXXXXX 120
           KDA N KELEDFDKYFEKEAE++ED+E   K  VDRARGEVP                  
Sbjct: 61  KDAHNTKELEDFDKYFEKEAENEEDTEADVKATVDRARGEVPNDYVSSGDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER 180
                                SGD SKTLAVVNLDWDHVKSEDLMITFS FVP+GGKIER
Sbjct: 121 GESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIER 180

Query: 181 IAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDA 240
           I+++PS             GPPKELFQ            +  +DSD DIGI DLYEEGDA
Sbjct: 181 ISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                +V CSD ++A+AIY+NCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360
           TFDD ARD C++LPKNYRPHQFSTDALQHSNVKLTWDETPADR+EVAKRAFTQKEIDDMD
Sbjct: 301 TFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE 420
           FKAYLA             AK+KLKSLVGGL FN KK+ ANDG EE EVDMEITFTPALE
Sbjct: 361 FKAYLASDSDESDEEVNEDAKSKLKSLVGGLGFNSKKENANDGDEE-EVDMEITFTPALE 419

Query: 421 GENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVADEE 480
           G +EKPIEGQ+ET+I                                       HVADEE
Sbjct: 420 GGDEKPIEGQEETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKKHVADEE 479

Query: 481 EIKNNAKSKAXXXXXXXXX-XXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVE 539
           EIKNNAKSKA                S+NSKAHF+M EILRSEKEKHK+ RYQKKERIVE
Sbjct: 480 EIKNNAKSKAELELLMDDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVE 539

Query: 540 DTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKRKHSDNGND 599
           D F PDLEDPRFKEVFEDHDFAIDPTQPEYK TQAM+ ILKERGKRV D+KRKH  N ND
Sbjct: 540 DNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGKRVHDRKRKHGKNEND 599

Query: 600 VAKNGD 605
           V ++G+
Sbjct: 600 VTEDGN 605

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/606 (62%), Positives = 416/606 (68%), Gaps = 2/606 (0%)

Query: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MA +K +KE  D RFAGI SDPKFKNTRT+DHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAEEKPQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPXXXXXXXXXXXXXXXXXX 120
           K+ +NNKELEDFDKYF+KEAE+DED+E + K VVDRARGE+                   
Sbjct: 61  KNTQNNKELEDFDKYFQKEAENDEDTEASVKTVVDRARGEISGDYVSSSDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER 180
                                 GDVSKTLAVVNLDWDHVKSEDLMITFSSFVP+GGK+ER
Sbjct: 121 EQSEVESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLER 180

Query: 181 IAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDA 240
           +AI+PS             GPPKELFQ            S  +DSD DIGINDLYEEGDA
Sbjct: 181 VAIYPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                +V CSD T++KAIYDNCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360
           TFDDA RDECT LPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD
Sbjct: 301 TFDDAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE 420
           FKAYLA             AKNKLKSLVGG++FN KK+   D  E  EVDMEITFTPALE
Sbjct: 361 FKAYLASDSDESDEQIDEDAKNKLKSLVGGINFNSKKENVKDSDE--EVDMEITFTPALE 418

Query: 421 GENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVADEE 480
           G NE+P E Q+ETTI                                       +   EE
Sbjct: 419 GGNEQPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTKLKSINKKYAEGEE 478

Query: 481 EIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVED 540
           +IKNNAK+KA              G++N+KAHF+M EILRSEKEK+K+ RYQ KERIVED
Sbjct: 479 DIKNNAKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVED 538

Query: 541 TFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKRKHSDNGNDV 600
            F PDL DPRFKEVFEDHDFAIDPTQPEYK+TQAM+ ILKERGKRVKDKKRKH  + ND+
Sbjct: 539 NFTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKRVKDKKRKHDGSENDI 598

Query: 601 AKNGDS 606
            KNGDS
Sbjct: 599 IKNGDS 604

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/606 (62%), Positives = 416/606 (68%), Gaps = 3/606 (0%)

Query: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MAG+  +KE +DARFAGI SDPKFKNT+T+DHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPXXXXXXXXXXXXXXXXXX 120
           K+A+NN+ELEDFDKYFEKEAE+DEDSEV AK VVDRARGEVP                  
Sbjct: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDDYVSSSDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER 180
                                SGD+SK LAVVNLDWDHVKSEDLMITFSSFVP+GGKIER
Sbjct: 121 GESEVESEEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER 180

Query: 181 IAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDA 240
           +AI+PS             GPPKELFQ            +  +DSD DIGI DLYEEGDA
Sbjct: 181 VAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                +V CSDTT++KAIYDNCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360
           TFDD  RDEC+ LPKNYRPHQFSTDALQHS+VKLTWDETPADR+EVAKRAFTQKEIDDMD
Sbjct: 301 TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE 420
           FKAYLA             AKNKLKSLVG   FN KK+  ND  E+ EVDMEITFTPALE
Sbjct: 361 FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPND--EDEEVDMEITFTPALE 418

Query: 421 GENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVADEE 480
           G NEK  E ++ETTI                                       H  DEE
Sbjct: 419 GGNEKSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHTNDEE 478

Query: 481 EIKNNAKSKA-XXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVE 539
           EI+ NAKSKA               G++N+KAHF+M EILRSEKEKHK+GRYQKKERIVE
Sbjct: 479 EIEKNAKSKAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVE 538

Query: 540 DTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKRKHSDNGND 599
           DTF PDLEDPRFKEVFEDHDFAIDPTQPE+K TQAMS ILKER KRVK+KKRK   + N+
Sbjct: 539 DTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENN 598

Query: 600 VAKNGD 605
           +  N D
Sbjct: 599 MTNNAD 604

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/643 (49%), Positives = 373/643 (58%), Gaps = 38/643 (5%)

Query: 1   MAGDKSE-KESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRK 59
           MA   SE KES D RFA I +DPKF+ T+ +D KIKLD RFSKKDLE++ KSKVDKYGRK
Sbjct: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60

Query: 60  IKDARNN-KELEDFDKYFEKEAEHDEDSEVAAK-----------------------IVVD 95
           + D++ N KE+ DFDKYFEK+ E  E  E+A +                         +D
Sbjct: 61  LADSKGNEKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNID 120

Query: 96  RARGEVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLD 155
           RARG+VP                                       SG+ SKTLAVVNLD
Sbjct: 121 RARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLD 180

Query: 156 WDHVKSEDLMITFSSFVPRGGKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXX 215
           WDHVKS DLMITFSSF+P GG+IE IAI+PS             GPPKELFQ        
Sbjct: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSK 240

Query: 216 XXXXS-VGTDSD-GDIGINDLYEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAK 273
               S    DSD  D+ I DLYEEGDADKDVD+                VV C++  +A 
Sbjct: 241 SKKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETAT 300

Query: 274 AIYDNCDGTEYESTANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVK 333
           AIY NCDGTEYESTANMFDLRYVPDGM F D  RD+C SLPKNY+PHQFSTDALQHSNVK
Sbjct: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360

Query: 334 LTWDETPADRLEVAKRAFTQKEIDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDF 393
           LTWDETP +R EVAKRAFTQKEIDDMDFKAYLA             AKNKLK+LVGG  F
Sbjct: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGGGF 420

Query: 394 NMKK----KGANDGKEEGEVDMEITFTPALEGENEKPIEGQDETTIXXXXXXXXXXXXXX 449
             ++    KGA  G++E EVDMEITF PAL+  + K     +ETTI              
Sbjct: 421 GSREIFGGKGAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIEKVARKEKERRKAR 480

Query: 450 XX--XXXXXXXXXXXXXXXXXXXXXXXHVA-DEEEIKNNAKSKAXXXXXXXXXXXXXXGS 506
                                      H   D+ E K N KS+A               +
Sbjct: 481 KQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLMMDDDEETGST 540

Query: 507 MNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQ 566
           +N+KAHF+M EILRSEKEK KRG+YQ K++IVED F PDL DPRFKEVFEDHDFAIDP++
Sbjct: 541 INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR 600

Query: 567 PEYKNTQAMSTILKERGKRV----KDKKRKHSDNGNDVAKNGD 605
           PE+K T+AM  ILKER KR+     +KKR+ S   N  A++ D
Sbjct: 601 PEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSD 643

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  519 bits (1337), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 303/587 (51%), Positives = 356/587 (60%), Gaps = 10/587 (1%)

Query: 8   KESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNK 67
           K+S D RF+ I +DPKFKN +T+  KI+LDSRFSK+DLE+++K+KVDKYGRK KD  + K
Sbjct: 6   KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSKK 65

Query: 68  ELEDFDKYFEKEAEHDEDSEVAAKIV--VDRARGEVPXXXXXXXXXXXXXXXXXXXXXXX 125
           EL+DF+KYFEKE E ++      +    VDRARGEVP                       
Sbjct: 66  ELDDFEKYFEKEDEEEKKDTEETEEKPKVDRARGEVPSDYVSSSDEYTSSESEDSEEEEL 125

Query: 126 XXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAIFP 185
                           +GD SKTLAVVNLDWDHVKS DLM+TFSSFVP+GGKI RI I+P
Sbjct: 126 DSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYP 185

Query: 186 SXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDADKDVD 245
           S             GPPKELFQ                DSD D+ I DLYEEGDA+KDVD
Sbjct: 186 SEFGKERLQREEVEGPPKELFQKKNKKKASHKED---FDSDSDVDIKDLYEEGDAEKDVD 242

Query: 246 SXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDA 305
           S                VV C++  +A+AIY+NCDGTEYESTANMFDLRYVPDGMTFDD 
Sbjct: 243 SKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDE 302

Query: 306 ARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYL 365
            RDEC SLPKNY+P QFSTDALQHSNVKLTWDETPADR+EVAKRAF+QKEI+DMDFKAYL
Sbjct: 303 PRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYL 362

Query: 366 AXXXXXXXXXXXXXAKNKLKSLVG-GLDFNMKKKGANDGKEEGEVDMEITFTPALEGENE 424
           A             +KNKLK+LVG  LDF     GA+DG  E EVDMEITFTP L+   E
Sbjct: 363 ASDSDESEEEVNENSKNKLKALVGESLDFGT--NGASDG--ESEVDMEITFTPGLDEAKE 418

Query: 425 KPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVADEEEIKN 484
              E ++ T                                             E E + 
Sbjct: 419 SEEEKEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDKKSRKAETENEE 478

Query: 485 NAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAP 544
            AK+KA               S+N KAHF++ EI+RSEKEK K+G+YQ+KE+IVED F P
Sbjct: 479 AAKAKAELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKP 538

Query: 545 DLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKR 591
           DL DPRFKEVFEDHDFAIDP+QPE+K T AM  IL ER KR K++ +
Sbjct: 539 DLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSK 585

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  506 bits (1303), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 306/608 (50%), Positives = 358/608 (58%), Gaps = 17/608 (2%)

Query: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           M+ D S K + D+RF+GI +DPKF+ T+ ++ KIKLD RFSKKDLE++ K+KVDKYGRKI
Sbjct: 1   MSEDNSTKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKI 60

Query: 61  KDAR--NNKELEDFDKYFEKEAEHDEDSEVAAK---IVVDRARGEVPXXXXXXXXXXXXX 115
            +    NNKEL+DFDKYFEKE E  ++ +   +   + VDRARGEVP             
Sbjct: 61  HEDNDMNNKELKDFDKYFEKEGESADEKKEEEEIETVTVDRARGEVPADYVSSSDEYTSS 120

Query: 116 XXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRG 175
                                     +GD +KTLAVVNLDWDHV+S DLMITFS F+P+G
Sbjct: 121 ESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFLPKG 180

Query: 176 GKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLY 235
           GKIE+I + PS             GPP+ELFQ            S   DSD    I DLY
Sbjct: 181 GKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDV--DIKDLY 238

Query: 236 EEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRY 295
           EEGDADKDVD+                VV C+   +A+AIY+NCDGTEYESTANMFDLRY
Sbjct: 239 EEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRY 298

Query: 296 VPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKE 355
           VPDGM FDD  RD+C+SLPKNY+PHQFSTDALQHSNVKLTWDETPA+R+EVAKRAFTQKE
Sbjct: 299 VPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKE 358

Query: 356 IDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVG-----GLDFNMKKKGANDGKEEGEVD 410
           I+DMDFKAYLA             AKNKLKSLVG     G       K   +G++E EVD
Sbjct: 359 IEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEGEDE-EVD 417

Query: 411 MEITFTPALEGENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 470
           MEITF P L    EK  E ++ T                                     
Sbjct: 418 MEITFDPGLSEGVEKTEEHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLKSL 477

Query: 471 XXXXHVADEEEIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGR 530
               H    E   + AKSKA                +N KAHF+MKEILRSEKEK K+G+
Sbjct: 478 KGKKHNDSTEGDASTAKSKAELELLMMDDEDDTETGINKKAHFNMKEILRSEKEKSKKGK 537

Query: 531 YQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKR----V 586
           YQ K RIVED F PDL DPRFKEVFEDHDFAIDP++PE+K T AM  ILKER KR     
Sbjct: 538 YQDKRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRSSKNA 597

Query: 587 KDKKRKHS 594
           + KKR HS
Sbjct: 598 QKKKRSHS 605

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  499 bits (1286), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/596 (48%), Positives = 353/596 (59%), Gaps = 22/596 (3%)

Query: 1   MAGDKSEKESI-DARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRK 59
           M+GDK+   +  D RF+GI SDPKFK+ + ++ KIKLD RFSKKDLE++ K+KVDKYGR+
Sbjct: 1   MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRR 60

Query: 60  IKDARNNKELEDFDKYFEKEAEHDEDSEVAAKIV----VDRARGEVPXXXXXXXXXXXXX 115
           +KD  +NKE +DF++YFEKE E    S+   +      +DRARGEVP             
Sbjct: 61  LKDV-DNKETKDFERYFEKEEESSSPSDEEGESTKVTSLDRARGEVPSDYLSSSEEESSS 119

Query: 116 XXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRG 175
                                     +GD ++ LAVVNLDWDHVKS DLM+TFSSFVP+G
Sbjct: 120 ESEEESENSELESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKG 179

Query: 176 GKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLY 235
           GKI +IAI+PS             GPP+ELFQ              G DSD DI   DLY
Sbjct: 180 GKILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKD----GDDSDVDI--KDLY 233

Query: 236 EEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRY 295
           EEGDA+KD DS                VV C++  +A+AIY NCDGTEYESTANMFDLRY
Sbjct: 234 EEGDAEKDYDSKALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRY 293

Query: 296 VPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKE 355
           VP+GM F D  +DEC  +PKNY+P QFSTDALQHSNVKLTWDETPA+R+E++KRAFTQKE
Sbjct: 294 VPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKE 353

Query: 356 IDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVGGL----DFNMKKKGANDGKEEGEVDM 411
           I+DMDFKAYLA             ++NKLKSLV       D ++  K  N+G   G+VDM
Sbjct: 354 IEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEG---GDVDM 410

Query: 412 EITFTPALEGENEKPIEGQDETTIXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 470
           EITFTP L+   +   +G+DETTI                                    
Sbjct: 411 EITFTPGLDEAKKDDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKS 470

Query: 471 XXXXHVADEEEIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGR 530
                 AD  E++   KSKA                +N KAHF+M EILRSEKEK KR +
Sbjct: 471 DSQSKTAD--EVEKEKKSKAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTK 528

Query: 531 YQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRV 586
           YQ +E+IVED F PDL DPRF+EVFEDHDFAIDP+QPE+K T AM  ILKER +RV
Sbjct: 529 YQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRV 584

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  491 bits (1264), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 298/609 (48%), Positives = 364/609 (59%), Gaps = 21/609 (3%)

Query: 6   SEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARN 65
           SEK S D RF+ I  DPKF N +T+  K+KLD RFSKKDLE++ K+KVDKYGR+++D  +
Sbjct: 2   SEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVED 61

Query: 66  NKELEDFDKYFEK---EAEHDEDSEVAAKIVVDRARGEVPXXXXXXXXXXXXXXXXXXXX 122
           +KE +DFDKYFE+   E + D+D+E+   + VDRARGEVP                    
Sbjct: 62  SKESKDFDKYFEQSDEEKKKDKDTEI---LTVDRARGEVPSDYVSSSDEFTSSDSEVSDN 118

Query: 123 XXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIA 182
                              SGD SKTLAVVNLDWD+V+S DLMITFSSF+P GG+IE+IA
Sbjct: 119 EVESESESEVELEKTEPS-SGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIA 177

Query: 183 IFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDADK 242
           I+PS             GPPKELFQ                DSD DI + DLYEEGDADK
Sbjct: 178 IYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQE----DSDSDIDVKDLYEEGDADK 233

Query: 243 DVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTF 302
           +VD+                VV C++  +A++IY+NCDGTEYESTAN+FD+RYVPDGM F
Sbjct: 234 NVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDF 293

Query: 303 DDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFK 362
           D   +D CT LPKNY+P QFSTDALQHSNVKLTWDETPADRL+VAKRAFTQKEI+DMDFK
Sbjct: 294 DGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFK 353

Query: 363 AYLAXXXXXXXXXXXXXAKNKLKSLVGG---LDFNMKKKGANDGKEEGEVDMEITFTPAL 419
           AYLA             +K+KLKSLV G    DF  K     DG +E EVDMEITFTP L
Sbjct: 354 AYLASDSDDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDE-EVDMEITFTPGL 412

Query: 420 EGENEKPIEGQ-DETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVAD 478
           +  N+   EGQ +E+TI                                         +D
Sbjct: 413 DEANKDGQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGRGKQTSD 472

Query: 479 EEEIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIV 538
              I+ + KSKA               S+N KAHF+MKEIL+SEKEK K+ +YQ K +IV
Sbjct: 473 ---IEQDPKSKAELELLMMDDEDDTEKSINKKAHFNMKEILKSEKEKKKKNKYQDKNKIV 529

Query: 539 EDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVK--DKKRKHSDN 596
            D F PDLEDPRFKE+FE HDFAIDPTQ E++ T+AM  +L +R K+    + KRK +  
Sbjct: 530 VDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQ 589

Query: 597 GNDVAKNGD 605
            ND  +NGD
Sbjct: 590 ENDTNENGD 598

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  490 bits (1261), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 293/594 (49%), Positives = 351/594 (59%), Gaps = 15/594 (2%)

Query: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           M+G+ S K+S D RF+GI SDPKFKN++ ++ KIKLD RF K DL+++HKSKVDKYGRK+
Sbjct: 1   MSGEDSMKQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKL 60

Query: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVA--AKI-VVDRARGEVPXXXXXXXXXXXXXXX 117
           KD ++NKELEDFDKYFEKE E D++ E+   AK+ V+DRARGEVP               
Sbjct: 61  KDVKDNKELEDFDKYFEKEDEEDKEEEIGTEAKVKVLDRARGEVPSDYESSSEEFTSSDS 120

Query: 118 XXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGK 177
                                   SGD SKTLAVVNLDWD+VKS+DLMITFSSF+P+GGK
Sbjct: 121 ESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGK 180

Query: 178 IERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGD---IGINDL 234
           IE+I I+PS             GPP+ELF                 + D     + I +L
Sbjct: 181 IEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIREL 240

Query: 235 YEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLR 294
           YEEGDA+KDVDS                VV C++  SA++IY+NCDGTEYES+AN+FDLR
Sbjct: 241 YEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFDLR 300

Query: 295 YVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQK 354
           YVPDG  FDD  RDEC  LPKNY+  QF+TDALQHSNVKLTWDETPADR+E+AKRAFTQK
Sbjct: 301 YVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQK 360

Query: 355 EIDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVG-----GLDFNMKKKGANDGKEEGEV 409
           EI++MDFKAYLA              KNKLKSLV      G       KG  D  EE +V
Sbjct: 361 EIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKG--DNNEEDDV 418

Query: 410 DMEITFTPALEGENEKPIEGQD--ETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 467
           DMEITFTP L    E   E +D  ETTI                                
Sbjct: 419 DMEITFTPGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQSENEKKEK 478

Query: 468 XXXXXXXHVADEEEIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHK 527
                     + +    +AK+KA               ++N KAHF+M EI+RSEKEK K
Sbjct: 479 LKELKKERNGNGKNTNVDAKAKAELELLMMDDETESTSTLNKKAHFNMNEIVRSEKEKGK 538

Query: 528 RGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKE 581
           + +YQ K +IVED F PDL DPRFKE+FEDHDFAIDPTQ E+K T AM  ILKE
Sbjct: 539 KSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKE 592

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  484 bits (1246), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 285/620 (45%), Positives = 346/620 (55%), Gaps = 39/620 (6%)

Query: 10  SIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKEL 69
           S D RFAG+ +DPKF+ TR +  KIKLD RFSKKDLE + K++VDKYGR++K  + +K+ 
Sbjct: 12  SSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLK-GQESKDK 70

Query: 70  EDFDKYFEKE----------------------AEHDEDSEVAAKIV-VDRARGEVPXXXX 106
            DFDKY+EKE                         DE+   +AK V +DRARGEV     
Sbjct: 71  RDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVHSDYV 130

Query: 107 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMI 166
                                              SGD SKTLAVVNLDWDHVKS DLM+
Sbjct: 131 SSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDWDHVKSTDLMV 190

Query: 167 TFSSFVPRGGKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSD 226
           TFSSFVP+GGKI R+AI+PS             GPP+E+F+            S G DSD
Sbjct: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKK-----SHGDDSD 245

Query: 227 GDIGINDLYEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYES 286
            ++ + DLYEEGDAD D D+                VV C++  +A++IY NCDGTEYES
Sbjct: 246 EELTVKDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGTEYES 304

Query: 287 TANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEV 346
           TANMFDLRYVPDGM FDD ARDEC S+PKNYRP +FSTDALQHS VK TWDETPADR  +
Sbjct: 305 TANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAM 364

Query: 347 AKRAFTQKEIDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVG-GLDFNMKKKGANDGKE 405
           AKRAFTQ+EI+DMDFKAYLA              KNKLKSLV   +    K     D K+
Sbjct: 365 AKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKD 424

Query: 406 -EGEVDMEITFTPAL-EGENEKPIEGQ--DETTIXXXXXXXXXXXXXXXXXXXXXXXXXX 461
            E +VDM+ITF PAL EG +    +G+  +ETT+                          
Sbjct: 425 GESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKELKKQAE 484

Query: 462 XXXXXXXXXXXXXHVADEEEIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRS 521
                             E    ++KS+A                +N KAHF+M EI+RS
Sbjct: 485 DDKKQKLKEARRKP----EPSATDSKSQAELELLMMDDSEEANSKLNKKAHFNMNEIVRS 540

Query: 522 EKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKE 581
           EKEK K+ ++Q K RIVED F PDL DPRF EVFEDHDFAIDP+QPE+K T AM  IL+E
Sbjct: 541 EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600

Query: 582 RGKRVKDKKRKHSDNGNDVA 601
           R KR +  K K  +   D+A
Sbjct: 601 RNKRSQKGKNKKREANGDIA 620

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  482 bits (1241), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 297/613 (48%), Positives = 364/613 (59%), Gaps = 34/613 (5%)

Query: 6   SEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARN 65
           SE++S D RF+ I +DPKFK + ++  KIKLD RF KKDLEV  ++KVDKYGRKIK+  +
Sbjct: 2   SEEKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEG-S 60

Query: 66  NKELEDFDKYFEK-----EAEHDEDSEVA-AKIVVDRARGEVPXXXXXXXXXXXXXXXXX 119
           +K++EDFDKYFEK     E E  ++ +VA +K +VDRARGEVP                 
Sbjct: 61  SKDIEDFDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEVPSDYVSSEDEFTSSDSDT 120

Query: 120 XXXXXXXXXXXX--XXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGK 177
                                   +GD +KTLA VNLDWDHV+S D+M+TFSSF+P+GGK
Sbjct: 121 SGDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGK 180

Query: 178 IERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEE 237
           IE+I I+PS             GPP+ELFQ            S   + + D+ I DLYEE
Sbjct: 181 IEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKN---SSEDEEESDVDIKDLYEE 237

Query: 238 GDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVP 297
           G+AD  VD                 V+ C++  SAKAIY+NCDGTEYESTAN+ DLRYVP
Sbjct: 238 GNADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVP 297

Query: 298 DGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEID 357
           DGM FDD  +D+C  LPKNY+PHQFSTDALQHSNVKLTWDETP DR+EVAKRAFTQKEI+
Sbjct: 298 DGMDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIE 357

Query: 358 DMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTP 417
           DMDFKAYLA             AKNKLKSLVG    ++K  G +   E+  +DMEITFTP
Sbjct: 358 DMDFKAYLASDSDESEEEVNEEAKNKLKSLVGE---SLKIDGKDGSDEDEGMDMEITFTP 414

Query: 418 AL-----EGENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 472
            L     EGE+ K  E  +ETTI                                     
Sbjct: 415 GLDEANAEGED-KDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSKH 473

Query: 473 XXHVADEEEIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQ 532
              ++D        K KA              G +NSKAHF+M EILRSEKEK K+G++Q
Sbjct: 474 DEPLSD--------KKKAELELLMMDENESNSG-INSKAHFNMNEILRSEKEKSKKGKFQ 524

Query: 533 KKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKR- 591
           KK+RIVED F P+L+D RFKEVFEDHDFAIDP+QPE+K T+AM  ILKER KR +D K  
Sbjct: 525 KKQRIVEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRKRSRDSKHG 584

Query: 592 --KHSDNGNDVAK 602
             +H+D  ND+ K
Sbjct: 585 KEEHTDK-NDINK 596

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  474 bits (1221), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 302/624 (48%), Positives = 363/624 (58%), Gaps = 25/624 (4%)

Query: 6   SEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDA-R 64
           S+K S D RF+G+ +DPKF++T+ +  K+KLDSRFSKKDLEV+ K+KVDKYGRKIK+   
Sbjct: 2   SDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDA 61

Query: 65  NNKELEDFDKYFEKE--AEHDEDSEVA---AKIVVDRARGEVPXXXXXXXXXXXXXXXXX 119
           N KELEDFDKYFEKE  A+  ED+E      K+VVDRARGEVP                 
Sbjct: 62  NKKELEDFDKYFEKEDEAKESEDAEAPEAPVKVVVDRARGEVPDDYVSSADEFTSSDSES 121

Query: 120 XXXXXXXXXXXX-----XXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPR 174
                                      SGD SKTLAVVNLDWDHVKS DLMITF+ F+P+
Sbjct: 122 SGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPK 181

Query: 175 GGKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDS------DGD 228
           GGKIERI I+PS             GPPKELF               G +S        D
Sbjct: 182 GGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSK-GAESGKSDDDVSD 240

Query: 229 IGINDLYEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTA 288
           + I DLYEEGDA+KD+DS                VV C++  +AKAIYDNCD TEYESTA
Sbjct: 241 VDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTA 300

Query: 289 NMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAK 348
           NMFDLRYVP+GMTFDD  RDEC +LPKNY+P  F+TDALQHSNVKLTWDETPADR+E+AK
Sbjct: 301 NMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAK 360

Query: 349 RAFTQKEIDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVGG-LDFNMKKKGA-NDGKEE 406
           RAF+QKEIDDMDFKAYLA              KN+LK+LVGG L  +  K GA  D  +E
Sbjct: 361 RAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDE 420

Query: 407 GEVDMEITFTPALE--GENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 464
             +DMEITFTP L+     E+    ++E+TI                             
Sbjct: 421 EGMDMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNAEKEK 480

Query: 465 XXXXXXXXXXHVADEEE-IKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEK 523
                         EEE + + AK++                ++N K HF+M EI+RSEK
Sbjct: 481 RDKLKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEK 540

Query: 524 EKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERG 583
           EK K+ ++Q K RIVED F PDL D RFKEVFEDHDFAIDP++PE+K T AM  IL+ER 
Sbjct: 541 EKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERS 600

Query: 584 KRV--KDKKRKHSDNGNDVAKNGD 605
            R   K KKRK ++   D +   D
Sbjct: 601 NRARSKGKKRKSAEQSTDTSDKTD 624

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  462 bits (1189), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 282/610 (46%), Positives = 354/610 (58%), Gaps = 37/610 (6%)

Query: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           M  D+  K S D RFAGI +DPKF+N + +  K+KLD RFSKKDL+V+ K+KVDKYGR+I
Sbjct: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60

Query: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVAAKI----------VVDRARGEVPXXXXXXXX 110
                +K+L+DFDKYFEKE +  ++ E ++            VVDRARGE+P        
Sbjct: 61  --TGESKDLKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSES 118

Query: 111 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSS 170
                                          SGD SKTLAVVNLDWDHV++ DLMITFSS
Sbjct: 119 EDSESDLSEEESEADVAEAVEEAKPE-----SGDPSKTLAVVNLDWDHVRAADLMITFSS 173

Query: 171 FVPRGGKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIG 230
           F+P GGKIE+I I+PS             GPP+E+F                 DSD D+ 
Sbjct: 174 FLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDE--------DSDSDVD 225

Query: 231 INDLYEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANM 290
           I DLYEEGDADK+VD+                +V C++  + ++IY NCDGTEYESTAN+
Sbjct: 226 IRDLYEEGDADKEVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANI 285

Query: 291 FDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRA 350
           FDLRYVP+GM FDD  +DEC  LPKNY+P +FSTDALQHSNVKLTWDETP DRLEV+KRA
Sbjct: 286 FDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRA 345

Query: 351 FTQKEIDDMDFKAYLAXXXXXX--XXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKEEGE 408
           F+QKE++DMDF+AYLA               AKNKLKSLVG       +  A   ++E E
Sbjct: 346 FSQKELEDMDFQAYLASGTDESDGEENNNEEAKNKLKSLVG-------QSLAYGKQQEEE 398

Query: 409 VDMEITFTPALEGENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 468
            DMEITFTP L+    +  E  +ETTI                                 
Sbjct: 399 PDMEITFTPGLDDSKPQADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKL 458

Query: 469 XXXXXXHVADEEEIKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKR 528
                    ++E   ++AKSKA               S+N KAHF+M EIL+SEKEK K+
Sbjct: 459 RSGKNKKQVEDE---SDAKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKK 515

Query: 529 GRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKD 588
           G+YQ K +I+ED F PDL DPRF EVFE+ DFAIDP+QPEYK+T+AM  IL+ER KR   
Sbjct: 516 GKYQDKGKIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHK 575

Query: 589 KKRKHSDNGN 598
           K++  +D+G+
Sbjct: 576 KRKPLADDGD 585

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  459 bits (1181), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 279/613 (45%), Positives = 346/613 (56%), Gaps = 41/613 (6%)

Query: 12  DARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKELED 71
           DARFAG+ +DPKF+ ++    K+KLD+RFSKKDL+V +KSKVD+YGRKI D RN K+ +D
Sbjct: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID-RNEKDKKD 67

Query: 72  FDKYF-------------------------EKEAEHDEDSEVAAKIV-VDRARGEVPXXX 105
           FDKY+                         + + + D+D +V A++  +DRARG+VP   
Sbjct: 68  FDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRARGDVPSDY 127

Query: 106 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLM 165
                                               +GD SKT+AVVNLDWDHVKS DLM
Sbjct: 128 VSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHVKSTDLM 187

Query: 166 ITFSSFVPRGGKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDS 225
           ITFS F+P+GGKI +IAI+PS             GPPKELF+                D 
Sbjct: 188 ITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTAED-NEDD 246

Query: 226 DGDIGINDLYEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYE 285
             D+ INDLYEEGDADK++DS                VV C++  +A++IY NCDGTEYE
Sbjct: 247 VSDVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNCDGTEYE 306

Query: 286 STANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLE 345
           STAN+FD+RYVPD MTFDD  RDEC  LPKNY+P QFSTDALQHSNVKLTWDETPADR+E
Sbjct: 307 STANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVE 366

Query: 346 VAKRAFTQKEIDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDF-NMKKKGAN--- 401
           ++KRAF+QKEID+MDFKAYLA             +KNKLKSLVGG  F N+  K      
Sbjct: 367 ISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVFGKDTEYDL 426

Query: 402 DGK-EEGEVDMEITFTPALEGENEKPIE--GQDETTIXXXXXXXXXXXXXXXXXXXXXXX 458
           DG  +E  VDMEITFTP L+ + E       ++E+TI                       
Sbjct: 427 DGSDDEDGVDMEITFTPGLDEKKEASDNETKKEESTIEKLQRKEKERRKLRKQKVKDLKE 486

Query: 459 XXXXXXXXXXXXXXXXHVADEEEI-----KNNAKSKAXXXXXXXXXXXXXXGSMNSKAHF 513
                           +  +  E+     +   KSKA              G +N+KAHF
Sbjct: 487 KSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDKSKAELELLMMDEDDRISG-VNNKAHF 545

Query: 514 SMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQ 573
           +M EILRSEKEK K+ +YQ K +IV+D F P+L D RF E+FEDH FAIDPTQPE+K T 
Sbjct: 546 NMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTS 605

Query: 574 AMSTILKERGKRV 586
           AM  IL ER KR 
Sbjct: 606 AMKEILNERTKRA 618

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  454 bits (1169), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 287/628 (45%), Positives = 341/628 (54%), Gaps = 41/628 (6%)

Query: 9   ESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKE 68
           ES D RFA + SDPKF+ T+ +  KIKLD RFSKKDL+ + K++VDKYGR +K  + NK+
Sbjct: 11  ESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK-GQENKD 69

Query: 69  LEDFDKYFEK-------------------------EAEHDEDSEVAAKIVVDRARGEVPX 103
            +DFDKY+EK                         EA+   DS     + +DRARGEVP 
Sbjct: 70  KKDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEVPS 129

Query: 104 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSED 163
                                                 SGD SKTLAVVNLDWDHVKS D
Sbjct: 130 DYVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKSTD 189

Query: 164 LMITFSSFVPRGGKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGT 223
           LMITFSSFVP GGKI +IA++PS             GPP+E+F+            S   
Sbjct: 190 LMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSDSD 249

Query: 224 DSDGDIGINDLYEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTE 283
                    DLYEEGDA+ D D+                VV C++  +A+AIY NCDGTE
Sbjct: 250 VDV-----RDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTE 303

Query: 284 YESTANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADR 343
           +ESTANMFDLRYVPDGMTFDD ARDECTS+PKNY+P QFSTDALQHS VKLTWDETPADR
Sbjct: 304 FESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADR 363

Query: 344 LEVAKRAFTQKEIDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDG 403
           + ++KRAFTQKEI+DMDFKAYLA              K KLKSLV        K   +  
Sbjct: 364 VAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFDQA 423

Query: 404 KEEGE--VDMEITFTPAL-EGENEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXX 460
            EEGE  VDM+ITF P L EG  +   E  +ETT+                         
Sbjct: 424 PEEGESDVDMQITFAPGLAEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKELKKQA 483

Query: 461 XXXXXXXXXXXXXXHVADEEEIKNNAKSKAXXXXXXXXXXXXXXGS-MNSKAHFSMKEIL 519
                              E    +AKSKA               S +N KAHF+M EI+
Sbjct: 484 EEEKKQKRKESRYK----PESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIV 539

Query: 520 RSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTIL 579
           RSEKEK K+ RYQ K++IVED F PDL DPRF EVFED DFAIDP+QPE+K T AM  IL
Sbjct: 540 RSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQIL 599

Query: 580 KERGKRV-KDKKRKHSDNGNDVAKNGDS 606
           +ER KR  K + +K   +GN   +NG S
Sbjct: 600 QERTKRSHKGQNKKRKADGNLANQNGQS 627

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  447 bits (1150), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 261/584 (44%), Positives = 324/584 (55%), Gaps = 20/584 (3%)

Query: 12  DARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKELED 71
           D+RFAGI +DPKF+  +    KI LD RFSKKDLE + K+KVDKYGR+I  + + KE +D
Sbjct: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI-GSYDEKEAKD 72

Query: 72  FDKYF------EKEAEHDEDSEV--AAKIVVDRARGEVPXXXXXXXXXXXXXXXXXXXXX 123
           FD+YF      EK    DE+ E    A   +DRARGEVP                     
Sbjct: 73  FDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSDENSSSESEEESED 132

Query: 124 XXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAI 183
                             +GD +K  AVVNLDWDHV+S DL+ TF+SFVP GG I+++AI
Sbjct: 133 SALDPDSELEIEESKPE-TGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAI 191

Query: 184 FPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDADKD 243
           +PS             GPP+ELF+                D + DI INDLYE  DA+KD
Sbjct: 192 YPSEFGKERMKREEVEGPPRELFKRKQSKKEKD-----SDDENSDIDINDLYEVDDAEKD 246

Query: 244 VDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303
            DS                VV CSD  +AKAIY NCDGTE+ESTANMFDLRYVPD M F+
Sbjct: 247 YDSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFE 306

Query: 304 DAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKA 363
           D  RD+C S+PK+Y+P QFST ALQHS VKLTWDETPADR+E++KRAF QKEI++MDFKA
Sbjct: 307 DDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKA 366

Query: 364 YLAXXXXXXXXXXXXXAKNKLKSLVG-GLDFNMKKKGANDGKEEGEVDMEITFTPALEGE 422
           YLA              KN L+SLV   +    K      G EE E D+EITFTP LE  
Sbjct: 367 YLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEE-EADVEITFTPGLENG 425

Query: 423 NEKPIEGQDETTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVAD-EEE 481
           +    E ++ET +                                        V + E+E
Sbjct: 426 DAPKEENEEETALDKIKRKEKERRKKRKERVKELKMQAIDEKKARRRKGDDGAVTEAEKE 485

Query: 482 IKNNAKSKAXXXXXXXXXXXXXXGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDT 541
           ++   K +A               ++N+ AHF+M EI++S+KEK K+ RYQ K  IV+D 
Sbjct: 486 LRK--KKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDN 543

Query: 542 FAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKR 585
           F PDL DPRFKEVFEDHDFAIDP+QPE+K T AM  IL+ER +R
Sbjct: 544 FKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRR 587

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  417 bits (1071), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 229/411 (55%), Positives = 263/411 (63%), Gaps = 9/411 (2%)

Query: 12  DARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKELED 71
           D RF+G+ +DPKFKN R ++ KIKLDSRFSK DLEV  K++VDKYGRKI +  NN+E +D
Sbjct: 10  DERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNL-NNQEAKD 68

Query: 72  FDKYFEKEAEHDEDSEVAAKIVVDRARGEVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 131
           FDKYFEKE +     E+A K ++DRARGEVP                             
Sbjct: 69  FDKYFEKEEDGKG-EEIAVKPLIDRARGEVPSDYQSSLDDYTSSESEDSEDEDLESEGES 127

Query: 132 XXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAIFPSXXXXX 191
                     SGD SKT+AVVNLDWDHVK+ DL++TFSSFVP+GGKIERIAIFPS     
Sbjct: 128 EAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIERIAIFPSEFGKQ 187

Query: 192 XXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDADKDVDSXXXXX 251
                   GPPKELFQ                DSD DI  NDLYEEGD DK+VDS     
Sbjct: 188 RMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDI--NDLYEEGDVDKEVDSKSLRQ 245

Query: 252 XXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAARDECT 311
                      VV C++ ++A+AIY+NCDGTEYESTAN+FDLRYVPDGM F+D   DECT
Sbjct: 246 YQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDFEDQPYDECT 305

Query: 312 SLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLAXXXXX 371
            LPKNY P  F+TDALQHSNVKLTWDETPADR+E+AKRAFTQKEID+MDFKAYLA     
Sbjct: 306 ELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFKAYLA-SDSE 364

Query: 372 XXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGK---EEGEVDMEITFTPAL 419
                    KNKLKSLV GL   +  K   D K   E+GEVDMEITFTP L
Sbjct: 365 ESEGENEEVKNKLKSLV-GLSMKIGDKSIMDNKSDNEDGEVDMEITFTPGL 414

 Score =  108 bits (270), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 60/91 (65%), Positives = 69/91 (75%)

Query: 505 GSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDP 564
            ++N KAHF+MKEILRSEKEK K+ ++Q KE+IVED F  DL DPRF E+FEDHDFAIDP
Sbjct: 502 STINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDP 561

Query: 565 TQPEYKNTQAMSTILKERGKRVKDKKRKHSD 595
           TQ EYK T AM  ILKER KR   KK   S+
Sbjct: 562 TQSEYKETAAMKEILKERSKRSTMKKANRSE 592

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  378 bits (970), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/451 (48%), Positives = 270/451 (59%), Gaps = 32/451 (7%)

Query: 3   GDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKD 62
           G+K EK + D RF+GI +DPKF++T++++ KIKLD RFSK+DLEV+ K+KVDKYGRKI D
Sbjct: 5   GEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVD 64

Query: 63  ARNNKELEDFDKYFEKEAEHD-------------EDSEVAAKI-VVDRARGEVPXXXXXX 108
           A  NK+++DFD+YF KE   D             +++E A     VDRARGE P      
Sbjct: 65  A--NKDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGEPPADYVSS 122

Query: 109 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITF 168
                                            SG+ + TLAVVNLDWDHVKS DL +TF
Sbjct: 123 SDEESSSESEEESGDSDIESEEIELEESKPA--SGNATNTLAVVNLDWDHVKSADLFVTF 180

Query: 169 SSFVPRGGKIERIAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGD 228
            SFVP+GG+I++IAI+PS             GPPKELFQ                  D +
Sbjct: 181 KSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKS--------KKNDKDDDE 232

Query: 229 IGINDLYEEGDADKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTA 288
           I +  +YEEGDA+ D DS                VV CSD  +A++IY NCDGTEYESTA
Sbjct: 233 INVESIYEEGDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTA 291

Query: 289 NMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAK 348
           N+FDLRYVPDGM  DD  RDECTSLPKNY+P QFSTDALQHS VKLTWDETPADR+E++K
Sbjct: 292 NVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISK 351

Query: 349 RAFTQKEIDDMDFKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKE--- 405
           RAFTQKEI++MDFKAYLA              KNKLK+LV      + +K   D KE   
Sbjct: 352 RAFTQKEIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMD-SVKVGQKSLFDQKEDED 410

Query: 406 EGEVDMEITFTPAL-EGENEKPIEGQDETTI 435
           + E DMEITFTP L E   +   + ++E+TI
Sbjct: 411 DNEADMEITFTPGLDESGQQDTNDNEEESTI 441

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 8/108 (7%)

Query: 505 GSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDP 564
            ++N+KAHF+M EIL+SEKEK K+ +YQ KE+IV+D F PD+ DPRFKEVFEDHDFAIDP
Sbjct: 505 STINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAIDP 564

Query: 565 TQPEYKNTQAMSTILKER----GKRVKDKKRKH----SDNGNDVAKNG 604
           TQPE+K T AM  ILKER     K+ + KKR H    +++  D+ K G
Sbjct: 565 TQPEFKKTPAMEKILKERTVRSSKKSRGKKRNHEIANTEHSKDINKIG 612

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  374 bits (959), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 257/421 (61%), Gaps = 20/421 (4%)

Query: 8   KESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNK 67
           K+SID RFA I SDPKF+  + ++ KIKLD RFSK+DLE + K+KVDKYGR+I  A   K
Sbjct: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTA-PGK 68

Query: 68  ELEDFDKYFEKEAEHD-------EDSEVAAKIVVDRARGEVPXXXXXXXXXXXXXXXXXX 120
           E +DF+KYF KE+          EDS VA    +DRARGEVP                  
Sbjct: 69  EEKDFEKYFTKESSESAAEESDKEDSSVAK---LDRARGEVPADYVSSSDEESSSESEAD 125

Query: 121 XXXXXXXXXXXXXXXXXXXXXSGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER 180
                                SGD SK LAVVNLDWDHVK  DL++ F+SFVP GGKIER
Sbjct: 126 SDDATAESDEEVEIEEEKPE-SGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIER 184

Query: 181 IAIFPSXXXXXXXXXXXXXGPPKELFQXXXXXXXXXXXXSVGTDSDGDIGINDLYEEGDA 240
           +AI+PS             GPP+E+F+                D D +IG+ DLYE+GDA
Sbjct: 185 VAIYPSEFGKERMQREEVEGPPREVFKSKKDK-------KAKQDDDDEIGLKDLYEQGDA 237

Query: 241 DKDVDSXXXXXXXXXXXXXXXXVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           +KD DS                VV C++  +A+AIY NCDGTEYESTANMFDLRYVP+G+
Sbjct: 238 EKDYDSKALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGV 297

Query: 301 TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360
           TFDD  R+EC S+PK+Y+P QFST ALQH  VKLTWDETPADR+E+AKRAF+QKEI+DMD
Sbjct: 298 TFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMD 357

Query: 361 FKAYLAXXXXXXXXXXXXXAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE 420
           FKAYLA             AKNKL+SLV  +    K   A++  EE E D++ITFTP LE
Sbjct: 358 FKAYLASDSEESEADDNSEAKNKLRSLVSSVKVADKPLFADESDEE-EADVQITFTPGLE 416

Query: 421 G 421
           G
Sbjct: 417 G 417

 Score =  100 bits (248), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/76 (69%), Positives = 64/76 (84%)

Query: 506 SMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPT 565
           S+NS AHF+M +ILRSEKE+ K+ +YQKK++IVED F PDL DPRFKEVFED DFAIDP+
Sbjct: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558

Query: 566 QPEYKNTQAMSTILKE 581
           QPE+K T AM  IL+E
Sbjct: 559 QPEFKETAAMKQILQE 574

>AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR145W (ENP2)
          Length = 689

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%)

Query: 546 LEDPRFKEVFEDHDFAIDPTQPEYK 570
           LED RFKE+FED DF +D    +YK
Sbjct: 480 LEDERFKEMFEDEDFLVDEDDYDYK 504

>TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4.77
           YGR145W
          Length = 698

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 4/39 (10%)

Query: 532 QKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYK 570
           ++ +++VE+     L+D RFKE+FED DF I+    +YK
Sbjct: 467 KRGDKVVENV----LQDDRFKEMFEDEDFQINEDDYDYK 501

>CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [2265
           bp, 754 aa] {ON} highly similar to uniprot|P48234
           Saccharomyces cerevisiae YGR145w ENP2
          Length = 754

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 546 LEDPRFKEVFEDHDFAIDPTQPEYK 570
           L D RFKE+FED DF +D    +YK
Sbjct: 538 LTDDRFKEMFEDEDFKVDENDYDYK 562

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,707,421
Number of extensions: 2150953
Number of successful extensions: 7918
Number of sequences better than 10.0: 66
Number of HSP's gapped: 8091
Number of HSP's successfully gapped: 106
Length of query: 629
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 513
Effective length of database: 40,180,143
Effective search space: 20612413359
Effective search space used: 20612413359
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)