Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.5845.349ON36836817080.0
YDR318W (MCM21)5.349ON36836814560.0
Smik_4.5775.349ON36836814510.0
Suva_2.4875.349ON36836814030.0
TDEL0E027805.349ON3473406882e-87
KAFR0C018705.349ON3413346845e-87
KNAG0C055205.349ON3853536809e-86
CAGL0H07139g5.349ON3582896273e-78
Kpol_1051.55.349ON3703646013e-74
TPHA0D020705.349ON3733595962e-73
ZYRO0D10120g5.349ON3292945566e-68
SAKL0G08888g5.349ON3792965483e-66
KLTH0H14806g5.349ON3462955114e-61
TBLA0H019805.349ON3592534742e-55
Ecym_81845.349ON2482214061e-46
Kwal_34.159865.349ON2312093945e-45
AGR349W5.349ON2422183921e-44
NCAS0F028505.349ON2812923681e-40
NDAI0I015505.349ON2762393532e-38
KLLA0B10142g5.349ON2931801574e-11
CAGL0G06182g2.113ON68177751.0
KLTH0C10230g6.56ON78365722.5
AGR089C8.259ON1370257704.0
TPHA0F022802.83ON478125686.0
CAGL0M11616g8.295ON4880133686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.584
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   662   0.0  
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   565   0.0  
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   563   0.0  
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   545   0.0  
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   269   2e-87
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   268   5e-87
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   266   9e-86
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   246   3e-78
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   236   3e-74
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   234   2e-73
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   218   6e-68
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   215   3e-66
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   201   4e-61
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   187   2e-55
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   160   1e-46
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   156   5e-45
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   155   1e-44
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   146   1e-40
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...   140   2e-38
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    65   4e-11
CAGL0G06182g Chr7 (589050..591095) [2046 bp, 681 aa] {ON} simila...    33   1.0  
KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} simila...    32   2.5  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...    32   4.0  
TPHA0F02280 Chr6 (496712..498148) [1437 bp, 478 aa] {ON} Anc_2.8...    31   6.0  
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    31   6.9  

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/368 (91%), Positives = 336/368 (91%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           MSKIDDLQQD                    NIKNKRKNQDSTNPIIQEFEELFDQFPQLN
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKLNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60

Query: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120
           NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ
Sbjct: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120

Query: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL 180
           HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL
Sbjct: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL 180

Query: 181 VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI 240

Query: 241 PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD 300
           PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD
Sbjct: 241 PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD 300

Query: 301 LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVXXXXXXXXXXXXN 360
           LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIV            N
Sbjct: 301 LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVLLGSLDDLELKLN 360

Query: 361 HSFSTIFR 368
           HSFSTIFR
Sbjct: 361 HSFSTIFR 368

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/368 (76%), Positives = 310/368 (84%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           MS+IDDLQQD                     IK+KRKN++S NPI+QEFE+LFDQFPQLN
Sbjct: 1   MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60

Query: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120
           NFLF+EHPEL+E DDKD S     IPATP  +EPKKRAKL+N+E + EQEWVL+TQPMVQ
Sbjct: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120

Query: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL 180
           HQMFD  VADLLDTDILTSPSKRKRKLKI DI TSDR++LED I++ENVYRMFGITFFPL
Sbjct: 121 HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL 180

Query: 181 VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDP DLKIKD S EIFVDREMLGIRLEVFSER S+FEKPHY+LLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI 240

Query: 241 PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD 300
           PSFIDVQGIF++TNGGLVISHD+ YLFAKRVFLQLVE+QKR+Q FKDLEAKKIIHDLDLD
Sbjct: 241 PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD 300

Query: 301 LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVXXXXXXXXXXXXN 360
           L+SSMVSFFVKD+KVELFVKQNEIVSCSILD+IHDFS+ NKSKWEI             N
Sbjct: 301 LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLELKLN 360

Query: 361 HSFSTIFR 368
           HSF+TIF+
Sbjct: 361 HSFATIFK 368

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/368 (76%), Positives = 312/368 (84%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           MSKIDDLQQD                    +IKNKRKN+DS+NPI+QEFE+LF+QFPQLN
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKTSIKNKRKNEDSSNPIVQEFEDLFEQFPQLN 60

Query: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120
           NFLF+EHPEL+E DD+  S  SVVIPAT   +EPKKRAKL+NDEN+ EQEWVL+TQPMVQ
Sbjct: 61  NFLFNEHPELEEMDDRGVSIASVVIPATLIPYEPKKRAKLNNDENLPEQEWVLKTQPMVQ 120

Query: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL 180
           HQMFD  VADLLDTDILTSPSKRKRKLKI DI++ D+  LEDSI++ENVYR+FGITFFPL
Sbjct: 121 HQMFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKGKLEDSIVVENVYRIFGITFFPL 180

Query: 181 VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDP DLKIKD SDEIFVDREMLGIRLEVFSER SKFEKPHYILLKKRIKSNSWFLFKHT+
Sbjct: 181 VDPIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIKSNSWFLFKHTV 240

Query: 241 PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD 300
           PSFIDVQGIF++TNGGLV+S+D+ YLFAKRVFLQLVEIQKRQQ FKDLEAKKIIHDL+LD
Sbjct: 241 PSFIDVQGIFDDTNGGLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIHDLNLD 300

Query: 301 LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVXXXXXXXXXXXXN 360
           L+SSM SFFVKDVKVELFVKQNEIVSCSILD+IHDFS  NK+KWEI             N
Sbjct: 301 LESSMASFFVKDVKVELFVKQNEIVSCSILDDIHDFSHNNKNKWEIALLGSLDDLELKLN 360

Query: 361 HSFSTIFR 368
           HSF+TIF+
Sbjct: 361 HSFATIFK 368

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/368 (74%), Positives = 309/368 (83%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           MSKIDDLQQD                     +++KRKNQ STNPIIQEFE+LFDQFPQLN
Sbjct: 1   MSKIDDLQQDVESLLSEIKSLEKSREELKTKLRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60

Query: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120
           NFLF+EHPELD+ DDKD S      PAT   +EPKK+AKL+NDEN+ E EWVL+TQPMVQ
Sbjct: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120

Query: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL 180
           H+MFDS VADLLDT+ILTSPSKRKRKL + +I+TSD++ LEDSII+EN+YRMFGITFFPL
Sbjct: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180

Query: 181 VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI 240
           VDP DLK+KD SDEI VDREMLGIRLEVF+ER SKFEKPHYILLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240

Query: 241 PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD 300
           PS+IDVQ IFN+TNGGLVIS D+ YLFAKRVF+QLVEIQKRQQ FKDLEAKKIIH+LDLD
Sbjct: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300

Query: 301 LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVXXXXXXXXXXXXN 360
           LQSSMVSFFVKDVKVELF+KQNEIVSCSILDEIHDF++KNK+KWE++            N
Sbjct: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKWELLLLGPLDDLELKLN 360

Query: 361 HSFSTIFR 368
           HSF+TIF+
Sbjct: 361 HSFATIFK 368

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  269 bits (688), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 142/340 (41%), Positives = 215/340 (63%), Gaps = 18/340 (5%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           MS+++DLQQD                     ++    ++ + +P+++ F+ +F QFPQL 
Sbjct: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60

Query: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120
           + L +E     E   +D  S  +       ++ PKK      D             P+ Q
Sbjct: 61  DVLSEETTARHEESTQDPIS--LKRKRNTDVNSPKKDKSFRGDH-----------PPVFQ 107

Query: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTS-DRNDLEDSIIMENVYRMFGITFFP 179
           HQMFD ++A  +DT+ILTSPSK +R++K    DT  D +   + +++ENVYRMFGIT+FP
Sbjct: 108 HQMFDESIAQFIDTNILTSPSKARRRMK----DTKYDEDAPRNQVLLENVYRMFGITYFP 163

Query: 180 LVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHT 239
           +VDP DLK+   +++  ++REM+GIRLEVF+E  ++FEKP+YILLKK+IKS+SW LFKHT
Sbjct: 164 VVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIKSDSWLLFKHT 223

Query: 240 IPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDL 299
           +P FIDV  +FN+TNGG +ISH+N+YLFAK V+ QL+E+  R Q  +DL +  +I +LDL
Sbjct: 224 VPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDL 283

Query: 300 DLQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRK 339
           DL+++ VSF   +V+  L + +++IVSCS++ E  D + K
Sbjct: 284 DLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALDGNVK 323

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  268 bits (684), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 140/334 (41%), Positives = 214/334 (64%), Gaps = 35/334 (10%)

Query: 31  NIKNKRKNQDSTNPIIQEFEELFDQFPQLNNFLFDEHPELDERDDKDTSSKSVVIPATPT 90
           +I + R+ +   N +++EFEELF QFPQL + L+ E+                  P   T
Sbjct: 10  DIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEYKG----------------PGDET 53

Query: 91  LHEP--------------KKRAKLDNDENVSEQEWVLRTQPMVQHQMFDSAVADLLDTDI 136
           L EP              +KR K  + +N+ E EWVL+ Q  ++H +FD +V D+LDT+I
Sbjct: 54  LLEPLQDQNLVEKFQTPSRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEI 113

Query: 137 LTSPSKRKRKLKIAD---IDTSDRNDLEDSIIMENVYRMFGITFFPLVDPADLKIKDVSD 193
           L+SPSKR+++L   D   I     ++L D I++EN++R+FGITFFP+VDP+DL++   + 
Sbjct: 114 LSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQ 173

Query: 194 EIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTIPSFIDVQGIFNET 253
           E+   REMLGIRL++F E   K++KP YILLKK+IKS++W +FKHTIPS+I V+ IF E 
Sbjct: 174 EMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEV 233

Query: 254 NGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLDLQSSMVSFFVKDV 313
           + GL IS++++YLF+K ++LQL++   R+ K K  E K +I +L + L S+ VSF +   
Sbjct: 234 SAGLAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEKGLISNLRISLSSTKVSFSIGTF 293

Query: 314 KVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIV 347
           ++EL+++ N I+SCS +  I D S   +SKWE++
Sbjct: 294 EIELYLQDNIIISCSFVKGIRDASV--RSKWEVL 325

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  266 bits (680), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 219/353 (62%), Gaps = 27/353 (7%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKR----KNQDSTNPIIQEFEELFDQF 56
           M +++DL+QD                     I++KR    + +D+TN +IQEFE +F++F
Sbjct: 1   MRELEDLEQDIDALEKEIESLKKRTADVKGEIRDKRLGGSRTKDTTNVVIQEFESVFEKF 60

Query: 57  PQLNNFLFDEH-PELDERDDKDTSS--------------KSVVIPATPTLHEPKKRAKLD 101
           PQL + L++++ P+  + DD DT+S              +SV   ATP      K  +  
Sbjct: 61  PQLYDILYNDYRPDASDNDDNDTNSVDSAGSNRANQTNNRSVSATATPVKTGKDKAHQQG 120

Query: 102 N--DENVSEQEWVLRTQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRND 159
           N  DE++ E EWVL+ Q  ++HQMFD +V DLLDTDIL+SPSKRKR       DTS    
Sbjct: 121 NRSDEDLPEDEWVLKNQVPIEHQMFDQSVGDLLDTDILSSPSKRKRNPAQHGADTSR--- 177

Query: 160 LEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKP 219
           L + I++EN YR+FGIT+FP+VDPADL++   + ++ + REMLG+R +VF+++ SKFEKP
Sbjct: 178 LHEKILLENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVFNDQDSKFEKP 237

Query: 220 HYILLKKRIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQ 279
            Y+LLKK +K+  W +FKHTIP  IDV  +F+   GGL  S++++YLF+K V+++LV+  
Sbjct: 238 FYVLLKKNLKAKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVRLVQSS 297

Query: 280 KRQQKFKDLEAKKIIHDLDLDLQSSMVSFFVKD---VKVELFVKQNEIVSCSI 329
            R + F  L+ + +I DL  DL+S+ VSF       + V+L ++ NE+VS  +
Sbjct: 298 LRLKHFNSLQERGLIEDLRGDLRSTNVSFMTGPRFMIDVKLTIQNNEVVSVYV 350

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  246 bits (627), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 197/289 (68%), Gaps = 11/289 (3%)

Query: 48  EFEELFDQFPQLNNFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDE--N 105
           +F ++F++ P L + L     +    D  DT+    +IP TP   + K R+ + N++  +
Sbjct: 49  DFNDIFEKNPGLRDLLLGYEIDKSATDVDDTN----IIPVTP---QKKSRSSVVNEKLHS 101

Query: 106 VSEQEWVLRTQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSII 165
           + E EWVL+TQP+V+H++FD +V D++DTDIL SPSKRK+K++  + +++ +   E  I 
Sbjct: 102 LPEHEWVLKTQPLVEHRLFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGKVSKE-PIQ 160

Query: 166 MENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLK 225
            EN+YR+FGI++FPLVDP+DL     ++++ V R+MLGIR ++F+E    FEKPHYILLK
Sbjct: 161 YENIYRLFGISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLK 220

Query: 226 KRIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKF 285
           K  KS+ W LFK+T+P++IDV+GIF E  GGL+ ++D+VYLFAK ++L LVEI  R + F
Sbjct: 221 KSAKSDDWKLFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELF 280

Query: 286 KDLEAKKIIHDLDLDLQSSMVSFFVKD-VKVELFVKQNEIVSCSILDEI 333
             LE   II DLD+DLQS ++   ++   K+E  + Q  I++C+I  +I
Sbjct: 281 LQLEKDGIIDDLDMDLQSLVIKCTLQGTTKIEFHIHQYSIIACTIKSKI 329

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  236 bits (601), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 141/364 (38%), Positives = 214/364 (58%), Gaps = 31/364 (8%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           MS + +L+QD                     + N    + +  PI ++FE+LF   PQL 
Sbjct: 1   MSDLLELEQDVTALRREIESLTKRRDAVKDKLANNEIEEYTQKPISKDFEDLFQSHPQLY 60

Query: 61  NFLFDEHPEL--------DERDDKDTSSKSVVIPATPTLHEPKKRAKL-DNDENVSEQEW 111
           + L  +  +         +ERD+    +  +            KR K  + D ++SE EW
Sbjct: 61  DLLSSDKDKNKSKKKPSSEERDEGKHMTSEI----------SNKRVKPNEQDTDISEDEW 110

Query: 112 VLRTQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADID----TSDRN---DLEDSI 164
           +L++QP+VQH+MF+S ++D+++TDILTSPSKRK  LK+ +ID    TS  N   +L   I
Sbjct: 111 ILKSQPLVQHKMFNSGISDMINTDILTSPSKRK--LKLGNIDDDSETSKGNKQKNLNKKI 168

Query: 165 IMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILL 224
            +EN++R+FGITFFPLVDP DLK+      + + REMLGIRLE+++E  S FEKPHYILL
Sbjct: 169 RIENLFRLFGITFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILL 228

Query: 225 KKRIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQK 284
           KK++K +SW +FKHTIPS+ID++  +   N G++ ++D + +FAK V+++L+    R+QK
Sbjct: 229 KKKLKIDSWMIFKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIREQK 288

Query: 285 FKDLEAKKIIHDLDLDLQSSMVSFFVKD-VKVELFVKQNEIVSCSILDEIHDFSRKNKSK 343
            + L   + I D   D+ SS V   + D  ++ELF+K   IVSC I  +  +   KN  K
Sbjct: 289 IQKLTELEYIRDCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKIPTDRMEPMLKN--K 346

Query: 344 WEIV 347
           W+I+
Sbjct: 347 WQII 350

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  234 bits (596), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 128/359 (35%), Positives = 212/359 (59%), Gaps = 16/359 (4%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           MS +D+L+QD                     + N   N     P++QEF  LF+QFP L 
Sbjct: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60

Query: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120
             L  E  +  E   K    +  V       ++ K+   L++D+N+ E EW+L  QP+++
Sbjct: 61  ELLSKEKIKRSEMLGK--HHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIE 118

Query: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRN----------DLEDSIIMENVY 170
           H++F S +++ ++TDILTSPSKRK+ ++  +I  +D N          +LE  II EN +
Sbjct: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTF 178

Query: 171 RMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKS 230
           R+FGI++FP+VDP DL     ++E+   REM+GIRLEVF +    FEKPHYILLKK+ KS
Sbjct: 179 RLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKS 238

Query: 231 NSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEA 290
           N+W LFK+TIP++ID+  IF   N G++++++++Y+FAK+V++QL+ IQ R++    L+ 
Sbjct: 239 NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQE 298

Query: 291 KKIIHDLDLDLQSSMVSFFV--KDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIV 347
             I+ D+ +DL   ++   +     K+ L+++++++ S SI  E  D    ++ +W++ 
Sbjct: 299 ANIVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKVTSVSIYSETLDIH--SQKRWKLT 355

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  218 bits (556), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 122/294 (41%), Positives = 192/294 (65%), Gaps = 31/294 (10%)

Query: 41  STNPIIQEFEELFDQFPQLNNFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKL 100
           S +P+++EFE +F +FP+L   L  E+  +D  +D DTS +   + ++       KR KL
Sbjct: 41  SNHPVVKEFESVFTKFPKLYEVLARENQIVDS-NDNDTSDEPSTVDSSFV-----KRRKL 94

Query: 101 DNDENVSEQEWVLRTQPMVQHQMFDSAVADLL-DTDILTSPSKRKRKLKIADIDTSDRND 159
           +  +              VQ++MFD ++ADLL DT   TSP KR+ KL+       +   
Sbjct: 95  EFSDG------------SVQNKMFDKSIADLLGDTSSSTSPGKRRSKLQ-------NFKG 135

Query: 160 LEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKP 219
           LE  + +EN YR+FGITFFPLVDP+D+  +       ++R+MLGIRLEVF+E   +FEKP
Sbjct: 136 LESQVSIENAYRLFGITFFPLVDPSDINFQRND----INRKMLGIRLEVFNEGLRQFEKP 191

Query: 220 HYILLKKRIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQ 279
           HYILLK+ +K NSW LFKHTIP+FID++ IF + + G++ ++D VYLFAK+V++QL+ + 
Sbjct: 192 HYILLKQNLKLNSWSLFKHTIPAFIDLESIFQKIDNGIITTYDQVYLFAKQVYIQLLCVS 251

Query: 280 KRQQKFKDLEAKKIIHDLDLDLQSSMVSFFVKDVK-VELFVKQNEIVSCSILDE 332
           +R Q  ++L+  ++I +L++DLQ + VSF ++ +K V LF++ ++++SC   D+
Sbjct: 252 QRVQIIEELQDIRLISNLEIDLQIAAVSFDIQGMKRVRLFLQDDQVISCDTFDD 305

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  215 bits (548), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 124/296 (41%), Positives = 182/296 (61%), Gaps = 15/296 (5%)

Query: 44  PIIQ----EFEELFDQFPQLNNFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAK 99
           P+I+    E+  +F+ FP L+  L ++  + +     D ++ S   P   T   P+KR  
Sbjct: 50  PVIELTTDEYGPIFEAFPHLHKLLSEKLFQQESNRGHDNTALST--PKKSTTISPRKRVV 107

Query: 100 LDN-DENVSEQEWVLRTQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRN 158
                 ++ E EWVLR QP V+H+MFDS +ADL+DT+ILTSPSKRK KL       +++ 
Sbjct: 108 NQVLPPSMPEHEWVLRMQPAVEHKMFDSDIADLIDTEILTSPSKRKEKLSKVH---NNKQ 164

Query: 159 DLEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEK 218
           +L D + +ENVYRM GIT FP+VDP+DLK+   + E  + REM+G+RLEVF+E  S FEK
Sbjct: 165 NLIDYVRLENVYRMTGITVFPVVDPSDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEK 224

Query: 219 PHYILLKKRIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEI 278
           P+Y+LLKK  K +SW +FKHTIP++ID+Q +F +TNGG++  +   YLFAK+V+  L++ 
Sbjct: 225 PYYVLLKKSSKRDSWDIFKHTIPNYIDIQLLFEKTNGGIITDYSGTYLFAKKVYQLLLQT 284

Query: 279 QKRQQKF-----KDLEAKKIIHDLDLDLQSSMVSFFVKDVKVELFVKQNEIVSCSI 329
             + Q F     +D    +I  DL +++ S  VSF     K  L +  N +   SI
Sbjct: 285 SLKAQVFEVLAREDSRISQIESDLAVNVVSFKVSFKNLSFKTVLQMDWNNVHGASI 340

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  201 bits (511), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 182/295 (61%), Gaps = 32/295 (10%)

Query: 48  EFEELFDQFPQLNNFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKR------AKLD 101
           EFE LF + P+L +        L ++  K+T S     P TP    PKKR      A+L 
Sbjct: 45  EFEGLFQKNPELKH-------TLSQKIFKETDS----FPQTP-YSSPKKRPLKSSAAQLS 92

Query: 102 N-DENVSEQEWVLRTQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDL 160
           N   ++ E EWVL+TQ  V+H+ FDSAVADL++TDILTSPSKRKR  +     +    +L
Sbjct: 93  NLSPDIPESEWVLKTQVPVEHKFFDSAVADLIETDILTSPSKRKRAAQ-----SRAHEEL 147

Query: 161 EDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPH 220
              + +EN+YRM GI+ FP+VDP+DL+  +  DEI + R+MLG+RLE+F+E +  FE P+
Sbjct: 148 VQKVQIENIYRMLGISTFPVVDPSDLEGTE-EDEINIKRKMLGLRLELFNELERSFEPPY 206

Query: 221 YILLKKRIKSNSWFLFKHTIPSFIDVQGIFNET-NGGLVISHDNVYLFAKRVFLQLVEIQ 279
           YIL K+  K++ W +F+HT+PS++ V+ +F +  + GL+ +   +Y FAK+V+  L+ I 
Sbjct: 207 YILFKQNPKNSYWNIFRHTVPSYVGVEQMFQQVRSNGLLANQSEIYTFAKKVYKSLLSIS 266

Query: 280 KRQQKFKDLEAKKIIHDLDLDLQSSMVSFFVKDVKVELFVK----QNEIVSCSIL 330
            + Q F+  E K+ I  L++D   + VSF ++  K+  FVK      ++++CS +
Sbjct: 267 VKTQIFRRTEKKEAISQLEIDPSCTSVSFHIE--KLGCFVKLKLDATDVIACSCI 319

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  187 bits (474), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 98/253 (38%), Positives = 164/253 (64%), Gaps = 9/253 (3%)

Query: 101 DNDENVSEQEWVLRTQP---MVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDR 157
           DN+  + +Q+  LR+ P    ++H++FD  ++ LL  ++++ PS+R++++K+   +   R
Sbjct: 86  DNEARIRKQK--LRSIPGQLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIR 143

Query: 158 NDLEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFE 217
             L++ +I+E VYRM GITFFP+VDP DL+  D    + + REMLGIRLE++++  S FE
Sbjct: 144 EILKNFVILEIVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFE 203

Query: 218 KPHYILLKKRIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVE 277
           KPHYILLK+  KS  W +FK+TIP++ID+  +F + N G++ +  +++LFAK V+  L  
Sbjct: 204 KPHYILLKQSEKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSS 263

Query: 278 IQKRQQKFKDLEAKKIIHDLDLDLQSSMVSFFVKDV-KVELFVKQNEIVSCSILDE---I 333
           I K+ Q FK LE  K+  +L++DL    +SF  K +  + + +K+ +I++C+I      I
Sbjct: 264 ISKKIQYFKKLENLKVFENLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYI 323

Query: 334 HDFSRKNKSKWEI 346
           +  +R    KWEI
Sbjct: 324 NKETRTFYRKWEI 336

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  160 bits (406), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/221 (39%), Positives = 134/221 (60%), Gaps = 5/221 (2%)

Query: 119 VQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFF 178
           V+H+MFD  +A   DT+I+ SPSKR + +K +       N+LE  + +EN YRM GITFF
Sbjct: 5   VEHRMFDPTIASFFDTEIVRSPSKRNKLMKSSATSIRPDNELEKFVEIENCYRMSGITFF 64

Query: 179 PLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNS-WFLFK 237
           PLVDP  L      D   +  E+LGIRLEVF+E   K+E P+YI+LK+R K+N  W L+K
Sbjct: 65  PLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWDLYK 124

Query: 238 HTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDL 297
           HTIP  ID++ I++ T  G++     VY+FAK+ +++L+ I  R Q   +L+  ++  ++
Sbjct: 125 HTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYRLQFICNLDP-QLFENI 183

Query: 298 DLDLQSSMVSFFVKDVKVELFVKQ---NEIVSCSILDEIHD 335
            +D  + M+SF +   ++   V Q     I+ C I  E H+
Sbjct: 184 KVDSYAVMLSFQLTGEEIITVVAQLRDRSIIDCDIDIERHN 224

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  156 bits (394), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 126/209 (60%), Gaps = 9/209 (4%)

Query: 123 MFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPLVD 182
           MFDS VADL +TDILTSPSKRK+      +++    +L   + +EN+YR  G++ FP+VD
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKV-----VNSRKHQELIKKLDIENLYRTIGLSTFPVVD 55

Query: 183 PADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTIPS 242
           P+D++ +D   E    R M+G+RLE+F+E    FE PHY+L K+ +K+  W +F+HTIPS
Sbjct: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114

Query: 243 FIDVQGIFNETNG-GLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLDL 301
           ++ V+ +F +T     +     +Y F K+V+  L+ I  +QQ FK L    I+  L +D 
Sbjct: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174

Query: 302 QSSMVSF--FVKDVKVELFVKQNEIVSCS 328
             +  SF      V V+L + + +I +CS
Sbjct: 175 SCTSASFQMMQGSVSVKLKLSETDITACS 203

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  155 bits (392), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 134/218 (61%), Gaps = 8/218 (3%)

Query: 123 MFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPLVD 182
           MFD A+A  LDT++L SPSKR + L     + S + +L + I +EN YRM GITFFPLVD
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILSTRP-EQSKQRELRNFIEVENCYRMCGITFFPLVD 59

Query: 183 PADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIK-SNSWFLFKHTIP 241
           P  L  +D  +E  V+ EMLGIRLEVF+E   +F+ P+Y+LL++  K +  W LFKHT+P
Sbjct: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118

Query: 242 SFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLDL 301
             +D + I++ T  G + S  +VYLFAK+ + +L+++  R Q    L+   +  ++  D 
Sbjct: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLD-PYLFENIRTDS 177

Query: 302 QSSMVSFFVKD----VKVELFVKQNEIVSCSILDEIHD 335
            ++M+SF +      + V + ++  E+ SC +  + HD
Sbjct: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD 215

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  146 bits (368), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 162/292 (55%), Gaps = 32/292 (10%)

Query: 1   MSKIDDLQQDXXXXXXXXXXXXXXXXXXXXNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60
           M++I DL+QD                      K K ++  +++PI+ E  +L  QFPQLN
Sbjct: 1   MTEIVDLEQDIAALKSEVQALTKKRDELKSKPKLKPRSSSTSDPIVNEITDLITQFPQLN 60

Query: 61  NFLFDEHPELDER-----DDKDTSSKSVVIPATPTLHEPKKRAKLDND-ENVSEQEWVLR 114
             L  + P + E      +++++  K  +        +  K++KL+N+ +++ E EWVL+
Sbjct: 61  EILLSK-PSVTESSRSTSNEEESDKKRKLDNEKIQAFQDAKKSKLNNENDDLPEHEWVLK 119

Query: 115 TQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSI-IMENVYRMF 173
            Q  V+H+MFD++VAD+L+T++L+SPSKR+  LK    +  +   L+    ++ENV+R+ 
Sbjct: 120 NQRPVEHKMFDTSVADVLNTEMLSSPSKRRLILKNGQDEMEENKHLQKEYRLLENVFRIV 179

Query: 174 GITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNS- 232
           GI+FF  VDP DL           + +M+GIRL+ F++      K +YI+LKK  K+N  
Sbjct: 180 GISFFDAVDPNDL-----------ESDMIGIRLDPFNQP----SKVYYIILKKEAKNNRE 224

Query: 233 --WFLFKHTIPSFIDVQGIFNETNGGL------VISHDNVYLFAKRVFLQLV 276
             W + KHTIP +I+V   F E+          + +HD++YL AK V+++L+
Sbjct: 225 GLWTIIKHTIPKYINVTNTFGESKRETWRTMIKIENHDDIYLLAKEVYVKLL 276

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score =  140 bits (353), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/239 (35%), Positives = 134/239 (56%), Gaps = 23/239 (9%)

Query: 47  QEFEELFDQFPQLNNFLFDEH------PELDERDDKDTS---SKSVVIPATPTLHEPKKR 97
           ++ + L DQFPQL++ L  ++      P L    + DTS    K      +P      K 
Sbjct: 48  RQLQSLLDQFPQLHDILLSDNAIDKSSPVLHNNGEDDTSLLSRKRKSEHGSPN----TKH 103

Query: 98  AKLDNDENVSEQEWVLRTQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDR 157
            +L    N+ E EWVL+ QP ++H+MFD++VAD+L TDIL+SPSKR  + K    D   R
Sbjct: 104 KRLSLSANLPEHEWVLKMQPPIEHKMFDTSVADVLGTDILSSPSKRIIETKERQSDNLQR 163

Query: 158 NDLEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFE 217
                 I++E+ Y+  G+ F  L DP DL++ +  + + +  +MLG+R E+ S   S+  
Sbjct: 164 T----LILLEDFYKKLGVNFLQLFDPNDLEMNEKMEALQMKGDMLGVRFELPS---SEGA 216

Query: 218 KPHYILLKKRIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLV 276
           + +Y+LLKK   S+ W  +KH++P+ IDV   F         SH+++YL AK ++LQL+
Sbjct: 217 QKYYLLLKKETASDYWIPYKHSLPNIIDVNEYFVNVAAE---SHEDIYLIAKDIYLQLL 272

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 21/180 (11%)

Query: 160 LEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKP 219
           + D +  EN  R+ G++ FP+               + + E +GIRLE+F E   K++ P
Sbjct: 107 ITDFVQWENSVRLIGVSLFPVN--------------YDNIEFMGIRLELFDELSLKYDPP 152

Query: 220 HYILLKKRIKS-NSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEI 278
            Y++LK  +K    W LFKH +P +I++   +         S  N+  FA   +  L+++
Sbjct: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKDLLKV 212

Query: 279 QKRQQKFKDLEAKKI----IHDLDLDLQSSMVSFFVKD--VKVELFVKQNEIVSCSILDE 332
             R Q F+ LE   +       L +D     VSF +    +K+++    +EI+ C+   E
Sbjct: 213 HSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRLGADIIKIKVDDGDDEIIDCTFNGE 272

>CAGL0G06182g Chr7 (589050..591095) [2046 bp, 681 aa] {ON} similar
           to uniprot|P38835 Saccharomyces cerevisiae YHR131c
          Length = 681

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 227 RIKSNSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFK 286
           R +S+S    + T+P  +  Q I   ++ G ++S+ N   F K  F  + + ++ +Q FK
Sbjct: 333 RTRSSSSATVQSTVPKRVASQPISRNSSSGRIVSNGNNSSFGK--FFDMFKSKRSKQDFK 390

Query: 287 DLEAKKIIHDLDLDLQS 303
            L++  +   L + L+S
Sbjct: 391 SLQSANVT-GLKVTLES 406

>KLTH0C10230g Chr3 (847951..850302) [2352 bp, 783 aa] {ON} similar
           to uniprot|Q99287 Saccharomyces cerevisiae YOR165W SEY1
           Synthetic Enhancement with YOP1
          Length = 783

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 183 PADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTIPS 242
           P DL  +++SD     +E+  + L+ +    S++ KP Y+  ++ +       FK TI  
Sbjct: 319 PVDLHCRELSDLAGKLQELKSLCLQEYDTYASRYAKPVYMDNRRDLSHKIENKFKETISK 378

Query: 243 FIDVQ 247
           F+DVQ
Sbjct: 379 FLDVQ 383

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 108/257 (42%), Gaps = 40/257 (15%)

Query: 32   IKNKRKNQDSTNPIIQEFEELFDQFPQLNNFLFDEHP----ELDERDDKDTSSKSVVIPA 87
            I+  + + D+ +  +QE ++      +    L DEH     ELD++++K  S  S+ I  
Sbjct: 978  IQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIEL 1037

Query: 88   TPTLHEPKKRAK-------------------------LDNDENVSEQEWVLRTQPMVQHQ 122
            T  L + +  A                          LD +EN S Q +     P  + +
Sbjct: 1038 TEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPTPDTKRE 1097

Query: 123  MFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPLVD 182
               S+   +L+T  L SPS  +RK+ IA+ + S   D E + ++EN       +    VD
Sbjct: 1098 NIQSS---MLETH-LASPSPNERKISIAENNLSMEVD-EQASVLENGLPKLPDSELARVD 1152

Query: 183  PADL-----KIKDVSDEIFVDREMLGIRLEVFSE-RKSKFEKPHYILLKKRIKSNSWFLF 236
              DL     +++D  D   VD E+L    +  +E R+ + +    I+ +   + +   L 
Sbjct: 1153 LEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLK 1212

Query: 237  KHTIPSFIDVQGIFNET 253
            K  +  F++  GI + T
Sbjct: 1213 KRRLDEFMEGFGIISIT 1229

>TPHA0F02280 Chr6 (496712..498148) [1437 bp, 478 aa] {ON} Anc_2.83
           YNL169C
          Length = 478

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 52/125 (41%), Gaps = 19/125 (15%)

Query: 195 IFVDREMLGIRLEVFSERKSKFEKPHYILLKKR---IKSNSWFLFKHTIPSFIDVQGIFN 251
           +F+    LGI   +   R+    K +  ++K +   I SNSWFLF ++      +  I+ 
Sbjct: 81  LFISGFALGITATIIENRR---HKDNETVIKSKDINITSNSWFLFIYSTLPLNAISRIWG 137

Query: 252 ETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLDLQSSMVSFFVK 311
             N   +      Y F    +L  V +++             + D +L   S++  FF +
Sbjct: 138 HFNNLTLPEWSRTYGFKLYSYLFGVNLEE-------------MADPNLSHYSNLAEFFYR 184

Query: 312 DVKVE 316
           D+K E
Sbjct: 185 DIKKE 189

>CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 aa]
           {ON} similar to uniprot|Q12019 Saccharomyces cerevisiae
           YLR106c
          Length = 4880

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 57/133 (42%), Gaps = 17/133 (12%)

Query: 106 VSEQEWVLRTQPMVQHQMFDSAVADLLDTDILTSPSKRKRKLK-------IADIDTSDRN 158
           V E  WVL            S +  LL+   LT PS R   LK       IA + TS+RN
Sbjct: 378 VKEGRWVLIEDIDKAPTEVLSVILSLLEKRELTIPS-RGETLKAAKGFQLIATVQTSERN 436

Query: 159 DLEDSIIMENVYRMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRL-----EVFSERK 213
             +DS   E V  M G + + +V   +   KD+ +EI   +  L  RL     E +    
Sbjct: 437 STKDS---EPVINMIGKSAWNIVSLEEPSDKDL-EEILSKKFSLLTRLIPQLIETYHNIH 492

Query: 214 SKFEKPHYILLKK 226
           S ++ P +I L K
Sbjct: 493 SIYQDPKFISLNK 505

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,197,118
Number of extensions: 1869520
Number of successful extensions: 7327
Number of sequences better than 10.0: 86
Number of HSP's gapped: 7598
Number of HSP's successfully gapped: 87
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)