Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.6315.425ON45845819910.0
YDR363W (ESC2)5.425ON45646013660.0
Smik_4.6285.425ON45846213041e-177
Suva_2.5345.425ON45236212851e-175
NCAS0F033105.425ON4423117642e-96
KAFR0E038705.425ON3963057305e-92
ZYRO0F09812g5.425ON4163177194e-90
NDAI0B056005.425ON4572947019e-87
TBLA0A037105.425ON4612685815e-69
SAKL0G02266g5.425ON4842885582e-65
Kpol_1027.265.425ON4433104978e-57
Kwal_55.214685.425ON4652944943e-56
KLTH0F16280g5.425ON4732884831e-54
TPHA0E018105.425ON4533054645e-52
CAGL0A02706g5.425ON3692884028e-44
Ecym_55245.425ON4152953653e-38
KNAG0C049805.425ON3452923588e-38
AER251W5.425ON4072593495e-36
TDEL0E020005.425ON4361193084e-30
KLLA0E21275g5.425ON3923112501e-22
KNAG0I026506.373ON2091100751.6
TPHA0E036501.51ON10561673.1
Ecym_10571.51ON9861663.6
CAGL0K05731g1.51ON10892655.3
KLTH0F01650g1.51ON9461638.2
Smik_4.7911.51ON10161638.9
YDR510W (SMT3)1.51ON10161639.2
Skud_4.7851.51ON10161639.7
Kpol_2002.451.51ON10477639.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.631
         (458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   771   0.0  
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   530   0.0  
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   506   e-177
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   499   e-175
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   298   2e-96
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   285   5e-92
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   281   4e-90
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   274   9e-87
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   228   5e-69
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   219   2e-65
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   196   8e-57
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   194   3e-56
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   190   1e-54
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   183   5e-52
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   159   8e-44
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   145   3e-38
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   142   8e-38
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   139   5e-36
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   123   4e-30
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   100   1e-22
KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {...    33   1.6  
TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON...    30   3.1  
Ecym_1057 Chr1 (104604..104900) [297 bp, 98 aa] {ON} similar to ...    30   3.6  
CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {...    30   5.3  
KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly s...    29   8.2  
Smik_4.791 Chr4 (1392239..1392544) [306 bp, 101 aa] {ON} YDR510W...    29   8.9  
YDR510W Chr4 (1469400..1469705) [306 bp, 101 aa] {ON}  SMT3Ubiqu...    29   9.2  
Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W...    29   9.7  
Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON} (93655.....    29   9.8  

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/458 (84%), Positives = 389/458 (84%)

Query: 1   MINHAKGITGPSIKLDSDNTSISGDSDDFFMENSFDEDEIDHSDESNRQNXXXXXXXXXX 60
           MINHAKGITGPSIKLDSDNTSISGDSDDFFMENSFDEDEIDHSDESNRQN          
Sbjct: 1   MINHAKGITGPSIKLDSDNTSISGDSDDFFMENSFDEDEIDHSDESNRQNVIVDSKVSVS 60

Query: 61  XXXXXXXXXXXXXXXXIXXXXXXXXXXXXXXLDGRKLIKCRPEKPSDRTRGRSMTKDSAV 120
                           I              LDGRKLIKCRPEKPSDRTRGRSMTKDSAV
Sbjct: 61  SSRYLSLGSSDEEDDDINQRSQSHNRSSSESLDGRKLIKCRPEKPSDRTRGRSMTKDSAV 120

Query: 121 ETSAPESTNEAKRLHGFXXXXXXXXXXXXXXXXPERKHKRQKCSLVDIYDENDDFFKELA 180
           ETSAPESTNEAKRLHGF                PERKHKRQKCSLVDIYDENDDFFKELA
Sbjct: 121 ETSAPESTNEAKRLHGFRSRSRSRSRSSIRSVSPERKHKRQKCSLVDIYDENDDFFKELA 180

Query: 181 KEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLV 240
           KEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLV
Sbjct: 181 KEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLV 240

Query: 241 KSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEK 300
           KSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEK
Sbjct: 241 KSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEK 300

Query: 301 NFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXXXXXXXLRNVKETQELEEN 360
           NFEATLESKLKEDEAALLVKQRQEIERKLEKKRN             LRNVKETQELEEN
Sbjct: 301 NFEATLESKLKEDEAALLVKQRQEIERKLEKKRNEQEESEYREFEFELRNVKETQELEEN 360

Query: 361 EIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKR 420
           EIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKR
Sbjct: 361 EIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKR 420

Query: 421 LPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIVD 458
           LPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIVD
Sbjct: 421 LPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIVD 458

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/460 (61%), Positives = 335/460 (72%), Gaps = 6/460 (1%)

Query: 1   MINHAKGITGPSIKLDSDNTSISGD-SDDFFMENSFDEDEIDHSDESNRQNXXXXXXXXX 59
           M   ++ I+ PSI LD DNTS S + SDDFFM+NS+D DEIDHSDESNRQ+         
Sbjct: 1   MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVTV 60

Query: 60  XXXXXXXXXXXXXXXXXIXXXXXXXXXXXXXXLDGRKLIKCRPEKPSDRTRGRSMTKDSA 119
                                           ++   + + +P+KPS RTRGRS+ K+S 
Sbjct: 61  PPSKHSTLTLSDSEDSDAKEQHQSLSRSSSKNVNIEDITEPKPDKPSGRTRGRSVMKESV 120

Query: 120 VETSAPES-TNEAKRLHGFXXXXXXXXXXXXXXXXPERKHKRQKCSLVDIYDENDDFFKE 178
           VE ++ ES  +E K                     P  K+KRQK SL+  YDENDDFFKE
Sbjct: 121 VEINSSESDLDEDKNF----PRSRSRSRSSIRSISPAGKYKRQKSSLLYTYDENDDFFKE 176

Query: 179 LAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDG 238
           LAKEAKK TTISKE TP+Q KRVYNIKFLSKLEGTINKAVQVKVLGKYEFS+ILPAALDG
Sbjct: 177 LAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDG 236

Query: 239 LVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEY 298
           L+KSYKIPKVM  IYKV NVTLYWNNAKLL FMTCNSL+I QDFENE+SDIDVTIVSKEY
Sbjct: 237 LMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEY 296

Query: 299 EKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXXXXXXXLRNVKETQELE 358
           EKNFEATLESKLKE+EAALL+K+RQE+ERKLEKKRN             L+NV+ETQE++
Sbjct: 297 EKNFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELKNVEETQEIK 356

Query: 359 ENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQ 418
           EN+ ++NTK LQ   SL GN+   E+V+++ALMGQDNKKI+V+VR STP  K+AEYYRIQ
Sbjct: 357 ENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQ 416

Query: 419 KRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIVD 458
           K+LPQK R++LLFDHDEL+M+EC+ADQDMEDEDM+DVI+D
Sbjct: 417 KQLPQKTRVKLLFDHDELDMNECIADQDMEDEDMVDVIID 456

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  506 bits (1304), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 278/462 (60%), Positives = 325/462 (70%), Gaps = 8/462 (1%)

Query: 1   MINHAKGITGPSIKLDSDNTSISGDS-DDFFMENSFDEDEIDHSDESNRQNXXXXXXXX- 58
           M   +K I    I L+SD+TS + DS D+FFM+NSFDEDEID +D S R++         
Sbjct: 1   MTRSSKSIGELPINLNSDSTSFTDDSSDNFFMDNSFDEDEIDDNDGSKRRSVIVDSKVSN 60

Query: 59  -XXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXXXLDGRKLIKCRPEKPSDRTRGRSMTKD 117
                                             ++     K + + PS RTRGRS  K+
Sbjct: 61  FPSDCLSSPSSSLDNEKNVASQANILPDRSSTENVNAEHTTKPKLDLPSGRTRGRSTMKE 120

Query: 118 SAVETSAPESTN-EAKRLHGFXXXXXXXXXXXXXXXXPERKHKRQKCSLVDIYDENDDFF 176
           S VE +  ES + + ++LH                  P  K+KRQK SL+  YDENDDFF
Sbjct: 121 SVVEINPRESKSIDDEKLHR----SRSRSRSSIRSLSPTGKYKRQKSSLLYAYDENDDFF 176

Query: 177 KELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAAL 236
           KELAKEAKK T++SKE TP+Q KRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAAL
Sbjct: 177 KELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAAL 236

Query: 237 DGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSK 296
           DGL KSYKIPKVM  IYKV NVTLYW NAKLL+FMTCNSL+I QDFENE+SDIDVTIVSK
Sbjct: 237 DGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSK 296

Query: 297 EYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXXXXXXXLRNVKETQE 356
           EYEKNFEA+LESKLKE+EAALLVK+ +EIERKLE+KRN             LRNVKE QE
Sbjct: 297 EYEKNFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFELRNVKEKQE 356

Query: 357 LEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYR 416
             ENE +IN K LQ +++L  NN D+EKV+K+AL GQDNKKI+VNVR STP  KVAEYYR
Sbjct: 357 RTENETVINIKNLQEDDNLLENNSDSEKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYR 416

Query: 417 IQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIVD 458
           IQK+LPQKARI+LLFDHD+L+M EC+ADQDMEDEDMIDVI++
Sbjct: 417 IQKQLPQKARIKLLFDHDKLDMHECIADQDMEDEDMIDVIIN 458

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  499 bits (1285), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 254/362 (70%), Positives = 291/362 (80%), Gaps = 3/362 (0%)

Query: 97  LIKCRPEKPSDRTRGRSMTKDSAVETSAPESTNEAKRLHGFXXXXXXXXXXXXXXXXPER 156
           ++K + +KPS RTRGRS+ K+S VE  + ES  + K    +                PE+
Sbjct: 94  IVKPKSDKPSGRTRGRSVIKESVVEIDSSESKTKKKE---YPHRSRSRSKSSVRSISPEQ 150

Query: 157 KHKRQKCSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINK 216
           K+KRQK SL++ YDENDDFFKELAKEAKK T+ISKE TP+QPKRVYNIKF SKLEGTINK
Sbjct: 151 KYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINK 210

Query: 217 AVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSL 276
           AVQVKVLGKYEFSRILPAALDGL+KSYKIPKVM  IYK  NVTLYWNNAKLL FMTCNSL
Sbjct: 211 AVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSL 270

Query: 277 NISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXX 336
           +I QDFENEISDID+TIVSKEYEKNFEATLESKLKE+E AL  K+RQE+E KLEKKRN  
Sbjct: 271 HIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQEMEMKLEKKRNER 330

Query: 337 XXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNK 396
                      LRNV+ET+EL+ NE  +N   L+  NS+K NNG  EKV+K+ALMGQDNK
Sbjct: 331 EESEFREFEFELRNVEETEELKANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNK 390

Query: 397 KIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVI 456
           KI+VNVRNSTP FKVAEYYRIQK+LPQKARI+LLFDHDELN++EC+ADQDMEDEDM+DVI
Sbjct: 391 KIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIADQDMEDEDMVDVI 450

Query: 457 VD 458
           V+
Sbjct: 451 VE 452

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  298 bits (764), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 164/311 (52%), Positives = 221/311 (71%), Gaps = 14/311 (4%)

Query: 159 KRQKCSLVDIY----DENDDFFKELAKEAKKITTI---SKEPTPE-QPKRVYNIKFLSKL 210
           KRQK +   I     DEND+FFKE+AKEAKK+ +I   SKE TP+ QPKRVY+I+FLS+L
Sbjct: 133 KRQKSTSTPILSLGPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQL 192

Query: 211 EGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNF 270
           +GTINK VQVKVLGK++F +ILP  L+GL+KSY IP V+   YKV NVTLYWNN KLLNF
Sbjct: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252

Query: 271 MTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVK----QRQEIE 326
           MTCNSLNI Q FENE++++D+ I+SKE E   E  L  KL  +E A  +K    + +E E
Sbjct: 253 MTCNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKE 312

Query: 327 RKLEKKRNXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVI 386
            +  K +               + +K+  EL++++  ++     GN ++ G++ +   ++
Sbjct: 313 GEKNKPKESKNTEYAKAIAEFEKELKDATELKDSQ--VHGGENDGNMNIDGSDNEKSSIM 370

Query: 387 KLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQD 446
           K+AL+G DNKKI+VNVRNSTP  K+AEYYR+QK+LPQ A+I+L+FDHDELN+ E V DQD
Sbjct: 371 KIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQD 430

Query: 447 MEDEDMIDVIV 457
           MEDEDMI+V++
Sbjct: 431 MEDEDMIEVVI 441

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  285 bits (730), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 153/305 (50%), Positives = 205/305 (67%), Gaps = 31/305 (10%)

Query: 159 KRQKCSLVDIY---DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTIN 215
           KRQK  + +     DENDDFFKELA  A+K +    E   ++PKR+YNI+F+SKL+G+IN
Sbjct: 116 KRQKSFISETAEDSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSIN 175

Query: 216 KAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNS 275
           K+V+VKVLGK+ FS+ILPAAL GL+ +YKIP +M  IY V NV LYWNNAKLLNFMTC+S
Sbjct: 176 KSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDS 235

Query: 276 LNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNX 335
           L+I   FENEIS++D+ IVSKE+ +  E   + K  ++EA L   +RQE           
Sbjct: 236 LSIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQEEAKL---ERQE----------- 281

Query: 336 XXXXXXXXXXXXLRNVKETQELEENEI---IINTKPLQGNNSLKGNNGDTEKVIKLALMG 392
                       +++V E  +    E    + +  P   N SL  +  D+E ++KLALMG
Sbjct: 282 -----------EIKDVDEGDDFVLKEFEAELRDVAPSNANLSLDTDGEDSEPLMKLALMG 330

Query: 393 QDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDM 452
           QDNKKI+VNVR+ST + K+ EYY+ QK L +  +++LLFDHDEL+++E V DQDMEDEDM
Sbjct: 331 QDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLNETVGDQDMEDEDM 390

Query: 453 IDVIV 457
           IDV+V
Sbjct: 391 IDVVV 395

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  281 bits (719), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 152/317 (47%), Positives = 209/317 (65%), Gaps = 43/317 (13%)

Query: 154 PERKHKRQKCS--LVDIY---DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLS 208
           P R+ KR + +  + + +   DEND+FFK++AK+       ++E TPEQP+R+YN++FLS
Sbjct: 129 PPRRTKRSRTTPNIANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLS 188

Query: 209 KLEGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLL 268
           KL+G+I+KAVQ+KVLGKY+F+ +LP+ L+G ++ YKIP VM  IY   NVTLYW  AKLL
Sbjct: 189 KLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLL 248

Query: 269 NFMTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDE--------AALLVK 320
           NFMTCNSL I Q FENEISDID+T++ KE E  FE  + S+L EDE           L  
Sbjct: 249 NFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGNLDA 308

Query: 321 QRQEIERKLEKKRNXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNG 380
           + +E E++L+   N                  ET EL + E                + G
Sbjct: 309 RVEEFEKELKNVDNSTTN-------------HETTELIDLE----------------DEG 339

Query: 381 DTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSE 440
           DT+ ++K+AL+G+DNKKI VNVRN+T L KVAEYYRI+K+LP+   I+L+FDH+ELN++E
Sbjct: 340 DTD-LMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNE 398

Query: 441 CVADQDMEDEDMIDVIV 457
            + DQDMEDEDMI+V+ 
Sbjct: 399 SIGDQDMEDEDMIEVLT 415

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  274 bits (701), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 146/294 (49%), Positives = 202/294 (68%), Gaps = 8/294 (2%)

Query: 154 PERKHKRQKCSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQ-PKRVYNIKFLSKLEG 212
           P RK  +   +L    DEND+FFKE+AKEAKKI +++KE TP++ PKR+YNI+F+SKL+G
Sbjct: 149 PIRKTPKLSSTLQMEPDENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDG 208

Query: 213 TINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMT 272
           T+NK VQVKVLGK++F +ILPAAL GL+K+Y IP V+   Y V NV+LYWN+AKLL+FMT
Sbjct: 209 TMNKCVQVKVLGKFQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMT 268

Query: 273 CNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAAL-----LVKQRQEIER 327
           CNSLNI Q FENE++++D+ ++SK+ E   E  +  KL +DE  +       K+ +EI+ 
Sbjct: 269 CNSLNIPQAFENEVTNVDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQE 328

Query: 328 KLEKKRNXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIK 387
           KL K+                  ++   EL+ N    +   +   N L    G+ + V+K
Sbjct: 329 KLAKEL-AKEEKENEVFEEFEHELENVSELKTNGYDADASTVNEANELALEEGNAD-VMK 386

Query: 388 LALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSEC 441
           +AL+GQDNKKIHVNVR +TP  KVAEYYRIQK+LPQ A+I+L+FDH+EL++ E 
Sbjct: 387 IALVGQDNKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSLYET 440

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  228 bits (581), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 125/268 (46%), Positives = 177/268 (66%), Gaps = 29/268 (10%)

Query: 198 PKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGN 257
           PKR+YN++F+SK+EGT++K VQVKVLGK+ FS+ILP AL    + YKIP V+   Y+V N
Sbjct: 214 PKRIYNVRFISKIEGTLDKKVQVKVLGKFPFSKILPPALKAFSEEYKIPNVLKQYYRVNN 273

Query: 258 VTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAAL 317
           VTLYWN++KLLNFMTCNSLNI Q +ENEISD+++ +++K  EK++E  +   LK      
Sbjct: 274 VTLYWNDSKLLNFMTCNSLNIPQIYENEISDVEIIVITKTNEKSYEDKINMSLK------ 327

Query: 318 LVKQRQEIERKLEKKRNXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQ-----GN 372
                Q IE+ L +K N             LR +K  +  E N I    K L+     G 
Sbjct: 328 -----QNIEQNLAQKSN---------EIKELRKLK-VESFEHNSIQEFEKELKELSQDGV 372

Query: 373 NSLKGNNGD---TEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRL 429
           ++ +  N D    E  IK+AL+ QDNKK++V VRNSTP  ++  Y+R QK+L +  +I+L
Sbjct: 373 DTKQTANIDDIPNESHIKIALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKL 432

Query: 430 LFDHDELNMSECVADQDMEDEDMIDVIV 457
           +FD++EL+++E V DQDMEDEDMI+V++
Sbjct: 433 IFDNEELDLNETVGDQDMEDEDMIEVVL 460

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  219 bits (558), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 183/288 (63%), Gaps = 25/288 (8%)

Query: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229
           D+ D FF E+ + A + +T+ +E +PE  KR Y I F+SKL+G+I+K ++VK  GK  F+
Sbjct: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280

Query: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289
           +ILP+ LD +VK+Y+IPK + ++YK+ NVTLYWN AK+LNFMTCNSL I Q++ +EI+D+
Sbjct: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340

Query: 290 DVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXXXXXXXLR 349
           D+T+VSKEYE  +EA  +  ++ + +         ++ K  KK +               
Sbjct: 341 DITLVSKEYEMKYEAEFKEMVENELSG------SSVDVKNVKKDDFAT------------ 382

Query: 350 NVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLF 409
           N  E Q LE++E   + +P    +S    +G     IKLAL+GQDNKK+ V  R+ST   
Sbjct: 383 NEYELQ-LEKSE---SAEPSLLKSSENIRDG---SFIKLALVGQDNKKMFVKARSSTLFK 435

Query: 410 KVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIV 457
           K+A+YY+  K LP   +++L FDH  L++ + V D +MEDEDMI+V +
Sbjct: 436 KIADYYKDVKNLPSFTKLKLTFDHVNLSLEDRVEDHEMEDEDMIEVAI 483

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  196 bits (497), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 185/310 (59%), Gaps = 11/310 (3%)

Query: 155 ERKHKRQKCSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTI 214
           E   KRQK    +  +ENDDF K +   +  +T +    +   P R+YNI F SKL+G++
Sbjct: 136 EEPSKRQK---YEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSV 192

Query: 215 NKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCN 274
           +K +Q +VLGK +FS I+   LD   K YK+ +V    YK   VT+YW+ AKLL FMTCN
Sbjct: 193 DKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCN 252

Query: 275 SLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDE------AALLVKQRQEIERK 328
           SL I  +F++EIS I++TI+SKE E+ FEA ++++L+ D+        +   +   IE +
Sbjct: 253 SLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQ 312

Query: 329 LEKKRNXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEK-VIK 387
           +++ +                +V  +Q   E+ + I+       + +     D ++ ++K
Sbjct: 313 IDENKKKYEEYENELNESIPISVP-SQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVK 371

Query: 388 LALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDM 447
           LAL+G DNKKI VN R +T  FK+AEYY + ++LP+  +++L+FD +++++   V DQD+
Sbjct: 372 LALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLDSMVKDQDV 431

Query: 448 EDEDMIDVIV 457
           ED+DMI+V++
Sbjct: 432 EDDDMIEVVI 441

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  194 bits (494), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 171/294 (58%), Gaps = 24/294 (8%)

Query: 163 CSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKV 222
            SL    +E++ FF+EL +EA + T+  KE +P   KRVYNIKFLS LEG++N  + VKV
Sbjct: 194 ISLAAEDNEDEKFFEELQREAGRTTSTLKEGSPATAKRVYNIKFLSNLEGSLNDKINVKV 253

Query: 223 LGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDF 282
            GK+ FS ILP AL  L+K YK+ K +   Y+  NV+LY N  K+LNFM CNSL+I  ++
Sbjct: 254 KGKHAFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNY 313

Query: 283 ENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXX 342
           E E+SD+ +T+VS++ E+ +  TLE    +   A     R+E   K+             
Sbjct: 314 EGEVSDVSMTLVSRDREQEYVKTLE----QSRHATPDLSREETSPKI----------PGF 359

Query: 343 XXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNV 402
                 ++++  +  E N ++ +T   + N+            IK+ALM QDNKKI+VNV
Sbjct: 360 SIEEFEKDLEGFESGESNNLLEDTPQTENNHG----------TIKIALMAQDNKKIYVNV 409

Query: 403 RNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVI 456
           R +T +  + E+YR  K L    R + +FD+++L +S  + D DMED D+I+V+
Sbjct: 410 RQTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQLSTKIDDLDMEDGDIIEVV 463

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  190 bits (483), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 162/288 (56%), Gaps = 23/288 (7%)

Query: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229
           DE+D FF+EL +EA +  +  KE +P   +R+YNIKF+S LEG+  + + VKV GK  F 
Sbjct: 206 DEDDKFFEELEREASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSFD 265

Query: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289
           +ILP AL  ++K YKIP  +  IY+   VTLY +  K+LNFM CNSL I  +F+ E+SD+
Sbjct: 266 QILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSDV 325

Query: 290 DVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXXXXXXXLR 349
            +TI+SK  E+NFEA  E     +          E+     +                LR
Sbjct: 326 CLTIISKGQEQNFEALYEQSKHSN---------HELVPAFIEPGTETPDFTVEEYEKELR 376

Query: 350 NVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLF 409
           NV    +  +N  + N  P Q   S+  N       I++ALM QDNKKI V  R  T   
Sbjct: 377 NV----DFNKNTSVQNQPPPQ---SVDDN-------IRIALMSQDNKKIIVTARPETTFA 422

Query: 410 KVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIV 457
            +AE+Y+    LP + ++ L FD++EL++   V+D D+ED+D+++V++
Sbjct: 423 ALAEHYQKLTSLPPQQQVLLFFDNEELHLDSKVSDADVEDDDIVEVVI 470

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  183 bits (464), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 179/305 (58%), Gaps = 19/305 (6%)

Query: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229
           D +D+FFK + + +K+ +T+S   TPE   R YNI ++SKL G+  + +Q KVLG   F+
Sbjct: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211

Query: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289
           ++LP  L+ L+K  KIP  + S+YK  NVTLYWN +KLLNFM C+SL I Q ++NEIS++
Sbjct: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISEL 271

Query: 290 DVTIVSKEYEKNFEATLESKLKEDEAA----------------LLVKQRQEIERKLEKKR 333
           ++ ++SKE E+ FE   + +L EDE                  +L     E E++LE   
Sbjct: 272 EIILISKEEEQKFEEQFKMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELE-NW 330

Query: 334 NXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQ 393
           N               +   +  ++ N+  +N   +  N S    +G T  VIK++LM  
Sbjct: 331 NSKDFNVTNDVLDVSNDENSSNNVKGND-SMNLIEISDNESSIKEHG-TSNVIKISLMSN 388

Query: 394 DNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMI 453
           DNKKI VNVR+ST + K+ +Y++  K L    RI+++FDHD L++   + D D+EDED++
Sbjct: 389 DNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIGDNDIEDEDIV 448

Query: 454 DVIVD 458
           ++I++
Sbjct: 449 EMIIE 453

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  159 bits (402), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 158/288 (54%), Gaps = 41/288 (14%)

Query: 168 IYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYE 227
           + DEND FF+ +AK ++ +          Q K VY ++F+S ++GT  K+VQVK LG + 
Sbjct: 120 VEDENDLFFQSIAKRSQSLPVQDGSGAVRQDK-VYYVQFISHVDGTKGKSVQVKALGSHP 178

Query: 228 FSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEIS 287
           FS+++ AAL GL++++++P VM  +Y+  +V  YWN AK+L FMTC++L + Q + ++  
Sbjct: 179 FSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYL 238

Query: 288 DIDVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXXXXXXX 347
           +I +  V +E +      LE ++ E           E ER                    
Sbjct: 239 EIQLVPVKEEAQ-----YLEQEVFE-----------EPERA-----PTPEEDAEEEFERE 277

Query: 348 LRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTP 407
           LR+ KE +       +++               ++E+V+++AL GQDNKK++VNV+ +T 
Sbjct: 278 LRDAKEVR-----APVVDL--------------ESEEVLRVALQGQDNKKVYVNVKPTTT 318

Query: 408 LFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDV 455
             ++ EYYR QK+LP+  +I L  D + L+    V  QD+EDEDM++V
Sbjct: 319 FARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKSQDIEDEDMLEV 366

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  145 bits (365), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/295 (30%), Positives = 157/295 (53%), Gaps = 28/295 (9%)

Query: 175 FFKELAKEAKKITTISKEPT--------PEQPKRVYNIKFLSKLEGTINKAVQVKVLGKY 226
           F  E+ +EA++ +++    +         E    +YN+ F+SKLEG+ NK + V++ GK 
Sbjct: 136 FLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLEGSTNKRINVRITGKK 195

Query: 227 EFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEI 286
           +FS  LP AL   VK YKI   +   Y++ NV +Y    ++  FMTC+S NI++ + +  
Sbjct: 196 KFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFNIAEAYASSS 255

Query: 287 SDIDVTIV----SKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXX 342
            DI+V IV    + E+E  ++  +E+K+K    ++           +E   +        
Sbjct: 256 IDIEVYIVPNELASEFEIQWKQKIETKMK--RVSISASPVDLDSDGIEFGNDDFRVNEYE 313

Query: 343 XXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNV 402
                 R++ ET+    N+I   +KP  GN           ++IK+ L+G DNKK++VNV
Sbjct: 314 KDLANARSLDETEIQYSNQI---SKPDDGN-----------ELIKVVLLGSDNKKVYVNV 359

Query: 403 RNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIV 457
           + +T   K+AE+YR  K+LP   ++ L FDHD+++ S  +    +ED+D+++V V
Sbjct: 360 KPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSV 414

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  142 bits (358), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 142/292 (48%), Gaps = 53/292 (18%)

Query: 170 DENDDFFKELAK------EAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVL 223
           D+ + FF+EL +      E  +  T S  P+P     VY ++F S+LEGT+ K+VQVKV+
Sbjct: 99  DDEEQFFQELLRARTQSVEPAETATTSTVPSP-----VYRVRFQSQLEGTLGKSVQVKVI 153

Query: 224 GKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFE 283
           G      +LP+ L  LV++ ++P+V+   Y  G V +Y   A++L FM CNSL + Q+FE
Sbjct: 154 GTRPLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFE 213

Query: 284 NEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNXXXXXXXXX 343
           NE+ ++DV +                L  +  A  V   QE     E   +         
Sbjct: 214 NEVLEVDVVL--------------RALNLETPASDVSGGQEATNGTEAAASVP------- 252

Query: 344 XXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVR 403
                              +    P    +   GN      ++K+AL+  DN++++V V 
Sbjct: 253 -------------------VPVPAPATAASESPGN--PAPALMKIALLSADNRRLYVKVH 291

Query: 404 NSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDV 455
             TP  ++ EYYR+++ LP  A ++L  D ++++    +++ D+ED D++++
Sbjct: 292 GGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQVSPETHISELDLEDGDVLEI 343

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  139 bits (349), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 137/259 (52%), Gaps = 17/259 (6%)

Query: 200 RVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVT 259
           RVYN+ F+S++EG+ N+ V VKV G+ +F+  L  AL    K + I K +   Y+   V 
Sbjct: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVK 223

Query: 260 LYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLV 319
           +Y    ++  FMTC+S NI + +    +DI+V IV  +    FE   + K +E    L  
Sbjct: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSN 283

Query: 320 KQRQEIERKLEKKRNXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNN 379
               E+   +E   +              R++ ET EL   E               G  
Sbjct: 284 SSFLEVMDDIEDDNDDFLVNEYEKALVNARSLNET-ELAVRE---------------GTP 327

Query: 380 GD-TEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNM 438
            D + +++K+ L+G DNKK+ ++VR +T L KVAE+YR+ K LP   ++ L+FDH+E+++
Sbjct: 328 ADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDL 387

Query: 439 SECVADQDMEDEDMIDVIV 457
            + + + D+ED D+I+V+V
Sbjct: 388 DDTICNIDIEDGDIIEVVV 406

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  123 bits (308), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 88/119 (73%)

Query: 178 ELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALD 237
           E  +E ++++T S     +  ++++N+ FLSKLEGT+++A+Q+KVLGKY+F+ IL + L+
Sbjct: 167 EPVEETRQMSTSSPAKGTKARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLE 226

Query: 238 GLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSK 296
            +V+ +KIP  ++  Y V NVTLYWN  KLL FMTC+SL IS    NE+++I+VT+VSK
Sbjct: 227 RVVEEFKIPYPVMHQYTVDNVTLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSK 285

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 146/311 (46%), Gaps = 40/311 (12%)

Query: 157 KHKRQKCSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINK 216
           + K  +   ++  DE  DF KE+   AK           +  KR+YNI F+S LEG+ +K
Sbjct: 107 RFKEDQTPSINTQDEMFDFLKEVTSNAKNHADTHN--NGKVTKRIYNINFISTLEGSQDK 164

Query: 217 AVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSL 276
            V VKV G   F  ILP  +   ++SYKIP+ +   Y    + L+    ++L F  C+SL
Sbjct: 165 RVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSL 224

Query: 277 NISQDFENEISDIDVTIVSK--------EYEKNFEATLESKLK----EDEAALLVKQRQE 324
            I +      + +D+ IV          EY++  E+ L+S L     E++  L    R E
Sbjct: 225 RIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLDESNIEEQDPLEQPARDE 284

Query: 325 IERKLEKKRNXXXXXXXXXXXXXLRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEK 384
             +  EK+               L +  +  E  ++ I +    ++ +NS          
Sbjct: 285 KFKLFEKE---------------LESAPKLAERTDDVIDLLDSDIESSNS---------- 319

Query: 385 VIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVAD 444
            I+L L+ + NK+  ++V  +T   ++A  Y+    L + A + L+FD++ELN +  V  
Sbjct: 320 -IRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLS 378

Query: 445 QDMEDEDMIDV 455
           + +E++D++++
Sbjct: 379 EGLEEDDILEI 389

>KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {ON}
            Anc_6.373 YCR093W
          Length = 2091

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 19/100 (19%)

Query: 243  YKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI---------DVTI 293
            +++ +VM+   +  N+  YW N  LLN  T      S+DF ++I+++         +  I
Sbjct: 1966 FQVIEVMVEQLRYPNIHTYWFNYVLLNMFT------SKDFGDQIAEVQELILRCILERII 2019

Query: 294  VSKEYEKNFEATLESKLKEDEAALL----VKQRQEIERKL 329
            V+K +           L +DE  LL    +K   EIE+ L
Sbjct: 2020 VNKPHPWGVSILTTQLLNQDEVNLLELEFIKTVPEIEKML 2059

>TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON}
           Anc_1.51 YDR510W
          Length = 105

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 395 NKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMID 454
           + +I   ++ +TPL ++ E +  +++  +   +R L+D   L   +   D DMED D+I+
Sbjct: 37  SSEIFFKIKRTTPLKRLMEAF-AKRQGKEMDSLRFLYDGIRLQADQTPEDLDMEDNDIIE 95

Query: 455 V 455
            
Sbjct: 96  A 96

>Ecym_1057 Chr1 (104604..104900) [297 bp, 98 aa] {ON} similar to
           Ashbya gossypii AFR697C
          Length = 98

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 395 NKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMID 454
           + +I+  +R +TPL ++ E +  +++  +   +R L+D   +   +   D DMED D+I+
Sbjct: 25  SSEIYFKIRRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGVRIQPDQSPDDLDMEDNDIIE 83

Query: 455 V 455
            
Sbjct: 84  A 84

>CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {ON}
           highly similar to uniprot|Q12306 Saccharomyces
           cerevisiae YDR510w SMT3 ubiquitin-like protein
          Length = 108

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 47/92 (51%), Gaps = 7/92 (7%)

Query: 365 NTKP-LQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQ 423
           + KP LQG    +G+   +E  I L +    + +I   ++ +TPL ++ E +  +++  +
Sbjct: 14  DVKPDLQG----QGDAPKSETHINLKV-SDGSSEIFFKIKKTTPLRRLMEAF-AKRQGKE 67

Query: 424 KARIRLLFDHDELNMSECVADQDMEDEDMIDV 455
              +R L+D   +   +   D DMED D+I+ 
Sbjct: 68  MDSLRFLYDGLRIQADQTPEDLDMEDNDLIEA 99

>KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly
           similar to uniprot|Q12306 Saccharomyces cerevisiae
           YDR510W
          Length = 94

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 395 NKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMID 454
           + +I   ++ +TPL ++ E +  +++  +   +R L+D   +   +   D DMED D+I+
Sbjct: 26  SSEIFFKIKRTTPLRRLMEAF-AKRQGKEMDSLRFLYDGVRIQADQTPEDLDMEDNDIIE 84

Query: 455 V 455
            
Sbjct: 85  A 85

>Smik_4.791 Chr4 (1392239..1392544) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 395 NKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMID 454
           + +I   ++ +TPL ++ E +  +++  +   +R L+D   +   +   D DMED D+I+
Sbjct: 32  SSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIE 90

Query: 455 V 455
            
Sbjct: 91  A 91

>YDR510W Chr4 (1469400..1469705) [306 bp, 101 aa] {ON}
           SMT3Ubiquitin-like protein of the SUMO family,
           conjugated to lysine residues of target proteins;
           regulates chromatid cohesion, chromosome segregation,
           APC-mediated proteolysis, DNA replication and septin
           ring dynamics; phosphorylated at Ser2
          Length = 101

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 395 NKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMID 454
           + +I   ++ +TPL ++ E +  +++  +   +R L+D   +   +   D DMED D+I+
Sbjct: 32  SSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIE 90

Query: 455 V 455
            
Sbjct: 91  A 91

>Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 395 NKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMID 454
           + +I   ++ +TPL ++ E +  +++  +   +R L+D   +   +   D DMED D+I+
Sbjct: 32  SSEIFFKIKKTTPLRRLMEAF-AKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIE 90

Query: 455 V 455
            
Sbjct: 91  A 91

>Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON}
           (93655..93969) [315 nt, 105 aa]
          Length = 104

 Score = 28.9 bits (63), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 379 NGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNM 438
            G +E  I L +    + +I   ++ +TPL ++ E +  +++      +R L+D   L  
Sbjct: 19  TGGSETHINLKV-SDGSSEIFFKIKRTTPLKRLMEAF-AKRQGKDVDSLRFLYDGVRLQS 76

Query: 439 SECVADQDMEDEDMIDV 455
            +   D DMED D+I+ 
Sbjct: 77  DQTPDDLDMEDNDIIEA 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,632,279
Number of extensions: 1924929
Number of successful extensions: 8869
Number of sequences better than 10.0: 89
Number of HSP's gapped: 9134
Number of HSP's successfully gapped: 94
Length of query: 458
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 345
Effective length of database: 40,524,141
Effective search space: 13980828645
Effective search space used: 13980828645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)