Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.5865.352ON64264227840.0
Smik_4.5795.352ON66766719610.0
YDR320C (SWA2)5.352ON66866819430.0
Suva_2.4895.352ON65966218610.0
NDAI0C043205.352ON70672010271e-130
Kpol_339.135.352ON6865729601e-120
CAGL0H07095g5.352ON6615349361e-117
TDEL0E027505.352ON5645689261e-116
KAFR0C018505.352ON6465219261e-115
ZYRO0D10186g5.352ON6355509241e-115
KNAG0C055005.352ON5856578741e-108
TBLA0H019705.352ON8403598041e-95
SAKL0G08822g5.352ON5825517686e-93
TPHA0E011105.352ON6933437749e-93
Kwal_34.159775.352ON5975337076e-84
KLTH0H14872g5.352ON6235436512e-75
Ecym_81815.352ON6613086349e-73
KLLA0B10197g5.352ON6212986143e-70
AGR352C5.352ON6485555849e-66
NCAS0F028705.352ON7002931539e-10
TBLA0I023106.328ON116118930.002
YCR060W (TAH1)6.328ON11162890.006
Kpol_1028.516.328ON11766880.008
SAKL0A01672g6.328ON12874880.011
Ecym_20906.328ON17264890.012
NCAS0H008306.21ON33881890.029
Skud_3.1356.328ON11862830.034
KLLA0C08910g6.328ON11559810.075
TDEL0B051402.152ON599113830.19
Kwal_47.178272.401ON52353800.43
ZYRO0G06512g2.152ON604111790.56
KAFR0F007202.152ON608112790.63
KAFR0J025706.328ON12159721.2
Smik_3.1596.328ON11562711.3
NDAI0I004406.328ON12859702.1
Skud_11.2581.262ON28738723.6
NCAS0F034903.481ON51276723.6
CAGL0K09240g6.328ON14251694.0
TPHA0D032203.481ON513131724.0
YOR007C (SGT2)6.21ON34681714.3
Kpol_1048.212.152ON597111724.4
TPHA0D038606.328ON12059674.6
ZYRO0D16390g7.217ON39832715.1
Smik_11.2821.262ON29134705.5
KNAG0H035302.152ON614111716.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.586
         (642 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...  1077   0.0  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   759   0.0  
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   753   0.0  
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   721   0.0  
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   400   e-130
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   374   e-120
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   365   e-117
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   361   e-116
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   361   e-115
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   360   e-115
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   341   e-108
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   314   1e-95
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   300   6e-93
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   302   9e-93
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   276   6e-84
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   255   2e-75
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   248   9e-73
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   241   3e-70
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   229   9e-66
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    64   9e-10
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    40   0.002
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    39   0.006
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    39   0.008
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    39   0.011
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    39   0.012
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    39   0.029
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    37   0.034
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    36   0.075
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    37   0.19 
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    35   0.43 
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    35   0.56 
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    35   0.63 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    32   1.2  
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   1.3  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    32   2.1  
Skud_11.258 Chr11 (468037..468900) [864 bp, 287 aa] {ON} YKR025W...    32   3.6  
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    32   3.6  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    31   4.0  
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    32   4.0  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    32   4.3  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    32   4.4  
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    30   4.6  
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    32   5.1  
Smik_11.282 Chr11 (475173..476048) [876 bp, 291 aa] {ON} YKR025W...    32   5.5  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    32   6.3  

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score = 1077 bits (2784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/642 (84%), Positives = 545/642 (84%)

Query: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60
           MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP
Sbjct: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60

Query: 61  LIPPSKVSFSAAPLVXXXXXXXXXXXXXXXXXXXVNIDDDFDEIFGSDAIAATGGLXXXX 120
           LIPPSKVSFSAAPLV                   VNIDDDFDEIFGSDAIAATGGL    
Sbjct: 61  LIPPSKVSFSAAPLVPSNSTSSANTASNTPSPAPVNIDDDFDEIFGSDAIAATGGLQQVD 120

Query: 121 XXXXXXXXXXXXXXXXXXXMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHR 180
                              MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHR
Sbjct: 121 QDSHDDDDGDDALVDEVKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHR 180

Query: 181 DRIAREKSNDIKIKKPGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENNRLKS 240
           DRIAREKSNDIKIKKPGLF            IATDFFNKGKELMDQWTSFPPEENNRLKS
Sbjct: 181 DRIAREKSNDIKIKKPGLFNNTDSDNNNLLSIATDFFNKGKELMDQWTSFPPEENNRLKS 240

Query: 241 HLNLEDESNDYDLSLEENPCNSGGDNLDEDLLTDFEAKIDITKRASKNVAXXXXXXXXXX 300
           HLNLEDESNDYDLSLEENPCNSGGDNLDEDLLTDFEAKIDITKRASKNVA          
Sbjct: 241 HLNLEDESNDYDLSLEENPCNSGGDNLDEDLLTDFEAKIDITKRASKNVASSPSPSFDIP 300

Query: 301 XXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSEFK 360
                GKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSEFK
Sbjct: 301 IDEDSGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSEFK 360

Query: 361 AKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLA 420
           AKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLA
Sbjct: 361 AKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLA 420

Query: 421 LALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNF 480
           LALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNF
Sbjct: 421 LALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNF 480

Query: 481 FDDKIMQGKRRCQNFISPPLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVKEQELENA 540
           FDDKIMQGKRRCQNFISPPLVR                            KVKEQELENA
Sbjct: 481 FDDKIMQGKRRCQNFISPPLVRKSTPVKKTTPTLKKPAPDPSPAPIDIPSKVKEQELENA 540

Query: 541 KLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKA 600
           KLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKA
Sbjct: 541 KLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKA 600

Query: 601 VAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
           VAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN
Sbjct: 601 VAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/667 (60%), Positives = 463/667 (69%), Gaps = 25/667 (3%)

Query: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60
           MSDPFAHLL S KNKDSA E K+ T +S++ PS   SVV D+ KTDK   +SLHS+SA P
Sbjct: 1   MSDPFAHLLTSFKNKDSAAESKKETLRSSNSPSLPDSVVADISKTDKTINDSLHSISASP 60

Query: 61  LIPPSKVSFSAAPLVXXXXXXXXXXXXXXXXXXXVNIDDDFDEIFGSDAIAATGGLXXX- 119
           LIP SKV FS  PLV                    +IDDDF+E+FG+   AAT  L    
Sbjct: 61  LIPSSKVGFSVPPLVSSNNTISANSTNSSPRPPLDHIDDDFNELFGNGTTAATDTLQKVN 120

Query: 120 ----XXXXXXXXXXXXXXXXXXXXMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSK 175
                                   MEIARLMSLGLS++KAT+FYNDDITYERYL++LKS 
Sbjct: 121 DDYCRNNEGRKSNGDEALVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERYLKVLKSN 180

Query: 176 QKKHRDRIAREKSNDIKIKKPGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEEN 235
           QKK +DR ARE   D+  ++  L             IAT+FFNKGKEL+DQWTSFPPEEN
Sbjct: 181 QKKSKDRTARESPGDVNFERSELSNNFGSENNNLFSIATNFFNKGKELVDQWTSFPPEEN 240

Query: 236 NRLKSHLNLEDESNDYDLSLEENPCNS-------------GGDNLDEDLLTDFEAKIDIT 282
           +RL +H NL ++S DYD  LE +P N                +NLDEDLLTDFE KI+IT
Sbjct: 241 DRLNNHPNLRNKSEDYDSPLENDPYNGFSIEDDKSEKGLLSENNLDEDLLTDFETKIEIT 300

Query: 283 KRASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNA 342
           KR   +V                 +KE  ++++LLDFS  N TKS+S+E+N+LF  + N 
Sbjct: 301 KRTVSDVDPSPSPSSGILIEENPLRKEPLVENNLLDFSEGNVTKSNSSESNSLFNGNRNP 360

Query: 343 VSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIA 402
            S +PISDIELSGY+EFKAKG+  FKNGDYVNSLQEYEK+LNSLPSNHPLRII LSNIIA
Sbjct: 361 NSAIPISDIELSGYNEFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIA 420

Query: 403 SQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHL 462
           SQLKVGEYSKSI NS +ALALFPP KA+W+N IS+SDPQRSFNDIWPKIMIRRAESFEHL
Sbjct: 421 SQLKVGEYSKSIENSSMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHL 480

Query: 463 ESFKNALETYQELISRNFFDDKIMQGKRRCQNFISPPLVR-------XXXXXXXXXXXXX 515
           ESF NALETYQELI++NFFD+KIMQGKRRCQNFI+PP V+                    
Sbjct: 481 ESFSNALETYQELINKNFFDEKIMQGKRRCQNFINPPPVKKFSPVKKATSTQSPTEKSTP 540

Query: 516 XXXXXXXXXXXXXXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLT 575
                          K+K+QELENAKLALYDKVF +I +WK  K DDIRHLL+NLS LLT
Sbjct: 541 TSSSSTSSNSPDTTSKIKKQELENAKLALYDKVFERISSWKNDKGDDIRHLLANLSGLLT 600

Query: 576 WCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKF 635
           WCNWKD+ MQDLVMPK+VKI YMKAVAKTHPDKIPESLSLENKMIAEN+FS+LSIAWDKF
Sbjct: 601 WCNWKDIPMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENVFSSLSIAWDKF 660

Query: 636 KQQNDIN 642
           KQQNDIN
Sbjct: 661 KQQNDIN 667

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/668 (59%), Positives = 457/668 (68%), Gaps = 26/668 (3%)

Query: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60
           MSDPFAHLL SLKNKDSA+  KETT QS++ PS +GS V DV +TDK   +SLHS+SA P
Sbjct: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60

Query: 61  LIPPSKVSFSAAPLVXXXXXXXXXXXXXXXXXXXVNIDDDFDEIFGSDAIAATGGLXXXX 120
           LIP  KV FSA PLV                    N DDDF+++FG   +  T  +    
Sbjct: 61  LIPSPKVDFSAPPLVPTNSTTKSNTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKPD 120

Query: 121 XXXXXXXXXX-----XXXXXXXXXMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSK 175
                                   MEIARLMSLGLS+++ATEFY +D+TYERYLEILKSK
Sbjct: 121 EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK 180

Query: 176 QKKHRDRIAREKSNDIKIKKPGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEEN 235
           QK+  D   R+K + IK++K GL             +ATDFFNKGK+L+DQWTSFPPE N
Sbjct: 181 QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN 240

Query: 236 NRLKSHLNLEDESNDYDLS----------LEENPCNSG---GDNLDEDLLTDFEAKIDIT 282
           +RL ++    D+  DYDL            E+N         DN D+DLLTDFE KIDIT
Sbjct: 241 DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT 300

Query: 283 KRASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNA 342
           KR + +V+                + E  ++DSLLDFS  N T S S E++TLF E+SN 
Sbjct: 301 KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT 360

Query: 343 VSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIA 402
            S +PISDIELSGY+EFKAKG +LFKNGDY+NSLQEYEK+LN+LP NHPLRII LSNIIA
Sbjct: 361 DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA 420

Query: 403 SQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHL 462
           SQLK+GEYSKSI NS +AL LFP +KA W NKISNSDP+RSFNDIWPKIMIRRAESFEHL
Sbjct: 421 SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480

Query: 463 ESFKNALETYQELISRNFFDDKIMQGKRRCQNFISPPLVRXXXXXXXXXXXXXXXXXXXX 522
           ESFK ALETYQELI +NFFDDKIMQGKRRCQ+FI+PP V+                    
Sbjct: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKKQN 540

Query: 523 XXXXX--------XXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLL 574
                           ++K++ELENAKLALYDKVF KI +WK GK+DDIRHLL+NLS LL
Sbjct: 541 LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL 600

Query: 575 TWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 634
           TWCNWKDVSMQDLVMPK+VKI YMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK
Sbjct: 601 TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 660

Query: 635 FKQQNDIN 642
           FK QNDIN
Sbjct: 661 FKLQNDIN 668

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/662 (58%), Positives = 446/662 (67%), Gaps = 23/662 (3%)

Query: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60
           MSDPFAHLL SLKNKDS TE K+TT Q+ D  ++S +VV     T +GN + LHS SA P
Sbjct: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFTATSATVVASAATTTQGNNDGLHSFSASP 60

Query: 61  LIPPSKVSFSAAPLVXXXXXXXXXXXXXXXXXXXVNIDDDFDEIFGSDAIAATGGLXXXX 120
           +IP S VSFS APLV                    NI+DDF+E+FGS+ +A    L    
Sbjct: 61  MIPASNVSFSVAPLVPSNSNSNANSASNTPTPSPANIEDDFNELFGSNTMATANELQQVD 120

Query: 121 XXXXXXXXXXX----XXXXXXXXMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQ 176
                                  MEIARLMSLGLS++KAT+FYN D+TYE+YLEI K KQ
Sbjct: 121 QNYYGNSDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQ 180

Query: 177 KKHRDRIAREKSNDIKIKKPGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENN 236
           KKH+DRIA  +      K   LF            +ATDFFNKGKEL+DQWTSFPPE N+
Sbjct: 181 KKHKDRIASHRPTGSSSKNASLFNNASPNNNNLFSMATDFFNKGKELVDQWTSFPPEAND 240

Query: 237 RLKSHLNLEDESNDYDLSLEENPCNSGGDNLDED-------------LLTDFEAKIDITK 283
           RL +++N+ED+ + Y+L LE +  +       ED             LLTDFE KIDITK
Sbjct: 241 RLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKDLLGGNDLDDDLLTDFETKIDITK 300

Query: 284 RASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAV 343
           + +K+                  K+E   +D+LLDFS +N +   ST N+ +  E  N  
Sbjct: 301 KDAKDTTPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNIS---STNNSAISREDGNTN 357

Query: 344 SVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIAS 403
            V PISDIELSGY+EFKAKG +LFKNGDYVNSLQEYEK+LNSLP  HPLRII LSNIIAS
Sbjct: 358 PVAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIAS 417

Query: 404 QLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLE 463
           QLK+GEYSKSI NSD ALALFP  K+SWN+KIS SDPQRS+NDIWPKIMIRRAESFEHLE
Sbjct: 418 QLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLE 477

Query: 464 SFKNALETYQELISRNFFDDKIMQGKRRCQNFISPPLVRXXXXXXXXXXXXXXXXXXXXX 523
           SFKNALETYQEL++RNFFDDKIMQGKRRCQ+F++P   R                     
Sbjct: 478 SFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARKPSPVKKTTPTPAPMKKPTST 537

Query: 524 XXXX---XXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWK 580
                     +VKEQELENAKLALYD V  KIG WK GK+DDIRHLL+NLS LLTWCNWK
Sbjct: 538 PSPAPVDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWK 597

Query: 581 DVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQND 640
           DVS+Q+LVMPKKVKI YMKAVAKTHPDKIP+SLSLENKMIAEN+F+TLS AWDKFKQQND
Sbjct: 598 DVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKFKQQND 657

Query: 641 IN 642
           IN
Sbjct: 658 IN 659

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  400 bits (1027), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 270/720 (37%), Positives = 376/720 (52%), Gaps = 92/720 (12%)

Query: 1   MSDPFAHLLASLKN-KDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAW 59
           MSDPFA LL S KN +++      T + +  L +++ S        +K +  SL + +  
Sbjct: 1   MSDPFASLLTSFKNGQNTTNNNTTTDTDTKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60

Query: 60  PLIPPSKVS------FSAAPLVXXX-----XXXXXXXXXXXXXXXXVNIDDDFDEIFGSD 108
           PLIP S+ +       ++ PL+                         +ID  FD IF S 
Sbjct: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFD-IFTST 119

Query: 109 AIAATGGLXXXXXXXXXXXXXXXXXXXXXXXMEIARLMSLGLSVQKATEFYNDDITYERY 168
                                          ME+ARLMSLGLS+ +A ++Y+  I YE  
Sbjct: 120 PPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYEDI 179

Query: 169 LEILKSKQKKHRDRIAREKSN----DIKIKKPGLFXXXXXXXXXXXX---------IATD 215
             I K ++KK + +  R K+N    +   K   LF                     +ATD
Sbjct: 180 --IRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATD 237

Query: 216 FFNKGKELMDQWTSFPPEENNRL-KSHLNLEDESNDYDLSLEENPCNSGGDNLD------ 268
              KGKEL+DQ T++P EENNRL K    +++E N +      +P ++   +L       
Sbjct: 238 ILYKGKELVDQLTAYP-EENNRLYKYREPIDNEENPFLQEGSRSPASARSPSLSGSHVAS 296

Query: 269 -------------------ED----LLTDFEAKIDITKR---ASKNVAXXXXXXXXXXXX 302
                              ED    L+ DF+ K+ I  +    +KN+             
Sbjct: 297 ASAKPSSKPSYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSMAKNIPPSITPDTT---- 352

Query: 303 XXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSN--------------AVSVVPI 348
                 E++ +++LLDF   +   +  + N ++  ++++               ++ VPI
Sbjct: 353 ------ETNNNNALLDFDGLSTVTAPGSSNISVNKKNTSSSSATSPSPSPASITIATVPI 406

Query: 349 SDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVG 408
           S IELSG+ EFK +G+ LFKNGDYV++LQEYEK+LN+LP  HPLRII  SNIIA+QLK+G
Sbjct: 407 SHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIG 466

Query: 409 EYSKSIVNSDLALALFPPAK--ASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFK 466
           EYSKSI +  +AL+LFP  K  ++WN  I +S PQRSF DIW K+++R+AES+EHLE++K
Sbjct: 467 EYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYK 526

Query: 467 NALETYQELISRNFFDDKIMQGKRRCQNFISPP----LVRXXXXXXXXXXXXXXXXXXXX 522
            AL++YQ+LI   F + KIM GKRRCQ  ++PP      +                    
Sbjct: 527 LALDSYQKLIENGFTNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKDTTTA 586

Query: 523 XXXXXXXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDV 582
                     K +E+EN K+ALYDKV  KI  WK  K+ DIRHLLSNLS +LTWC+W  +
Sbjct: 587 SVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSI 646

Query: 583 SMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
           S  DLVMPKKVKI Y+KA+ KTHPDKIPESL LENKMIAEN+FS LS+AWDKFK  N++N
Sbjct: 647 SQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  374 bits (960), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/572 (41%), Positives = 311/572 (54%), Gaps = 93/572 (16%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKS----NDIK--- 192
           MEIA+LMSLGL + +AT  Y++ I YE     L SK +    RI  +++    NDI+   
Sbjct: 139 MEIAKLMSLGLDIDEATTHYDNGILYE----TLVSKIRTSNSRITAQRNDSGRNDIRAEP 194

Query: 193 IKKP----GLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLE--- 245
           ++KP    G F              T  F+KGK+L+DQWT +  EE++RL  + N +   
Sbjct: 195 MRKPRTSNGSFTF------------TGLFDKGKQLVDQWTVYH-EEDDRLFRNTNFKVDP 241

Query: 246 -----DESNDYDLSLE-------------------------------------------E 257
                  S DYD S E                                           E
Sbjct: 242 STNTYQPSGDYDTSDENPFNQQSRYDIASSKTTSTDSQTRNYHDKKTSINNKAHERIAKE 301

Query: 258 NPCNSGGDNLDEDLLTDFEAKIDITKRASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLL 317
            P N+   NLD  LL D    I   K +S+NV+                K+  ++   ++
Sbjct: 302 TPINNQPANLD--LLNDDFISI---KLSSENVSTNLTNLEQAKSKQATSKQ--AISKPIV 354

Query: 318 DFSPE-NFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSL 376
           + +P+ N T  D     T     + ++  VPIS+IEL GY EFK +G   FK GDYV +L
Sbjct: 355 NVAPKANNTLLDFDSPTTAVHSPAASLPKVPISEIELLGYKEFKERGTENFKTGDYVTAL 414

Query: 377 QEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLALALFPPAKASWNNKIS 436
           + Y+K+LN+LP  HPLRII  SNI+AS  K GEY KSI  S  AL  FP  +  WN  I 
Sbjct: 415 EAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEISTSALEQFPGDQKQWNEFIQ 474

Query: 437 NSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNFFDDKIMQGKRRCQNFI 496
           +S+PQR++ DIWPKI+++RAE+FEH+ES++NALETYQ++I +NFF+DK+M GKRRCQ+ I
Sbjct: 475 DSEPQRTYKDIWPKIVLKRAEAFEHIESYENALETYQQMIEKNFFNDKVMSGKRRCQHVI 534

Query: 497 SP-PLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVK-----EQELENAKLALYDKVFG 550
           +P    +                            K+K     E E+E+ +LALYD V  
Sbjct: 535 NPVKPTKSNSSALPRQTNTKPKKESNQNKAYENVEKLKQKNKLEAEIESQRLALYDSVEA 594

Query: 551 KIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIP 610
           +I  WK  K+DDIRHLLSNL  +LTW NW  V   DLVMPKKVKI YMKAVA+THPDKIP
Sbjct: 595 QINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPSDLVMPKKVKITYMKAVARTHPDKIP 654

Query: 611 ESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
             L LE KMIAENIFS LS AW+KFK+ N++N
Sbjct: 655 SDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  365 bits (936), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/534 (38%), Positives = 310/534 (58%), Gaps = 40/534 (7%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKKPGLF 199
           ME+A+LMSLGL++ KA+ +Y   IT+E   ++L+ +++K  +   +  + D K     + 
Sbjct: 137 MELAKLMSLGLNIDKASSYYERGITFE---DVLRKRKQKASNGYQQRSNIDRKQGGGEIR 193

Query: 200 XXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLEDESNDYDLSLEENP 259
                       + +   NKGKEL++Q +++  EEN R+      E+ S       +EN 
Sbjct: 194 NIFDTRGSGSESLFSGILNKGKELVNQLSTYTEEENERMNKFKGYEEYSMSETYLEKENS 253

Query: 260 CNSG------GDNLDEDLLTDFEAKID-----ITKRASKNVAXX--XXXXXXXXXXXXXG 306
            + G       + + +        K +     I KR +                      
Sbjct: 254 MDPGVFSRSSQEKIPQRAARPSHEKSNSSRSKINKRMTTEAPHKPFNDDDQSSLIESKDS 313

Query: 307 KKESSM--DDSLLDFSPENFTKS---DSTENNTLFGESSNAVSVVPISDIELSGYSEFKA 361
            +ESSM  + +LLDF  +N   S   +++  NT+      +++ +PIS IE+SGY+EFKA
Sbjct: 314 SRESSMPGEGTLLDFDNDNHASSPVVNTSNQNTV------SITQIPISHIEISGYNEFKA 367

Query: 362 KGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLAL 421
           +G   FKNGDY ++++EYEK+LN+LP  HPLRII  SNIIAS++K+G++S+S+V++  A+
Sbjct: 368 RGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAM 427

Query: 422 ALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNFF 481
            L P  K+ W   I NSDP RS+NDIWPKI++R+AES+E +E +K AL+ YQ L+ +N F
Sbjct: 428 KLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYKLALDAYQTLLEKNLF 487

Query: 482 DDKIMQGKRRCQNFI--------SPPLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVK 533
            +K++ GKRRCQ+ +        +PP                               K+K
Sbjct: 488 SEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPAPRRAPTVNRQTEVVNKKSVNAEKLK 547

Query: 534 EQ-----ELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLV 588
           ++     +LE+ K+ALYDKV G I +WK GK+DDIR+LLSNL  ++TW  WK V   +LV
Sbjct: 548 KENERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLLSNLQAVITWTQWKPVQSSELV 607

Query: 589 MPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
           +P+KVKI YMKAVAK HPDK+P SL+LE +MIAE++FSTLS +W+ FK+ NDIN
Sbjct: 608 LPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFSTLSDSWENFKKSNDIN 661

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  361 bits (926), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 213/568 (37%), Positives = 302/568 (53%), Gaps = 62/568 (10%)

Query: 95  VNIDDDFDEIFG--------------SDAI-AATGGLXXXXXXXXXXXXXXXXXXXXXXX 139
           +N+ DD DE+FG               D+  AA                           
Sbjct: 39  INVHDDLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQKVEKSLEESPEMVVDEVKD 98

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKKPGLF 199
           ME+A+LMSL L + +AT++Y   + YE+      S+Q++ ++ I R +    + ++    
Sbjct: 99  MEVAKLMSLNLDIDQATDYYERGVLYEQL-----SRQRREQELIRRREQMLRQQQQQQQT 153

Query: 200 XXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLEDESNDYDLSLEENP 259
                       +A+    KG++ +DQ++ FP +E +RL      +D   +   S+E   
Sbjct: 154 PEEKFDSGSFFSLASGILEKGRQFVDQFSGFP-QEQDRLTRVRVEQDLPVERPKSVEPPT 212

Query: 260 CNSGGDNLDEDLLTDFEAKIDITKRASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLLDF 319
                 NL    L +F+ KI++ +                               +LLDF
Sbjct: 213 VEVEEGNL----LGEFQEKINLEEPKRSPTPPPQA--------------------TLLDF 248

Query: 320 SPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEY 379
                       +N    E    ++ VPIS +E+SGY E+K +G   FK GDYV++ QEY
Sbjct: 249 ------------DNGTPPERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEY 296

Query: 380 EKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSD 439
           EK+LNSLP NH LRI+  SN+ A+  KVGEY + + + + AL +FP     W+  I +S 
Sbjct: 297 EKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQ 356

Query: 440 PQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNFFDDKIMQGKRRCQNFISPP 499
           P R+F ++WPKI+ RRAE+FEH+E+++ AL+ YQ LI +N F+DKIM GKRRCQ  ++P 
Sbjct: 357 PIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPT 416

Query: 500 LVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVKEQ----ELENA-KLALYDKVFGKIGT 554
             +                            +VK++    EL+ A K ALYD VF +I +
Sbjct: 417 EPKATSPNRSPTPVPKVSEDTKQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIES 476

Query: 555 WKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLS 614
           WK GK DDIRHLL+NLS +LTWC+WK VS  DLVMPKKVKI YMKAVAKTHPDKIP SL 
Sbjct: 477 WKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLE 536

Query: 615 LENKMIAENIFSTLSIAWDKFKQQNDIN 642
           LE +MIAE++FS+LS+AW+KFK  NDIN
Sbjct: 537 LEKRMIAEDVFSSLSVAWEKFKLANDIN 564

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  361 bits (926), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/521 (40%), Positives = 307/521 (58%), Gaps = 23/521 (4%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREK----SNDIKIKK 195
           MEIA+LMSLGLS++KA  +Y+  I+Y+  L+ L  +++++  R  R+      N  K  K
Sbjct: 131 MEIAQLMSLGLSIEKANSYYSKGISYDTLLKKL--ERRRYGSRKGRDTPTFGGNTNKDDK 188

Query: 196 PGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLEDESNDYDLSL 255
                           +A+  FNKGKE +DQ T++ PEE +RL  + ++ + S+     L
Sbjct: 189 AYAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAY-PEETDRLSRYRDISEISSMK--PL 245

Query: 256 EENPCNSGG---DNLDEDLLTD-FEAKIDITKRASKNVAXXXXXXXXXXXXXXXGKKESS 311
            ++P    G   D + +   TD  +A     ++ S   +                K+E S
Sbjct: 246 RKSPGIVDGFDMDRISQHQDTDKGKAPTREVQQESPPPSHDLLDNFQNNLKLDDNKEELS 305

Query: 312 MDDSLLDFSPENFT--KSDSTENNTLFGESSNA-----VSVVPISDIELSGYSEFKAKGA 364
            +  LLD   ++ T  KS S  +++L  +  N      +  +PIS IELSGY+E+ ++G+
Sbjct: 306 KESVLLDIDNDDSTLLKSKSLTSDSLLFQDENVLENSNIPKIPISSIELSGYNEYNSRGS 365

Query: 365 TLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLALALF 424
           + FKNGDY+++L+EYEK+LN+LP +HPLRII  SNI A++LK+GEYS  +  +D AL LF
Sbjct: 366 SFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLF 425

Query: 425 PPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNFFDDK 484
           P     WN  I +S+P +S+ DIW K+++R+AE+ EHLE+F+ A + Y  LI  N F DK
Sbjct: 426 PKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDK 485

Query: 485 IMQGKRRCQNFISPPLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVKEQELENA---K 541
           IM GKRRCQ  ++P + +                            K + ++ E     K
Sbjct: 486 IMDGKRRCQKVLNPEIAKKTQQKPSSSKPAAVPTPSTQKYESVERIKEQNRQEEENEAEK 545

Query: 542 LALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAV 601
           L LYD V  KI  WK  K +DIRHLL+NL  +LTW  WK +S+ DLVMPKKVK+ Y+KA+
Sbjct: 546 LKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAI 605

Query: 602 AKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
           AKTHPDKI  SL+LE+KMIAEN FSTLS+AWDKFK++N++N
Sbjct: 606 AKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  360 bits (924), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 220/550 (40%), Positives = 302/550 (54%), Gaps = 84/550 (15%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAR------------EK 187
           ME+A+LMSLG S+  A   Y   + Y+  +E  K K+K HR  + R            E 
Sbjct: 123 MEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERK-KKKLHRRELQRLMAETNWERETPET 181

Query: 188 SNDIKIKK-PGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENN-------RLK 239
           +ND   K    LF            IA+  FNKGK+++D  + FP EEN+       RLK
Sbjct: 182 NNDESGKNNVDLFS-----------IASGIFNKGKKIVDHLSLFPDEENDLLPYRSERLK 230

Query: 240 SHLNLEDE-------------------SNDYDLSLE-ENPCNSGGDNLDEDLLTDFEAKI 279
                E E                     +Y+ +L+ + P     +    DLL DF+ K+
Sbjct: 231 QRQTFEPELPRRPRKDPTPNPRTQGTPQVEYESTLQYQQPTIQAQEG---DLLGDFQDKL 287

Query: 280 DITKRASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGES 339
            +  + +K+ +                  +S  +++LLDF   +   ++ST  +      
Sbjct: 288 SLRSQGNKSTSAS----------------QSPSNETLLDF---DAPSANSTSASVSVSRQ 328

Query: 340 SNAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSN 399
            + V  VPI++IELSGY+EFK +   LFK GDYV +LQEYEK+ N+LP  HPLRII  SN
Sbjct: 329 GSVVPTVPITEIELSGYNEFKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSN 388

Query: 400 IIASQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESF 459
           ++ASQLK G+Y +S+  + +AL LFP     W   I NS+P +++ D+WPKI+ RRAE+F
Sbjct: 389 LMASQLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAF 448

Query: 460 EHLESFKNALETYQELISRNFFDDKIMQGKRRCQNFISP--PLVRXXXXXXXXXXXXXXX 517
           EH E+F+ A   YQ LI +NF  +KIM GKRRCQ  ++P  P V                
Sbjct: 449 EHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQKVLNPEKPKV---VQKKPASSKSPSP 505

Query: 518 XXXXXXXXXXXXXKVKEQ-----ELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQ 572
                        KVKE      E +  + ALYD+V+ +I  W+ GK +DIRHLLSNL  
Sbjct: 506 SPNHSDKKYKNLQKVKEDNRKQAEEDTQRHALYDRVYDQIKLWESGKANDIRHLLSNLQT 565

Query: 573 LLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAW 632
           +LTW +WK VS  DLVMPKKVKI Y++AVAKTHPDKI +SL L+ KMIAE++FS+LS AW
Sbjct: 566 VLTWVDWKPVSPADLVMPKKVKITYLRAVAKTHPDKISDSLPLDKKMIAESVFSSLSSAW 625

Query: 633 DKFKQQNDIN 642
           +KFK +NDIN
Sbjct: 626 EKFKSENDIN 635

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  341 bits (874), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 218/657 (33%), Positives = 322/657 (49%), Gaps = 87/657 (13%)

Query: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60
           M+DPFA LL S K        K   S+S +  +  G   P    T        H+V   P
Sbjct: 1   MADPFASLLTSFKESSKKPAAK---SESPEPVTVKGGGEPATAST--------HAVFMEP 49

Query: 61  LIPPS--KVSFSAAPLVXXXXXXXXXXXXXXXXXXXVNIDDDFDEIFG-SDAIAATGGLX 117
           LIP    + SF   P                        DD FD++F   ++  A     
Sbjct: 50  LIPSGGGQGSFQQKP---------------------AGSDDKFDDVFDLFNSEPAAEVKE 88

Query: 118 XXXXXXXXXXXXXXXXXXXXXXMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQK 177
                                 ME+A++MSLG  + KA EFY+  + Y+  +E    +  
Sbjct: 89  PDRVPSDESVHENVAVVDEVRDMEVAKIMSLGFGIDKAVEFYDSGVLYDELVERRDRRHI 148

Query: 178 KHRD--RIAREKSNDIKIKKPGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEEN 235
           +H       RE +   K      F             A    NKGK+ +D  T++P EE 
Sbjct: 149 RHTHTRHSVREVTEVPKHTGNSFFSA-----------AVGLLNKGKDFVDHLTAYPDEEG 197

Query: 236 NRLKSHLNLEDESNDY-DLSLEENPCNSGGDNLDEDLLTDFEAKIDITKRASKNVAXXXX 294
           +RL  +     ++  + D +         G+   + L+ DFE+K+ IT + +  +A    
Sbjct: 198 DRLARYRQEHADAAHFGDFT--------PGEREQDLLIDDFESKVSITDKHNPPLA---- 245

Query: 295 XXXXXXXXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSVVPISDIELS 354
                           + D++LLDF  ++ +KS S  +  +    S  + +VPIS +ELS
Sbjct: 246 ---------------QTPDETLLDFGEDDSSKSGSRTH--VNNSPSIELPIVPISTMELS 288

Query: 355 GYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSI 414
           GY+EF+AKG  LFK GDY  ++ EYEK+LN+LP  HPLRII +SN++   LK+GEY+K +
Sbjct: 289 GYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCL 348

Query: 415 VNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQE 474
             + LAL L P  +++W + I  S+P+R++ DIW K+++R AE+ EH E++  A + YQ 
Sbjct: 349 KLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQL 408

Query: 475 LISRNFFDDKIMQGKRRCQNFISP---------PLVRXXXXXXXXXXXXXXXXXXXXXXX 525
           L++    ++K+M GKRRCQ  ++P         P                          
Sbjct: 409 LVANGITNEKVMDGKRRCQKVLNPPSKVERKGTPTPTPQVVTPARTPDPATSKTVYENAE 468

Query: 526 XXXXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQ 585
                  K ++ E AK+  YD V  K+  WKG KE DIR+LLS+L++++TW  W  VS  
Sbjct: 469 RVKRANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGDIRYLLSHLTEIVTWVEWNSVSQA 528

Query: 586 DLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
           DLVMPK+VKI Y+KA+AK HPDKIP  L LE +MIA+ +FS L+ AW+KFK  N+IN
Sbjct: 529 DLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADTVFSVLNNAWEKFKLDNNIN 585

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  314 bits (804), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 227/359 (63%), Gaps = 27/359 (7%)

Query: 306 GKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSV---------------VPISD 350
           G +ESS+   L DF  ++ T     +NN+    S N V+                VPIS 
Sbjct: 486 GSQESSI---LFDFDSDSVTSMHIKQNNS--ATSKNIVTAKADEKDLVNTLPIVKVPIST 540

Query: 351 IELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEY 410
           IELSGY+EF+A G   FK GDY ++L EY+K+LN+LP  HPLR+I  SNI+A+QLKVGEY
Sbjct: 541 IELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEY 600

Query: 411 SKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALE 470
           S+S+ + D+AL LFP     W   I +SDPQ+++ +IWPKI++R+AE+ EH+E ++ A +
Sbjct: 601 SQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQIAYD 660

Query: 471 TYQELISRNFFDDKIMQGKRRCQNFISP--PLVRXXXXXXXXXXXXXXXXXXXXXXXXXX 528
           +YQ L+ +N F+DKIM GKRRCQ  ++P  P ++                          
Sbjct: 661 SYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRISSAKQSTASTSSINVNKN 720

Query: 529 XXKV-----KEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVS 583
             ++     KE+E E  +L L D V  KI  W   KEDDIR+LLSN+  +LTW NWK ++
Sbjct: 721 VERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWSNWKAIN 780

Query: 584 MQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
             DLVMPKKVK+ YMKAVAKTHPDKI + LS+ENKMIAE+IFS LS+AW+KFK  N +N
Sbjct: 781 ASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKTANKMN 839

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 55/109 (50%), Gaps = 26/109 (23%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKK---- 195
           MEIA+LMSLGLS+ KA  +YN     +  L  +++ QK  R      K +D KI+     
Sbjct: 223 MEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQA-QKHKRQSNYSTKYDDTKIRNSLDK 281

Query: 196 -------PG---LFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEE 234
                  PG   LF            IA+DF NKGK ++DQ++++  E+
Sbjct: 282 LNNSASPPGNNVLF-----------SIASDFLNKGKGIVDQFSTYHEED 319

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  300 bits (768), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 198/551 (35%), Positives = 288/551 (52%), Gaps = 98/551 (17%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHR-DRIAREKSNDIKIKKPGL 198
           MEIARLMSLG+S+++A ++Y   I Y+   ++L+ + +KH   R A   S D       L
Sbjct: 82  MEIARLMSLGVSLERALQYYERGILYD---DVLRRRHEKHEAKRQAAAASRDFT----KL 134

Query: 199 FXXXXX----------XXXXXXXIATDFFNKGKELMDQ---------------WTSFPPE 233
           F                      +AT  FNKGK  M++               + SF   
Sbjct: 135 FDNGSSNILGSDGSDDKQQDLFSMATGLFNKGKSFMEERLKQRQQHQHQQDPAFRSFADH 194

Query: 234 ENNRLKSHLNLEDESNDY---DLSLEENPCNSGGDNLDE------DLLTDFEAKIDITKR 284
            ++RL+S    + E + Y    +  E  P  +  D ++E      DLL  F+ ++ ++  
Sbjct: 195 ISSRLESPTRAKYERSQYTDKQVGSERRPEPAPVDEVEEPSVIEGDLLGGFD-ELSVS-- 251

Query: 285 ASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLLDF----SPENFTKSDSTENNTLFGESS 340
                                    S   ++LLDF    SP                 SS
Sbjct: 252 -------------------------SPQHETLLDFEQAVSPPQL-------------RSS 273

Query: 341 NAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNI 400
           +A   + IS +ELSG+ EFK+KG  LF +G+Y ++L EYEK+LN+LPS HPLRII LSNI
Sbjct: 274 SARPPISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISLSNI 333

Query: 401 IASQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFE 460
           I +QLK+GE S ++ N + AL L    +      I  S+P +S+ + W KI +R+AE+ E
Sbjct: 334 ITTQLKLGESSSALQNIETALRLI--GEDELQLTIPASNPPKSYREFWGKITMRKAEALE 391

Query: 461 HLESFKNALETYQELISRNFFDDKIMQGKRRCQNFISPP--------LVRXXXXXXXXXX 512
           H+E++ +ALE Y+ LI + F   K+M GKRRCQ  +SPP        + R          
Sbjct: 392 HVENYVSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVARKKPSPNVLDT 451

Query: 513 XXXXXXXXXXXXXXXXXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQ 572
                               + ++LEN K  L DKV  +I +W  GKE+D+R LL++L +
Sbjct: 452 SSSTLPKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKENDLRQLLADLPK 511

Query: 573 LLTWCN-WKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIA 631
           +LTW N WK V+  DLVMPKKVKI Y+KA+AKTHPDK+ +SL +E+KM+AE+IFS LS A
Sbjct: 512 VLTWSNDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLAEDIFSILSKA 571

Query: 632 WDKFKQQNDIN 642
           W+ FK++N+I+
Sbjct: 572 WEAFKEENNIS 582

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  302 bits (774), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 213/343 (62%), Gaps = 13/343 (3%)

Query: 309 ESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSEFKAKGATLFK 368
           E   D++LLDF  E+ +   S  N ++       + V+ I+ IELSGY+EFK +G   FK
Sbjct: 353 ERIQDNTLLDFGNEDLS---SPANVSISSSGQECIPVISINQIELSGYNEFKDRGTEYFK 409

Query: 369 NGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSDLALALFPPAK 428
            GDYV++ ++YEK+LNSL   HPLRII  SN++AS LK G+Y+  I  S  AL LFP   
Sbjct: 410 KGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKES 469

Query: 429 ASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISRNFFDDKIMQG 488
             W+N I NS+P +++ +IW K++ RRAE+FE +E+++ A ++YQ LI  N F++KIM G
Sbjct: 470 KLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIENNIFNEKIMAG 529

Query: 489 KRRCQNFISP-----PLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVKEQ-----ELE 538
           K RCQ  ++P     PL +                            K++EQ     + E
Sbjct: 530 KLRCQKVLNPETHNKPLKKLVATTAETKTSQTKNIVNTQSTSSGNLKKIQEQNKRTEKYE 589

Query: 539 NAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYM 598
             K ALYD V  K+  W  GK+DDIRHLLS L +++TW  W +V+  DLVMPKKVKI Y+
Sbjct: 590 EEKEALYDVVEQKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLVMPKKVKITYL 649

Query: 599 KAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDI 641
           KAVAKTHPDK+P +L  E++M+AENIFS LS  W+KFK  N+I
Sbjct: 650 KAVAKTHPDKLPSNLDTESRMLAENIFSILSKNWEKFKVDNNI 692

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  276 bits (707), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 184/533 (34%), Positives = 270/533 (50%), Gaps = 66/533 (12%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKK---P 196
           MEIARLMSLGLS  KAT +Y   + Y+  LE  + +Q++ R+   ++ S++ +  +   P
Sbjct: 101 MEIARLMSLGLSCTKATSYYERGLLYDDLLE--RKRQQRTREEAPQKTSDEGRFTQGSEP 158

Query: 197 GLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENNRLKS--HLNLEDESNDYDLS 254
            L             +A+ + N+G+  +D          ++LK   + N     +DY  S
Sbjct: 159 DLLS-----------VASSWLNRGRTFLD----------SKLKQIQNDNGTQSYSDYISS 197

Query: 255 LEENPCNSGG---------DNLDEDL------LTDFEAKIDITKRASK-NVAXXXXXXXX 298
             E+  ++G           N+D  +      L D   +  +  + S  N          
Sbjct: 198 RMESSAHTGSRLRPTSDIPTNIDRSISFQDLSLADQPNESSVPAQVSPMNSEILPPLVNI 257

Query: 299 XXXXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNAVSVVPISDIELSGYSE 358
                  G +E+S D  L+DF        D+   +     SS   + + +S +E   Y E
Sbjct: 258 GDDVPVSGPEEASAD-LLVDF--------DAPSGHDAV--SSPVAASIAMSALEFHSYQE 306

Query: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418
           FK KG   F  GDY  + Q +EK++NSLP +HPLR I LSN+I  +LK+GEY K+I +S 
Sbjct: 307 FKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSS 366

Query: 419 LALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELISR 478
           +AL L   AK   ++ I  SDP ++F +IW KI+  +AE++EH+E +  AL+ YQ LI R
Sbjct: 367 VALKLISCAK--LDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKR 424

Query: 479 NFFDDKIMQGKRRCQNFISP---------PLVRXXXXXXXXXXXXXXXXXXXXXXXXXXX 529
                K+M+G+RRCQ  + P         PL                             
Sbjct: 425 GAASRKVMEGRRRCQKIVEPEKFVQRSKTPLSTSPSVSRKDVAVAATSQVPSEKLERVQN 484

Query: 530 XKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVSMQDLVM 589
              KE+ELE  K  L+DKV  ++  W    EDD+R LLS    ++ W +WK+VS  DLVM
Sbjct: 485 INKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDWKNVSTADLVM 544

Query: 590 PKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDIN 642
           PK+VKI Y+KAV KTHPDKI +S  LE KM+AEN+F  LS AW+ FK+QN ++
Sbjct: 545 PKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQNKLS 597

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  255 bits (651), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 175/543 (32%), Positives = 270/543 (49%), Gaps = 65/543 (11%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIARE-----KSNDIKIK 194
           MEIARLMSLGL   KA E+Y   I YE+ ++    +QK+   R  R      +S+ ++ +
Sbjct: 106 MEIARLMSLGLDWDKAAEYYERGILYEQVVD----RQKRRTARTERPLRTSPQSSQLREE 161

Query: 195 KPGLFXXXXXXXXXXXXIATDFFNKGKELMD-QWTSFPPEENNR-LKSHLNLEDESNDYD 252
           +  LF            +A+++ NKG+  +D +      E ++R    +++    SN   
Sbjct: 162 ESDLFS-----------VASNWLNKGRTFLDSKLKQVQTEYSDRSFSDYISSRSGSNASP 210

Query: 253 LSLEENPC---NSGGDNLDEDLLTDF-----EAKIDITKRASKNVAXXXXXXXXXXXXXX 304
             L+E+         D   + + T F     E +     RA+  V               
Sbjct: 211 PWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGPRANSPVPSTKSPAVSVASASH 270

Query: 305 XGKKESSMDDSLLDFSPENFTKSDSTENNTL--FGESSNAVSVVP------ISDIELSGY 356
               E+  D S    +P     S   +N+ L  F   +   S VP      ++++E   +
Sbjct: 271 PVYSETPGDKSEAPPNP-----SPVQDNDLLIDFEAPALKTSNVPATYSPNLTELERHSF 325

Query: 357 SEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVN 416
            EFK KGA  F+ GDY  + Q YEK+LNSLP  HPLR++  SNII  +LKVGEY +++ +
Sbjct: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385

Query: 417 SDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQELI 476
           +  AL L P  + S N+ I N +P +++ + W KIM  +A +FE +E+++ ALETYQ+LI
Sbjct: 386 ASSALKLIP--QGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLI 443

Query: 477 SRNFFDDKIMQGKRRCQNFISPPLVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXKV---- 532
                  K+++ +R+CQ  I+   +                             KV    
Sbjct: 444 EAGVTSSKVLEARRQCQKAIA---LEKKPVSVARKSETSIPKAAVTKKPSGRPAKVTLEN 500

Query: 533 -------------KEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNW 579
                        KE++LE  +  L+D+V   I  W  G +D++R LL+    ++ W NW
Sbjct: 501 PSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTIVDWVNW 560

Query: 580 KDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQN 639
           K+VS  DLV+PKK K+ Y+KAVAKTHPDKI +S  L+ KMIAEN+F  LS AW+ FK++N
Sbjct: 561 KEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWETFKEKN 620

Query: 640 DIN 642
            ++
Sbjct: 621 QLS 623

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  248 bits (634), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 185/308 (60%), Gaps = 13/308 (4%)

Query: 346 VPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQL 405
           VPIS IE+SGY EF   G   F+NGDY N+ Q+Y K+LN+LP  HPLRI+  SNII +QL
Sbjct: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415

Query: 406 KVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESF 465
           K+GE+++S+ N + A  L     +S +  I  ++P +++ + W KI+ ++AE  E+LE +
Sbjct: 416 KIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHY 473

Query: 466 KNALETYQELISRNFFDDKIMQGKRRCQ---NFISPPLVRXXXXXXXXXXXXXXXXXXXX 522
             AL  Y+ LIS+  FD KI++GK RCQ      S P                       
Sbjct: 474 DEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSI 533

Query: 523 XXXXXXXXKVKE--------QELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLL 574
                   K +E        +ELE  K  L+DKV  KI +W  GKE D+RHLLS LS +L
Sbjct: 534 PERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLSRLSLVL 593

Query: 575 TWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 634
           TW NW  +   DLV+PKKVKI YMKA++K HPDK+P +L LE+KM+AE+IFS L  AW+ 
Sbjct: 594 TWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNV 653

Query: 635 FKQQNDIN 642
           FK  NDIN
Sbjct: 654 FKLNNDIN 661

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  241 bits (614), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/298 (44%), Positives = 182/298 (61%), Gaps = 5/298 (1%)

Query: 348 ISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKV 407
           ISD EL+ ++EFK  G   F +GDY N+L E+EK+ N+LP  HPLRII LSNI++ QLK+
Sbjct: 325 ISDFELTSFNEFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPLRIISLSNIVSCQLKL 384

Query: 408 GEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKN 467
           GE SK++ +  LAL L   A  + ++ I +S P+R+F  +  KI ++ AE  EHLE+++ 
Sbjct: 385 GENSKALESVKLALDLSDLAPNA-SDIIEHSVPERTFKQMINKIQLKHAEIQEHLENYEK 443

Query: 468 ALETYQELISRNFFDDKIMQGKRRCQNFISP----PLVRXXXXXXXXXXXXXXXXXXXXX 523
           AL  Y  LIS    + K+M GKRRC+  ++P    P                        
Sbjct: 444 ALSLYANLISNGITEQKVMDGKRRCEKIVNPEKFKPAKEKISSPTIPVRSKTSISADTVA 503

Query: 524 XXXXXXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLLTWCNWKDVS 583
                    K++E E  +L L DKV  KI  W    E+D+R+LL+NL  LL W +WK+VS
Sbjct: 504 VNRVKEENKKQEEEEEERLRLRDKVDEKISEWTKNNENDLRYLLANLEPLLWWASWKEVS 563

Query: 584 MQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKQQNDI 641
            QDLVM KKVKI Y+KA+AKTHPDKIP   SLE  MIAEN+++ L+ AW+ FK QN+I
Sbjct: 564 PQDLVMTKKVKICYLKAIAKTHPDKIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 12/89 (13%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDI---KIKKP 196
           MEIARLMSLGLS  KA  +Y+  I YE  +E  K K+K+ R  +    +ND    +++K 
Sbjct: 140 MEIARLMSLGLSFDKAVHYYDKGIMYEELIESQK-KRKQSRSNV----NNDFGQQQLRK- 193

Query: 197 GLFXXXXXXXXXXXXIATDFFNKGKELMD 225
                          +A++ FN GKE ++
Sbjct: 194 ---QESRDSSPAFISVASNLFNMGKEFIE 219

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  229 bits (584), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 170/555 (30%), Positives = 262/555 (47%), Gaps = 84/555 (15%)

Query: 140 MEIARLMSLGLSVQKATEFYNDDITYE---------------------RYLEILKSKQKK 178
            E+A+LMSLGL +  A ++Y+    YE                     R  +  +S+   
Sbjct: 126 FELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSDFCRSRDFG 185

Query: 179 HRDRIAR----EKSNDI----KIKKPGLFXXXXXXXXXXXXIATDFFNKGKELM-DQWTS 229
               + R    E+ +D+      + P                A++ FN+G++ + DQ  +
Sbjct: 186 RGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIEDQLAT 245

Query: 230 FP----------PEENNRLKSHLNLED----ESNDYDLSLEENPCNSGGDNLDEDLLTDF 275
                        + N R  +H    D    ++ND    +   P  +     + DLL  F
Sbjct: 246 HARTSASSRSTLSDSNERFSNHTQESDYSVNQTNDQAHLIHTQPTAA-----EVDLLEGF 300

Query: 276 EAKIDITKRASKNVAXXXXXXXXXXXXXXXGKKESSMDDSLLDFSPENFTKSDSTENNTL 335
            A  ++ +  S                   G K    ++SL+DFS E  +KS        
Sbjct: 301 -ADTEVVQHQS---------TLEVPRMQAAGVKS---EESLIDFSSEGPSKS-------- 339

Query: 336 FGESSNAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRII 395
                N VS+ P+   ELSGY +F    A  +K GDY  + Q+Y K+LN+LP  HPLRII
Sbjct: 340 -AAQLNYVSITPL---ELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRII 395

Query: 396 GLSNIIASQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRR 455
            LSNII +QLK+GE+++S+ N + A+ L       ++ +I ++ P R++ + W KI+ ++
Sbjct: 396 ALSNIITTQLKIGEHTESMKNINSAVELL--QDVPFDAQIQDTSPPRTYKEFWQKILAKK 453

Query: 456 AESFEHLESFKNALETYQELISRNFFDDKIMQGKRRCQ--------NFISPPLVRXXXXX 507
           AE  E  ++++ AL  YQ+LISR +    I+ GK RCQ        N  S P        
Sbjct: 454 AEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTATTQGDR 513

Query: 508 XXXXXXXXXXXXXXXXXXXXXXXKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLL 567
                                      ++ EN +  L+DKV  +I TW  GK  D+RHLL
Sbjct: 514 KNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDLRHLL 573

Query: 568 SNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFST 627
             L  LL W N   +   DLVMPK+VK++Y+KAV+KTHPDK+P++L LE KM+AE++F T
Sbjct: 574 LGLPALLPWLNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFIT 633

Query: 628 LSIAWDKFKQQNDIN 642
           L+ AW  FK++N ++
Sbjct: 634 LTKAWGVFKEENSLS 648

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 111/293 (37%), Gaps = 90/293 (30%)

Query: 1   MSDPFAHLLASLKN-KDSA-TEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSA 58
           MSDPFA LL S KN KD+A +E  ++   +T  P+S+                ++  +S 
Sbjct: 1   MSDPFADLLTSFKNGKDNAKSEPTKSNISATQKPASASP--------------NISQLSI 46

Query: 59  WPLIPPSKVSFSAAPLVXXXXXXXXXXXXXXXXXXXVNIDDDFDEIFG------------ 106
            PL+P      S +P                     V+I DDFD++FG            
Sbjct: 47  TPLVP------SPSP--------------------NVSIHDDFDDLFGVSLGQNGTNTIV 80

Query: 107 --------SDAIAATGGLXXXXXXXXXXXXXXX----------XXXXXXXXMEIARLMSL 148
                   +D I A   +                                 ME+ARLMSL
Sbjct: 81  PKQTVKTETDDIDAAFNVFQATPSQSIKPEASAPNDIDRDEEEYVVDEVKDMEVARLMSL 140

Query: 149 GLSVQKATEFYNDDITYERYLEILKSKQK-KHRDRI-------------AREKSNDIKIK 194
           GLS+ +A + Y+  I YE  L  +K  Q+ K R ++             A  + ND    
Sbjct: 141 GLSIDEANDHYDKGILYENLLAKMKQNQRQKERRKVETQPTKRNSNPPSANNRLNDRFDN 200

Query: 195 KPGLFXXXXXXXXXXXXIATDFFNKGKELMDQWTSFPPEENNRLKSHLNLEDE 247
                            +ATDF  KGKE +DQ  ++ PEENNRL   LN  DE
Sbjct: 201 TYANIRDSRTRGGDLFSMATDFLYKGKEFVDQLIAY-PEENNRL---LNYRDE 249

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (44%), Gaps = 25/118 (21%)

Query: 356 YSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIV 415
           + E KAKG   FKNG Y  ++  Y + ++  PSN     IG SN   + LK   + ++I 
Sbjct: 3   FEELKAKGNISFKNGSYSEAISWYNRCISIDPSNP----IGYSNKAMALLKADRFDEAIT 58

Query: 416 NSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNALETYQ 473
             +  L L           IS  DP+   N I  K+  R       L+S K++L  YQ
Sbjct: 59  TCEKGLQL-----------ISKEDPE---NLIKQKLEYR-------LQSAKSSLRDYQ 95

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 38.9 bits (89), Expect = 0.006,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 353 LSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSK 412
           +S + + K +G +LFK G Y  ++  Y++ + + P N     +G SN   + +K+GEY++
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNP----VGYSNKAMALIKLGEYTQ 56

Query: 413 SI 414
           +I
Sbjct: 57  AI 58

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 356 YSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIV 415
           + E+K  G T FK+G+Y+ +++ Y+K +   P N P   IG SN   S +K+ +Y++++ 
Sbjct: 3   FEEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPEN-P---IGYSNSAMSLIKLTKYTEALE 58

Query: 416 NSDLAL 421
           +    L
Sbjct: 59  SCGTGL 64

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 353 LSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSK 412
           +  +   KAKG   FK  DY  ++  Y+KA+ + PSN     IG SN     +K+ ++S+
Sbjct: 1   MEDFDTLKAKGNVFFKKCDYETAVLYYQKAITADPSNP----IGYSNNAMGLIKLEKWSE 56

Query: 413 SIVNSDLALALFPP 426
           ++   +  L +  P
Sbjct: 57  AVDACNKGLKMICP 70

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 358 EFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNS 417
           + K KG T FKNGDY  ++  YEKA  +L S++P   I  SN+  + +K+  + +++   
Sbjct: 43  DLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNAC 98

Query: 418 DLAL 421
           D  L
Sbjct: 99  DKGL 102

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 45/81 (55%), Gaps = 5/81 (6%)

Query: 346 VPISDIELSGYSE-FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQ 404
           +P+ D E+   +E FK +G       DY  ++++Y +A+ +LP+N    +I  +N  A+ 
Sbjct: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143

Query: 405 LKVGEYSKSIVNSDLALALFP 425
             V EY  +I +++ A+ + P
Sbjct: 144 SSVKEYDNAIKDAEKAIEIDP 164

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 36.6 bits (83), Expect = 0.034,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 353 LSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSK 412
           ++ + + K +G  LFK G Y+ ++  Y++ + + P N     +G SN   + +K+GE+++
Sbjct: 5   MTSFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQPQNP----VGYSNKAMALIKLGEHAQ 60

Query: 413 SI 414
           +I
Sbjct: 61  AI 62

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 353 LSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYS 411
           +  + EFK KG T +K  ++ +++  Y+KA+   P+N     +G SN   + +K+  Y+
Sbjct: 1   MPSFEEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNP----VGYSNCAMALIKLNNYA 55

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 26/113 (23%)

Query: 357 SEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVN 416
           +  K +G   FK  DY N+L+ Y  AL  +    P   +  SNI A  + +G+  K + N
Sbjct: 102 TALKDRGNEFFKKKDYDNALKYYNYAL--VVKKDP---VFYSNISACYVSLGQLDKVVEN 156

Query: 417 SDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469
           S  AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 157 STKALELKPD---------------------YSKALLRRASANESLENYADAM 188

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 12  LKNKDSATEFKETTSQSTDLPSSSGSVVPD-VLKTDKGNYESLHSVS-AWPLI 62
           L NKD A E     SQ   LP  S  + PD VL+ D   YE LH+V+  WP +
Sbjct: 91  LVNKDQAAELSAQESQQLYLPHMSRPLGPDEVLEADPTVYEMLHNVNLPWPCL 143

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 26/111 (23%)

Query: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418
            K KG   FK  DY N+L+ Y+ AL       P   +  SNI A  + + +  K + NS 
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYALTL--KKDP---VFYSNISACYVSMNQLDKVVENST 163

Query: 419 LALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469
            AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 49/112 (43%), Gaps = 26/112 (23%)

Query: 358 EFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNS 417
           E K KG   FK  DY N+L+ Y+ AL  +    P   +  SN+ A  + + E  K I  S
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164

Query: 418 DLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469
             AL L P                      + K ++RRA + E LE++ +A+
Sbjct: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 356 YSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSI 414
           +  FK +G   FK G+Y ++++ YEK +   P N P   IG SN   + +K  +  +++
Sbjct: 3   FDHFKTEGNQYFKEGNYASAIKSYEKCIEINPEN-P---IGYSNKAMALIKANKNQEAV 57

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.0 bits (71), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 353 LSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSK 412
           ++ + + K  G  LFK G Y  ++  Y++ + + P N     +G SN   + +K+ EY+ 
Sbjct: 5   VTQFEKEKELGNALFKQGLYREAVDSYDQLITAQPQNP----VGYSNKAMALIKLAEYTH 60

Query: 413 SI 414
           +I
Sbjct: 61  AI 62

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 31.6 bits (70), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 356 YSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSI 414
           +++ K +G T F+ GDY  +   Y++ +   P+N     IG SN   S +K G +  ++
Sbjct: 3   FNDLKQEGNTFFQKGDYAQANGYYDQCIKLEPTNP----IGYSNKAMSLIKQGNHGLAV 57

>Skud_11.258 Chr11 (468037..468900) [864 bp, 287 aa] {ON} YKR025W
           (REAL)
          Length = 287

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 233 EENNRLKSHLNLEDESNDYDLSLEENPCNSGGDNLDED 270
           EE +R +   ++EDESND D+  +EN  +S   N  ED
Sbjct: 13  EEEDRTQDRADVEDESNDVDMIADENGTSSAASNEQED 50

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418
           FK +G T  K  +Y+ +++ Y +A+   P+    + I  SN   +QLK+  +   + + D
Sbjct: 15  FKNEGNTYIKEQNYMKAIELYSQAIELDPT----QSIFFSNRALAQLKLDNFQSCMNDCD 70

Query: 419 LALALFPPAKASWNNK 434
           +AL L P    +++ +
Sbjct: 71  VALRLDPKNIKAYHRR 86

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 4/51 (7%)

Query: 356 YSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLK 406
           +  FK  G   FK G+Y  ++++Y K ++  P+N     +G SN+  + LK
Sbjct: 35  FQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTN----AVGYSNLAMAYLK 81

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 56/131 (42%), Gaps = 27/131 (20%)

Query: 358 EFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNS 417
           +FK KG    K  DY ++++ Y KA+ +L S      I  SN   + LK   +  ++V+ 
Sbjct: 14  DFKNKGNEYIKKSDYDSAIEFYSKAI-ALDSTQS---IYFSNRALAHLKQDNFYSAVVDC 69

Query: 418 DLALALFPPAKASWN-------------------NKISNSDPQRSFNDIWPKIMIRRAES 458
           D AL L P    +++                   N +  + P    NDI     ++  E+
Sbjct: 70  DNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKP----NDITASNALKVCEN 125

Query: 459 FEHLESFKNAL 469
           F   E FKNA+
Sbjct: 126 FIREERFKNAI 136

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 346 VPISDIELSGYSE-FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQ 404
           +P  D E    +E  K +G     N DY  ++ +Y +A+  LP+N     I  +N  A+ 
Sbjct: 91  IPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAH 146

Query: 405 LKVGEYSKSIVNSDLALALFP 425
             + EY +++ +++ A+++ P
Sbjct: 147 SSLKEYDQAVKDAESAISIDP 167

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 47/111 (42%), Gaps = 26/111 (23%)

Query: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418
            K KG   FK   Y ++L+ Y  AL+      P   +  SNI A  + +G   K + +S 
Sbjct: 102 LKDKGNQFFKEQKYEDALKYYNYALDL--KQDP---VFYSNISACYVSLGNLEKVVESST 156

Query: 419 LALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469
            AL L P                      + K ++RRA + E+LE+F  A+
Sbjct: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAM 186

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 30.4 bits (67), Expect = 4.6,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 356 YSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSI 414
           + ++K +G   FK G Y  + + Y+K ++  P N     IG SN   + +K+G Y++ +
Sbjct: 3   FEQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENP----IGYSNKAMALIKLGRYTEVV 57

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
           {ON} similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 398

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 590 PKKVKIAYMKAVAKTHPDKIPESLSLENKMIA 621
           P ++K AY +   +THPDK P+    ENK  A
Sbjct: 19  PTEIKKAYRRKAMETHPDKHPDDPEAENKFQA 50

>Smik_11.282 Chr11 (475173..476048) [876 bp, 291 aa] {ON} YKR025W
           (REAL)
          Length = 291

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 233 EENNRLKSHLNLEDESNDYDLSLEENPCNSGGDN 266
           EE +R +   ++EDESND D++ EEN  +S   N
Sbjct: 13  EEEDRTQDRADVEDESNDVDMTAEENGTSSAVAN 46

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418
            K KG  LFK      +++ Y+ AL       P   +  +NI A  + + ++ K + N +
Sbjct: 109 LKDKGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCN 163

Query: 419 LALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469
            AL L P                      + K+++RRA ++E++E+F +A+
Sbjct: 164 KALELKPD---------------------YSKVLLRRANTYENMENFADAM 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,651,085
Number of extensions: 2604243
Number of successful extensions: 9256
Number of sequences better than 10.0: 98
Number of HSP's gapped: 9479
Number of HSP's successfully gapped: 120
Length of query: 642
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 526
Effective length of database: 40,180,143
Effective search space: 21134755218
Effective search space used: 21134755218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)