Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.4038.318ON59059027200.0
Smik_4.3888.318ON59759620910.0
YDR144C (MKC7)8.318ON59659620720.0
Suva_2.3058.318ON59759918280.0
Smik_12.1868.318ON57249113351e-178
YLR120C (YPS1)8.318ON56949113071e-174
Suva_10.2118.318ON56649312941e-172
Skud_12.1928.318ON56948812821e-170
CAGL0M04191g8.318ON60150812481e-165
SAKL0H15664g8.318ON55649312161e-161
NCAS0B035608.318ON58654912091e-159
Kpol_543.618.318ON58847711881e-156
KNAG0G024108.318ON53048411511e-151
Kwal_26.7254singletonON57048711501e-151
TDEL0F044508.318ON52447111301e-148
KAFR0B057108.318ON57549111341e-148
NDAI0G026208.318ON59047911171e-145
TPHA0A015808.318ON60047811111e-144
KAFR0H023008.318ON52148310981e-143
NCAS0C033008.318ON55948010811e-140
KLLA0E04049g8.318ON58950010711e-138
KNAG0I009108.318ON56950310371e-134
KAFR0B06530singletonON53849110321e-133
Skud_12.1938.319ON49746110231e-132
YLR121C (YPS3)8.319ON50847910181e-132
Smik_12.1878.319ON50747910181e-132
ZYRO0F10230g8.318ON58050910241e-132
KLTH0G12386g8.318ON58049410131e-130
ZYRO0G02904gsingletonON5314769941e-128
TBLA0D00140singletonON6075089911e-126
ZYRO0F10274gsingletonON5724979831e-125
NDAI0J010308.318ON6523609881e-125
TBLA0A039108.318ON5964839771e-124
Suva_10.2128.319ON7454649891e-124
Kwal_56.239028.318ON6295069791e-124
AGL192W8.318ON4994769581e-123
Ecym_42518.318ON5024799551e-122
TBLA0E02630singletonON6893459601e-121
ZYRO0F10318g8.319ON4864519281e-118
TBLA0H012908.318ON6673449251e-116
ZYRO0F10252gsingletonON5514628891e-112
KAFR0E03940singletonON6384808891e-111
KNAG0E03220singletonON5404808681e-109
KAFR0I01700singletonON5524638641e-108
Kwal_33.14239singletonON6514708671e-107
SAKL0C02970gsingletonON5924918571e-106
KLTH0F06754gsingletonON7674738681e-106
CAGL0E01419g8.318ON5915178311e-103
KNAG0I01200singletonON6774578181e-100
SAKL0F07172g7.182ON5424527842e-96
TPHA0C008408.318ON10004828072e-95
CAGL0E01815gsingletonON5194857682e-94
ZYRO0E02266gsingletonON5064967611e-93
CAGL0E01749gsingletonON4824467522e-92
KNAG0I009008.319ON5314787535e-92
ZYRO0F10296gsingletonON5284987343e-89
CAGL0E01771gsingletonON5194547308e-89
CAGL0E01859gsingletonON5054817244e-88
CAGL0E01881gsingletonON5084467124e-86
CAGL0E01793gsingletonON5164507063e-85
Suva_16.14singletonON5404307004e-84
CAGL0E01837gsingletonON5214616924e-83
NCAS0A124607.182ON5404656822e-81
YIR039C (YPS6)singletonON5374276822e-81
Suva_9.13singletonON4644586674e-80
KAFR0B06700singletonON5314766516e-77
SAKL0E15356gsingletonON5574676091e-70
Suva_34.1singletonON3873265812e-68
CAGL0E01727gsingletonON5394255895e-68
Ecym_43947.182ON5184265824e-67
Skud_9.1547.182ON5164515824e-67
NDAI0B017207.182ON5474495828e-67
Smik_65.1singletonON3423105651e-66
KLLA0D15917g7.182ON5114165753e-66
KNAG0H027607.182ON5634465732e-65
YIL015W (BAR1)7.182ON5874075743e-65
Smik_9.1757.182ON5934445463e-61
ZYRO0D15554g7.182ON5214465143e-57
CAGL0J02288g7.182ON5413964961e-54
TDEL0H026507.182ON5524224934e-54
AGR240W7.182ON4524294812e-53
SAKL0H00330gsingletonON5784254656e-50
Smik_5.7singletonON3042324204e-46
Kpol_1063.227.182ON3363544068e-44
Suva_79.1singletonON2272133513e-37
TBLA0D045807.182ON3954263362e-33
ZYRO0F07392g8.677ON4184452531e-22
NCAS0C013608.677ON4064392399e-21
Suva_9.1877.182ON3331752332e-20
Suva_62.1singletonON2521892256e-20
TPHA0D012608.677ON4194002336e-20
Suva_9.186singletonOFF5431802341e-19
KNAG0J017108.677ON4154462212e-18
KLTH0D11264g8.677ON4174642193e-18
NDAI0E021058.677ON4083032175e-18
Kwal_26.88028.677ON4123512141e-17
TBLA0B038308.677ON4134182095e-17
Smik_5.6singletonON123951858e-16
Kpol_1013.68.677ON4023051981e-15
YPL154C (PEP4)8.677ON4053111981e-15
Smik_6.3518.677ON4053111972e-15
Skud_16.1288.677ON4053111953e-15
Suva_16.1568.677ON4063091936e-15
KLLA0F22088g5.401ON5584441956e-15
SAKL0H06512g8.677ON4044451927e-15
KAFR0H024208.677ON4163061928e-15
KLLA0D05929g8.677ON4093081847e-14
Kpol_1072.158.677ON3994411821e-13
TPHA0E019205.401ON6244251832e-13
Ecym_23968.677ON4154021793e-13
Ecym_13245.401ON5763021787e-13
TDEL0A062308.677ON4083411652e-11
CAGL0M02211g8.677ON4154481643e-11
YDR349C (YPS7)5.401ON5962941601e-10
Skud_4.6185.401ON5863001572e-10
Kwal_55.200345.401ON5932141564e-10
ACR144W8.677ON4084241544e-10
Smik_4.6135.401ON5963051547e-10
TDEL0E022305.401ON5732321521e-09
Suva_2.5205.401ON5982891521e-09
AGR407CsingletonON2682071462e-09
ACR150W5.401ON5534371483e-09
NDAI0C046105.401ON6094241465e-09
KLTH0E02596g5.401ON5961981385e-08
NCAS0F031505.401ON6454261332e-07
ZYRO0A06578g5.401ON7202911332e-07
Smik_67.1singletonON110531185e-07
CAGL0A02431g5.401ON5872371305e-07
SAKL0G07524g5.401ON6324201297e-07
KAFR0E040805.401ON5962151215e-06
ACR143WsingletonON3933141189e-06
YGL258W-AsingletonON77781042e-05
TBLA0H016805.401ON6094291135e-05
YGL259W (YPS5)singletonON165461022e-04
Kpol_1059.335.401ON6622951054e-04
KNAG0C051405.401ON598234930.012
SAKL0D01408gna 1ON506313751.7
NDAI0D011102.260ON393240689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.403
         (590 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...  1052   0.0  
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   810   0.0  
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   802   0.0  
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   708   0.0  
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   518   e-178
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   508   e-174
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   503   e-172
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   498   e-170
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   485   e-165
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   473   e-161
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   470   e-159
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   462   e-156
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   447   e-151
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   447   e-151
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   439   e-148
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   441   e-148
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   434   e-145
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   432   e-144
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   427   e-143
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              421   e-140
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   417   e-138
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              404   e-134
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            402   e-133
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   398   e-132
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   396   e-132
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   396   e-132
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   399   e-132
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   394   e-130
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   387   e-128
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                386   e-126
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   383   e-125
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             385   e-125
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   380   e-124
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   385   e-124
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   381   e-124
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   373   e-123
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   372   e-122
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   374   e-121
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   362   e-118
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   360   e-116
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   347   e-112
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              347   e-111
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   338   e-109
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   337   e-108
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   338   e-107
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   334   e-106
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   338   e-106
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   324   e-103
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              319   e-100
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   306   2e-96
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   315   2e-95
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   300   2e-94
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   297   1e-93
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   294   2e-92
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              294   5e-92
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   287   3e-89
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   285   8e-89
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   283   4e-88
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   278   4e-86
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   276   3e-85
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   274   4e-84
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   271   4e-83
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   267   2e-81
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   267   2e-81
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   261   4e-80
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   255   6e-77
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   239   1e-70
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   228   2e-68
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   231   5e-68
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   228   4e-67
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   228   4e-67
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   228   8e-67
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       222   1e-66
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   226   3e-66
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   225   2e-65
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   225   3e-65
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   214   3e-61
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   202   3e-57
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   195   1e-54
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   194   4e-54
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   189   2e-53
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   183   6e-50
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       166   4e-46
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   160   8e-44
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   139   3e-37
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   134   2e-33
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...   102   1e-22
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    97   9e-21
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    94   2e-20
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    91   6e-20
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    94   6e-20
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    95   1e-19
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    90   2e-18
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    89   3e-18
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     88   5e-18
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    87   1e-17
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    85   5e-17
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        76   8e-16
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    81   1e-15
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    81   1e-15
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    80   2e-15
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    80   3e-15
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    79   6e-15
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    80   6e-15
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    79   7e-15
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    79   8e-15
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    75   7e-14
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    75   1e-13
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    75   2e-13
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    74   3e-13
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    73   7e-13
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    68   2e-11
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    68   3e-11
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    66   1e-10
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    65   2e-10
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    65   4e-10
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    64   4e-10
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    64   7e-10
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    63   1e-09
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    63   1e-09
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    61   2e-09
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    62   3e-09
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    61   5e-09
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    58   5e-08
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    56   2e-07
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    56   2e-07
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        50   5e-07
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    55   5e-07
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    54   7e-07
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    51   5e-06
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    50   9e-06
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    45   2e-05
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    48   5e-05
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    44   2e-04
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    45   4e-04
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    40   0.012
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    33   1.7  
NDAI0D01110 Chr4 (252528..253709) [1182 bp, 393 aa] {ON} Anc_2.2...    31   9.5  

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/590 (88%), Positives = 525/590 (88%)

Query: 1   MKFSAATFVANAFLLYXXXXXXXXXXXXXXXXXXXYVIMNFEKKYGDSFENASNDRNAGA 60
           MKFSAATFVANAFLLY                   YVIMNFEKKYGDSFENASNDRNAGA
Sbjct: 1   MKFSAATFVANAFLLYSSTVSADSIASASIATSESYVIMNFEKKYGDSFENASNDRNAGA 60

Query: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK 120
           HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK
Sbjct: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK 120

Query: 121 DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD 180
           DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD
Sbjct: 121 DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD 180

Query: 181 SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI 240
           SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI
Sbjct: 181 SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI 240

Query: 241 GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAV 300
           GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAV
Sbjct: 241 GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAV 300

Query: 301 DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLD 360
           DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLD
Sbjct: 301 DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLD 360

Query: 361 SGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSN 420
           SGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSN
Sbjct: 361 SGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSN 420

Query: 421 FQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYID 480
           FQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYID
Sbjct: 421 FQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYID 480

Query: 481 VIESAVPSALKAPNYSNTWSTYESIVPGGNIFXXXXXXXXXXXXXXXXXXXXXXXLKGQK 540
           VIESAVPSALKAPNYSNTWSTYESIVPGGNIF                       LKGQK
Sbjct: 481 VIESAVPSALKAPNYSNTWSTYESIVPGGNIFSTSSNVSMSGSGSRSHSATSSSSLKGQK 540

Query: 541 LQXXXXXXXXXXXXXXXXXXXXXXXRKENGGDNLSPPFFARLITTILYYI 590
           LQ                       RKENGGDNLSPPFFARLITTILYYI
Sbjct: 541 LQTSTTNSRSSAATSVSSPTLSSSTRKENGGDNLSPPFFARLITTILYYI 590

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/596 (67%), Positives = 462/596 (77%), Gaps = 6/596 (1%)

Query: 1   MKFSAATFVANAFLLYXXXXXXXXXXXXXXXXXXXYVIMNFEKKYGDSFENASNDRNAGA 60
           MK S   FV NA LL+                   YV MNF++KYGDSFE+A+ND  A A
Sbjct: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60

Query: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK 120
            LV R DDYELV+LTN+NSFYSVELDIGTPPQK+TVLVDTGSSDLWVTGS+NPYC T+G+
Sbjct: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE 120

Query: 121 DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD 180
           DTS  SFK ++KDN  SVVESV TEISYDTT+    ATAT+ NT   SQ +NC TYGTFD
Sbjct: 121 DTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD 180

Query: 181 SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI 240
           +SKSSTFESNKT+FSITYGDSTFASGTWGHD+L+LNNLNVTGLSFAVANETNSTVGVLGI
Sbjct: 181 TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI 240

Query: 241 GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAV 300
           GLPGLESTYSGVSLSS QKSYTYNNFPM+LKNSGAIKS+AYSLF+N S+S+HGTILFGAV
Sbjct: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300

Query: 301 DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLD 360
           DHGKY GDLYTIPIIN LQN GYKDPIQF VTLQGI V+ G+  +N TTLTTTKIP LLD
Sbjct: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360

Query: 361 SGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSN 420
           SGTTISY+P  LVE++A +VGA+YS +YGYY+M+CI+E++++ +++FDFGGF+I++WLSN
Sbjct: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN 420

Query: 421 FQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYID 480
           FQL TDS S+VCILG APQSDP +ILGDNFLVSTY+VYDLDNMEISMA+ADFSD  EYID
Sbjct: 421 FQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYID 480

Query: 481 VIESAVPSALKAPNYSNTWSTYESIVPGGNIFXXXXXXXXXXXXXXXXXXXXXXXLKGQK 540
            I+ +VPSALKAP YS+TWSTYESIVPGGN+F                        KGQK
Sbjct: 481 TIKDSVPSALKAPGYSSTWSTYESIVPGGNMFPTSYNFSSSNSVSLSHSATGTSSNKGQK 540

Query: 541 LQXXXXX------XXXXXXXXXXXXXXXXXXRKENGGDNLSPPFFARLITTILYYI 590
            Q                             RKENGG NL+PPFFA  +  ILY+I
Sbjct: 541 SQTSTTAFSNSRSSSTISSTAMSSSTSSSSTRKENGGHNLNPPFFATFVMAILYHI 596

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/596 (66%), Positives = 460/596 (77%), Gaps = 6/596 (1%)

Query: 1   MKFSAATFVANAFLLYXXXXXXXXXXXXXXXXXXXYVIMNFEKKYGDSFENASNDRNAGA 60
           MK S  TFV +A L+                    YV MNF+KKYG SFENA +D     
Sbjct: 1   MKLSVLTFVVDALLVCSSIVDAGVTDFPSLPSNEVYVKMNFQKKYGSSFENALDDTKGRT 60

Query: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK 120
            L+ R+DDYELV+LTN+NSFYSVELDIGTPPQK+TVLVDTGSSDLWVTGS+NPYCSTK K
Sbjct: 61  RLMTRDDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCSTKKK 120

Query: 121 DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD 180
           DT+  SFKQ++KD  ASVVESV TEISYDTTI   EATAT D+T   SQ I+C TYGTF+
Sbjct: 121 DTTGSSFKQVNKDALASVVESVFTEISYDTTIVTSEATATFDSTASTSQLIDCATYGTFN 180

Query: 181 SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI 240
           +SKSSTF SN T+FSI YGD+TFASGTWGHDQL+LN+LN+TGLSFAVANETNSTVGVLGI
Sbjct: 181 TSKSSTFNSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGI 240

Query: 241 GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAV 300
           GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG IKS+AYSLF+N S+S+HGTILFGAV
Sbjct: 241 GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAV 300

Query: 301 DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLD 360
           DHGKY GDLYTIPIIN LQ+ GYKDPIQF VTLQG+  + GD  DN TTLTTTKIP LLD
Sbjct: 301 DHGKYAGDLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLD 360

Query: 361 SGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSN 420
           SGTTISY+P +LV++LAD+VGA+YSS YGYY+M+CI E++++ +++FDFGGF++S+WLS+
Sbjct: 361 SGTTISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSD 420

Query: 421 FQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYID 480
           FQL TDS S++CILG APQSDPT+ILGDNFL +TY+VYDLDNMEISMA A+FSD+ EYI+
Sbjct: 421 FQLVTDSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIE 480

Query: 481 VIESAVPSALKAPNYSNTWSTYESIVPGGNIFXXXXXXXXXXXXXXXXXXXXXXXLKGQK 540
           +IESAVPSALKAP YS+TWSTYESIV GGN+F                        KGQK
Sbjct: 481 IIESAVPSALKAPGYSSTWSTYESIVSGGNMFSTAANSSISYFASTSHSATSSSSSKGQK 540

Query: 541 LQXXXXXXXXXXXXX------XXXXXXXXXXRKENGGDNLSPPFFARLITTILYYI 590
            Q                             RKENGG NL+PPFFAR IT I ++I
Sbjct: 541 TQTSTTALSISKSTSSTSSTGMLSPTSSSSTRKENGGHNLNPPFFARFITAIFHHI 596

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/599 (64%), Positives = 445/599 (74%), Gaps = 11/599 (1%)

Query: 1   MKFSAATFVANAFLLYXXXXXXXXXXXXXXXXXXXYVIMNFEKKYGDSFENASNDRNAGA 60
           MKFSA T   NAFL Y                   YV + F+KKYGDSFENAS+++   A
Sbjct: 1   MKFSAITLATNAFLFYSSMANADSLASPSLAAGDNYVRIQFQKKYGDSFENASSNKKTEA 60

Query: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK 120
            LV+R DDYE+V L+N+NSFYSV+LDIGTP QK+TVLVDTGSSDLWVTGSNNPYCSTK  
Sbjct: 61  RLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVTVLVDTGSSDLWVTGSNNPYCSTKSG 120

Query: 121 DTSDFSFKQIHKDN----PASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTY 176
            TS  S ++  +DN      SVV+SV +EISYDTTI+  +ATAT D+T  A Q I+C TY
Sbjct: 121 HTSSSSKERKDEDNILSLVQSVVQSVASEISYDTTITDTDATATQDSTSSALQTIDCTTY 180

Query: 177 GTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVG 236
           G FDSSKSSTF+SNKT FSITYGD TFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVG
Sbjct: 181 GVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVG 240

Query: 237 VLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTIL 296
           VLGIGL GLESTYSG +LSS Q+SYTYNNFPMVLKNSGAIKS+AYSLF N++N++HG+IL
Sbjct: 241 VLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLNETNAKHGSIL 300

Query: 297 FGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIP 356
           FGAVDHGKY+GDLYTIPIIN LQ++GYKDPIQF VTLQG+ +A GD    +TT+TTTKIP
Sbjct: 301 FGAVDHGKYSGDLYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDS--ESTTITTTKIP 358

Query: 357 ALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISS 416
           ALLDSGTTISY+PV+L+E+LADK+GASYSS+ GYY+M+CI +   DI VVFDFGGF+IS 
Sbjct: 359 ALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFGGFYISG 418

Query: 417 WLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDND 476
            LS++QL  DSSSDVCILGFAPQSD TVILGDNFL + Y+VYDLDNMEISMA  D S   
Sbjct: 419 NLSSYQLSADSSSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMAQVDLSGRS 478

Query: 477 EYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIFXXXXXXXXXXXXXXXXXXXXXXXL 536
           E IDVIE +VPSA+KAP+YS+TWST  SIV GG+IF                        
Sbjct: 479 EDIDVIEDSVPSAVKAPSYSSTWSTDGSIVSGGDIFTVSSGSSNQRSGSGSYSTTSTSSS 538

Query: 537 KGQKLQXXXXXXXXXX-----XXXXXXXXXXXXXRKENGGDNLSPPFFARLITTILYYI 590
           KGQK Q                            +KEN G  L+PPFFA+ IT +L YI
Sbjct: 539 KGQKDQGSTTYAKSGAGSTASSTMASSSTSASSTKKENVGHTLNPPFFAKFITIVLSYI 597

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  518 bits (1335), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 274/491 (55%), Positives = 351/491 (71%), Gaps = 23/491 (4%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V + F K YGDS +N   D+   AHL +R D YE + +TN+ SFYSVELD+G+PPQ +T
Sbjct: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEIS----YDTT 151
           VLVDTGSSDLW+ GSNNPYCS+  +  S    + I K + +S   +++ +I+       T
Sbjct: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNS--RRRVIDKRDDSSSSGALVNDINPFGWLTGT 158

Query: 152 ISVIEATAT---------LDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDST 202
             +I  TAT           + P +   ++C  YGTF +S SSTF SN T FSI+YGD T
Sbjct: 159 GGLIGPTATGSGGSSETATQSVPASEATMDCKEYGTFTTSDSSTFRSNNTYFSISYGDGT 218

Query: 203 FASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYT 262
           FASGT+G D L+L++LNVTGLSFAVANETNST+GVLGIGLP LE TYSG + S  ++ + 
Sbjct: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278

Query: 263 YNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNG 322
           Y+NFP+VLKNSGAIK++AYSL+ N S++EHGTILFGAVDH KYTG LYTIPI+N L  +G
Sbjct: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338

Query: 323 YKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGA 382
           +  PIQF VT+ GI V+  D  +   TLTTTKIPALLDSGTT++YLP  +V L+AD++GA
Sbjct: 339 FSSPIQFDVTINGIGVS--DSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGA 396

Query: 383 SYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDP 442
            YS   GYYV++C  +    I  VFDFGGFHI++ LS+F L T S+   C+LG  P SD 
Sbjct: 397 QYSYRLGYYVLDCPSDDSTQI--VFDFGGFHINASLSSFILSTGST---CLLGIIPTSDN 451

Query: 443 T-VILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWST 501
           T  ILGD+FL + Y+VYDLDN+EISMA A ++   E I+VI S++PSA+KAP Y+NTWST
Sbjct: 452 TGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWST 511

Query: 502 YESIVPGGNIF 512
             +IV GGNIF
Sbjct: 512 SATIVTGGNIF 522

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  508 bits (1307), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 271/491 (55%), Positives = 349/491 (71%), Gaps = 23/491 (4%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V + F K YGDS EN  +D+     L++R D YE + +TN+ SFYSV+L++GTPPQ +T
Sbjct: 38  FVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVT 97

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEIS----YDTT 151
           VLVDTGSSDLW+ GS+NPYCS+    +S    + I K + +S   S+I +I+       T
Sbjct: 98  VLVDTGSSDLWIMGSDNPYCSSNSMGSS--RRRVIDKRDDSSSGGSLINDINPFGWLTGT 155

Query: 152 ISVIEATAT---------LDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDST 202
            S I  TAT           + P +   ++C  YGTF +S SSTF SN T FSI+YGD T
Sbjct: 156 GSAIGPTATGLGGGSGTATQSVPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGT 215

Query: 203 FASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYT 262
           FASGT+G D L+L++LNVTGLSFAVANETNST+GVLGIGLP LE TYSG + S   K+Y 
Sbjct: 216 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYK 275

Query: 263 YNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNG 322
           Y+NFP+VLKNSGAIKS+ YSL+ N S++ HGTILFGAVDH KYTG LYTIPI+N L  +G
Sbjct: 276 YDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 335

Query: 323 YKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGA 382
           +  PIQF VT+ GI ++  D   +  TLTTTKIPALLDSGTT++YLP  +V ++A ++GA
Sbjct: 336 FSSPIQFDVTINGIGIS--DSGSSNKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGA 393

Query: 383 SYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDP 442
            YSS  GYYV++C  +    + +VFDFGGFHI++ LS+F L   S+   C+LG  P SD 
Sbjct: 394 QYSSRIGYYVLDCPSD--DSMEIVFDFGGFHINAPLSSFIL---STGTTCLLGIIPTSDD 448

Query: 443 T-VILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWST 501
           T  ILGD+FL + Y+VYDL+N+EISMA A ++   E I++I S+VPSA+KAP Y+NTWST
Sbjct: 449 TGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWST 508

Query: 502 YESIVPGGNIF 512
             SIV GGNIF
Sbjct: 509 SASIVTGGNIF 519

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  503 bits (1294), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 273/493 (55%), Positives = 349/493 (70%), Gaps = 32/493 (6%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V ++F+K YGDS + A  D+     L +R D YE + +TN+ SFYSV+L++GTP Q IT
Sbjct: 39  FVKLSFDKLYGDSLDTAGRDKKPEVRLSKRADGYEEIIITNQQSFYSVDLEVGTPAQNIT 98

Query: 96  VLVDTGSSDLWVTGSNNPYCST--------KGKDTSDFSFKQIHKDNPASVVESVITEIS 147
           VLVDTGSSDLW+ GS+NPYCS+        + +DTS  S   ++  NP       +TE  
Sbjct: 99  VLVDTGSSDLWIMGSSNPYCSSDDSSKYVLRKRDTSSSSGDLVNDINPFGW----LTE-- 152

Query: 148 YDTTISVIEATATLDNTPLASQKI-------NCGTYGTFDSSKSSTFESNKTKFSITYGD 200
              T SV  ATAT   +  A+Q +       +C  YGTF SS SSTF+SN T F I+YGD
Sbjct: 153 ---TGSVTGATATATGSGTATQSVPASEATMDCEEYGTFTSSDSSTFKSNNTAFEISYGD 209

Query: 201 STFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKS 260
            TFA+GT+G D LNL++LNVTGLSFAVANETNST+GVLGIGLP LE TYSG S S+  KS
Sbjct: 210 GTFAAGTFGTDVLNLSDLNVTGLSFAVANETNSTMGVLGIGLPSLEVTYSGSSASNGGKS 269

Query: 261 YTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQN 320
           Y Y+NFP+VLKNSGAIKS+AYSL+ N S+++HGTILFG VDH KY+G LYT+ ++N L  
Sbjct: 270 YKYDNFPIVLKNSGAIKSNAYSLYLNDSDAKHGTILFGGVDHNKYSGTLYTVALVNTL-- 327

Query: 321 NGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKV 380
           +G+  PIQF +TL G+ +   +G  +  TLTTTKIP LLDSGTT++YLPV++VEL+A+ V
Sbjct: 328 SGFTSPIQFDITLNGLGIIDDNG--DEKTLTTTKIPVLLDSGTTLTYLPVEMVELIAENV 385

Query: 381 GASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQS 440
           GA YSS  GYYVM C         +VFDFGGFHI++ LS+F L T  S + C+LG  P S
Sbjct: 386 GAQYSSRIGYYVMECPSS-DNSTEIVFDFGGFHINASLSSFILST--SGNTCLLGIIPTS 442

Query: 441 DPT-VILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTW 499
           D T  ILGD+FL + Y+VYDL+N+EISMA A ++   E I+VI ++VP+A+KAP Y+NTW
Sbjct: 443 DSTGSILGDSFLTNAYVVYDLENLEISMAQAKYNVTSEDIEVISTSVPNAVKAPGYTNTW 502

Query: 500 STYESIVPGGNIF 512
           ST  SI  GGNIF
Sbjct: 503 STTASIATGGNIF 515

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  498 bits (1282), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/488 (53%), Positives = 346/488 (70%), Gaps = 18/488 (3%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V + F K YGD+ ++   D+     L++R D YE + +TN+ SFYSV+L++GTPPQ +T
Sbjct: 38  FVKLPFHKLYGDTRDDVGTDKKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVT 97

Query: 96  VLVDTGSSDLWVTGSNNPYCST-----------KGKDTSDFSFKQIHKDNPASVVESVIT 144
           VLVDTGSSDLW+ GSNNPYCS+             +D S  S   ++  NP   +    +
Sbjct: 98  VLVDTGSSDLWIMGSNNPYCSSGSMSSSRRRVINKRDDSSSSGALVNDINPFGWLTGTGS 157

Query: 145 EISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFA 204
            I    T S   +     + P +   +NC  +GTF +S SSTF SN T FSI+YGD TFA
Sbjct: 158 AIGPTATGSGGGSGTATQSVPASEATMNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFA 217

Query: 205 SGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYN 264
           SGT+G D L+L++LNVTGLSFAVANETNST+GVLGIGLP LE TYSG + SS ++ YTY+
Sbjct: 218 SGTFGTDILDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASSSRRPYTYD 277

Query: 265 NFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYK 324
           NFPMVLKNSGAIK++AYSL+ N S+++HGTILFGAVDH KY G LYT+PI+N L  +G+ 
Sbjct: 278 NFPMVLKNSGAIKTNAYSLYLNDSDAKHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFS 337

Query: 325 DPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASY 384
            PIQF VT+ GI ++  D  ++  TLTTT+IPALLDSGTT++YLP  +V ++AD++ A Y
Sbjct: 338 SPIQFDVTINGIGISYPD--NSQKTLTTTQIPALLDSGTTLTYLPQAVVAMIADELDAQY 395

Query: 385 SSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTV 444
           SS  GYYV++C         +VFDFGGFHI++ LS+F L   ++ ++C+LG    +D T 
Sbjct: 396 SSRLGYYVLDCPSN-SNSTQIVFDFGGFHINASLSSFIL---NAGNICLLGII-ATDDTT 450

Query: 445 ILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYES 504
           ILGD+FL + Y+VYDLDN+EISMA A ++  +E I+VI S++PSA+KAP Y++TWST  S
Sbjct: 451 ILGDSFLTNAYVVYDLDNLEISMAQAQYNITNENIEVITSSIPSAIKAPGYTSTWSTSAS 510

Query: 505 IVPGGNIF 512
           IV GGNIF
Sbjct: 511 IVTGGNIF 518

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  485 bits (1248), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 268/508 (52%), Positives = 345/508 (67%), Gaps = 37/508 (7%)

Query: 36  YVIMNFEKKYGDSFENASNDRN-AGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKI 94
           YV ++F+K YG++FE A   R+ A   + +R + YE V++TN+NSFYSV L++GTPPQ +
Sbjct: 27  YVKLDFDKYYGETFETAKRGRSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQSV 86

Query: 95  TVLVDTGSSDLWVTGSNNPYCS----TKGK-------------DTSDFSFKQI------- 130
            VLVDTGSSDLW+TGS+NPYC     T GK             D  D + ++        
Sbjct: 87  VVLVDTGSSDLWITGSDNPYCRGSTGTSGKNMLLEAELKRALEDARDIAKERTTLAPRDD 146

Query: 131 -HKDNPAS--VVESVITEISYDTTISVIE-ATATLDNTP-LASQKINCGTYGTFDSSKSS 185
            H D   S       +      TTI++ + A  T   T   A   INC  YGTFD+SKSS
Sbjct: 147 EHNDGLLSWLTGSDGLLGGQGGTTITLTDSAQPTAAGTSNGARATINCAKYGTFDTSKSS 206

Query: 186 TFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGL 245
           T+ SN T F I YGDSTFASGTWG D L+L++LNVTGLSFAVAN TNSTVGVLGIGLP L
Sbjct: 207 TWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGLPAL 266

Query: 246 ESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKY 305
           E TYSG +  S Q+ Y Y+NFP+VL  +GAIKS++YSLF N +++E G++LFGAVDH KY
Sbjct: 267 EVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVDHSKY 326

Query: 306 TGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTI 365
            GDLYTIP++N   + GYK+PIQF VTL G+ +++    DN TT+TTTKIPALLDSGTT+
Sbjct: 327 LGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSS--DN-TTITTTKIPALLDSGTTL 383

Query: 366 SYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFT 425
           +YLP  LV  +  K+ A+YS+  GYYV +C  +   D  VVFDFGGFHI++ ++NF +  
Sbjct: 384 TYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQ-SDDTEVVFDFGGFHINAPITNFII-- 440

Query: 426 DSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESA 485
            SS D CILG  PQS   +ILGD+FL S Y+VYDL+N EISMA A+++   E I+VI S+
Sbjct: 441 GSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQANYAGGQEDIEVISSS 500

Query: 486 VPSALKAPNYSNTWSTYE-SIVPGGNIF 512
           VP A++AP +S+TWST   S    G+IF
Sbjct: 501 VPGAVRAPGFSSTWSTLATSFNTQGDIF 528

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  473 bits (1216), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 253/493 (51%), Positives = 342/493 (69%), Gaps = 22/493 (4%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV + F+K  G ++E +S      A L +R+D ++ ++L N+ SF+SVEL+IGTP Q +T
Sbjct: 28  YVSLPFDKSRGSTYEESSKHNKPYAVLSKRDDGFQEIELKNQVSFFSVELEIGTPRQNVT 87

Query: 96  VLVDTGSSDLWVTGSNNPYCS--TKGKDTSDFSF------------KQIH-KDNPASVVE 140
           VLVDTGSSDLWVTGSNNPYC   + G   +D S             K+++ K +  S V 
Sbjct: 88  VLVDTGSSDLWVTGSNNPYCRAGSVGNRRNDASSGSGSGSGSSNNKKRVNIKRDEISSVR 147

Query: 141 SVITEISYDTTISVIEATATLDNT-PLASQKINCGTYGTFDSSKSSTFESNKTKFSITYG 199
           S +T    +T      A+AT  N+   A   I+C  YGTF++S SSTF SN T F I YG
Sbjct: 148 SWLTASGTNTRTQSGSASATRANSLSSALATIDCSQYGTFNTSASSTFSSNDTLFVIFYG 207

Query: 200 DSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQK 259
           DS++A GTWG D+L L+++++ GLSFAVAN+TNSTVGVLGIGLPGLE TYSG + SS + 
Sbjct: 208 DSSYAYGTWGQDELYLHDIDIGGLSFAVANQTNSTVGVLGIGLPGLEVTYSGYA-SSARN 266

Query: 260 SYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQ 319
            Y Y+NFP++LK +  IK++AYSLF N +NS  G++LFGAVDH KY+G LYT+P++N L+
Sbjct: 267 RYQYDNFPLILKRNNVIKANAYSLFLNSTNSSSGSLLFGAVDHSKYSGQLYTVPLLNTLE 326

Query: 320 NNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADK 379
           ++GY DPIQF V +QGI V T     + TTLTTT IPALLDSG T+SY PV++ E++AD 
Sbjct: 327 SSGYTDPIQFEVAVQGIGVRTS---GSNTTLTTTVIPALLDSGATLSYFPVQVAEMIADA 383

Query: 380 VGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQ 439
           + A+YSS YGYY+++C      D  +++DFGGFHI+S L+++ L T+  S +C+LG  PQ
Sbjct: 384 LDATYSSSYGYYIVDCPSS-DDDTEIIYDFGGFHIASKLTDYILTTNRPS-ICVLGIVPQ 441

Query: 440 SDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTW 499
           +    ILGD FL S Y+VYDLDN EIS+A A++   DE I+VI  +VPSA+KAP+YS+T 
Sbjct: 442 NSNRFILGDVFLTSAYVVYDLDNFEISLAQANYEGGDEQIEVISESVPSAIKAPSYSSTR 501

Query: 500 STYESIVPGGNIF 512
            +  S   GG+IF
Sbjct: 502 FSSASASTGGDIF 514

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  470 bits (1209), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 268/549 (48%), Positives = 343/549 (62%), Gaps = 58/549 (10%)

Query: 1   MKFSAATFVANAFLLYXXXXXXXXXXXXXXXXXXXYVIMNFEKKYGDSFENASNDRNAGA 60
           M+ S   ++ ++ LL+                   YVI+ F K  GDS+E+A+ D+    
Sbjct: 1   MRLSTIKYIFSSSLLFTNILASTIPEHETTDQSSKYVILPFNKLVGDSYEDATPDKKPHF 60

Query: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCS--TK 118
            LV+R+  YE V + NE SFYSVEL IGTP QKITVLVDTGSSDLW+ GS+NPYC+  + 
Sbjct: 61  ALVKRDGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYCASTSN 120

Query: 119 GKDT-----------------------------SDFSFKQIHK-DNPASVVESVITEISY 148
           GK+                              SDFSF  + + D P  V        S 
Sbjct: 121 GKNVMRKDDSNLPDGILFTEITVTNLSDLTGFFSDFSFIPMSETDIPTGVT-------ST 173

Query: 149 DTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTW 208
           +T    +  T T +N  L+ + I+C  YGTFD ++SSTF++N T F  +YGDSTFASGTW
Sbjct: 174 NTVGGPVFPTQT-NNIALSERTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTW 232

Query: 209 GHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPM 268
            HD LNL  LN+TGLSFAVAN +NSTVGVLGIGLPGLE+TYSG    S  K Y YNNFPM
Sbjct: 233 AHDVLNLGGLNITGLSFAVANMSNSTVGVLGIGLPGLETTYSG----STSKLYQYNNFPM 288

Query: 269 VLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQ 328
           +LK SGAI S++YSLF +  +++ G++LFGAVDH KY G+LYT+P++NIL + GY +PIQ
Sbjct: 289 LLKQSGAIDSTSYSLFLDDLDAKQGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQ 348

Query: 329 FHVTLQGIAVATGDGMDNAT---TLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYS 385
           F VTL GI      G+ N +   T+TT K PALLDSGTTISY P ++V+ +A ++GA YS
Sbjct: 349 FDVTLAGI------GIQNDSKNYTVTTNKFPALLDSGTTISYFPQEVVQTIARQLGARYS 402

Query: 386 SEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVI 445
           S  G+Y M+C + V      VFDFGGFHI+  +S+F L T  S + C+L  APQ    ++
Sbjct: 403 SALGFYAMSC-NGVSSSTNFVFDFGGFHITGPVSDFLLPT--SGNTCVLAMAPQESQHIL 459

Query: 446 LGDNFLVSTYIVYDLDNMEISMANADFSDN--DEYIDVIESAVPSALKAPNYSNTWSTYE 503
           LGD FL   Y+VYDLDN EIS+A A+      D  I +I  +VPSA+KAP YS TWS   
Sbjct: 460 LGDIFLTHAYVVYDLDNYEISLAQANTGTQNLDSNIQIISDSVPSAIKAPLYSETWSKAM 519

Query: 504 SIVPGGNIF 512
            I  GGNIF
Sbjct: 520 PISTGGNIF 528

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  462 bits (1188), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 246/477 (51%), Positives = 318/477 (66%), Gaps = 52/477 (10%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V  +F+K  GDSFENASN     A++V+R++  E V++ N+++FYSV L IG+  Q +T
Sbjct: 64  FVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGSNAQNVT 123

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VL+DTGSSDLWVTGSNNP CS +G   SD                               
Sbjct: 124 VLLDTGSSDLWVTGSNNPLCS-RGDSNSD------------------------------- 151

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                          ++C  +GTF+ S S T+ SN+T FSI+Y DS++ASGTWG D L L
Sbjct: 152 --------------AVDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKL 197

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGA 275
            +L+VTGLSFAVAN TNSTVGVLGIGLP LE TYSG S +     Y Y NFP++LKNSGA
Sbjct: 198 QDLDVTGLSFAVANYTNSTVGVLGIGLPSLEVTYSG-SNNVAGTRYQYENFPLLLKNSGA 256

Query: 276 IKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG 335
            K++AYSL+ N  +S  G++LFG VDH KY+G LYTIP++N L+  G+  P++F VTLQG
Sbjct: 257 TKANAYSLYLNDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVEFDVTLQG 316

Query: 336 IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
           + ++  D      TLTTTKIPALLDSGTT+ YLP  LV L+AD+  A Y+S  GYYVMNC
Sbjct: 317 MGIS--DDEHGNVTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNC 374

Query: 396 IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTY 455
             +  +D  +VFDFGGFHIS+ L+ + +   +   +C+LG  PQS  T ILGD+FL   Y
Sbjct: 375 -PDSDEDSQIVFDFGGFHISTNLTTYII--QAVGGICVLGILPQSSGTAILGDSFLQHAY 431

Query: 456 IVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           +VYDLDN+EISMA A F  +DE ++VI S++PSA+KAP YS+TWST+ SI  GGNIF
Sbjct: 432 VVYDLDNLEISMAQASFETDDENVEVISSSIPSAVKAPGYSSTWSTFSSISSGGNIF 488

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  447 bits (1151), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 234/484 (48%), Positives = 315/484 (65%), Gaps = 55/484 (11%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV M FEKK+GD++  A+  +     L +R   YE + LTN+ SF+SVELD+GTP Q +T
Sbjct: 21  YVGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEEITLTNQQSFFSVELDVGTPAQNVT 80

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VLVDTGSSDLW+TG++NPYC T     +D   ++                          
Sbjct: 81  VLVDTGSSDLWITGADNPYCLTYSGSGADSIPRR-------------------------- 114

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTK--FSITYGDSTFASGTWGHDQL 213
                         +++C  YGTF    SST+  N +   F ITYGD+TFASG WG D L
Sbjct: 115 -------------DRVDCSEYGTFSLEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHL 161

Query: 214 NLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNS 273
           +L ++NVTG+SFAVAN TNSTVGV+GIGLPGLE+T SG       + YTY NFP VLKNS
Sbjct: 162 HLQDVNVTGVSFAVANRTNSTVGVMGIGLPGLETTNSG------SRPYTYANFPQVLKNS 215

Query: 274 GAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTL 333
           GA +S+ YSL+ N    E G+ILFGAVDH KYTG +YT+PIIN LQ+ GY  PIQF +TL
Sbjct: 216 GATQSALYSLYLNDLEEERGSILFGAVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITL 275

Query: 334 QGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVM 393
           QGI +++ +   +  T+T+TK+PALLDSGTT++YLP  +V  +A ++GAS S+ +G YV+
Sbjct: 276 QGIGLSSSESNGDEVTITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVL 335

Query: 394 NCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVS 453
            C   V +++ +V+DFGGFHI+S L+N+     +S  +CILG  P+   T ILGD FL  
Sbjct: 336 PC-SNVPENMHLVYDFGGFHINSNLTNY--IVQASQTLCILGLFPRDSNTAILGDTFLTD 392

Query: 454 TYIVYDLDNMEISMANADF--SDNDEYIDVI--ESAVPSALKAPNYSNTWST-YESIVPG 508
            Y+VYDL+N++I +A A F  SD+D  ID++   + +PSA +AP+YS+TWST   ++  G
Sbjct: 393 AYVVYDLENLQIGLAQAKFGVSDSDAKIDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTTG 452

Query: 509 GNIF 512
           GNIF
Sbjct: 453 GNIF 456

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  447 bits (1150), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 232/487 (47%), Positives = 322/487 (66%), Gaps = 20/487 (4%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV ++F+K  GD+ E+A       A LV+R D  E +K+ N+N+FYSVE+ +G+P Q +T
Sbjct: 34  YVRISFDKLRGDTAEDARVGLMPRAELVKRADGSETIKIKNQNNFYSVEVGVGSPAQNVT 93

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQ--------IHKDNPASVVESVITEIS 147
           +L+DTGSSD+WV GSNNP+C    + +      +        + KD  +S   S++T  +
Sbjct: 94  LLIDTGSSDMWVMGSNNPFCEGSSRSSKHVLLGENIGLEDETVKKDFFSSF-RSLLTATA 152

Query: 148 YDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGT 207
             +T+S      +  +   +   ++C +YGTF +  SS+F+SN T F I YGD T+A GT
Sbjct: 153 -TSTVSASAVAPSRTSVAASDATLSCSSYGTFATGSSSSFKSNNTDFYIQYGDLTYALGT 211

Query: 208 WGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFP 267
           WGHD + L ++ V+ LS AVANE+NST GVLGIGL GLE T  G  +SS + +YTY N P
Sbjct: 212 WGHDDVTLQDITVSDLSMAVANESNSTFGVLGIGLTGLEVTNVGSLVSSSRSAYTYQNLP 271

Query: 268 MVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPI 327
            +L + G I  +AYSLF +  ++EHG++LFGAVDH KYTG+LYT+P++NI +++G+ DPI
Sbjct: 272 ALLVDQGKIHQNAYSLFLDDLDAEHGSVLFGAVDHSKYTGNLYTVPLVNIYKSSGFPDPI 331

Query: 328 QFHVTLQGIAVATGDGMDNAT--TLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYS 385
           Q  VTLQG+ ++      N T  T TTT IPALLDSGTT++YLP  +V+ +A ++ A YS
Sbjct: 332 QLDVTLQGLGMSA-----NKTNITFTTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQYS 386

Query: 386 SEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVI 445
            + GYYV+ C  EV     +VFDFGGFHI S L NF +   +SS+ C LG  PQS    I
Sbjct: 387 YDVGYYVLEC-SEVSDSDELVFDFGGFHIKSKLQNFLI--KASSNFCALGLVPQSSSRAI 443

Query: 446 LGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESI 505
           LGDNFL + Y+VYDL+N+E+SMA A++    E I+VI S +P A+KAP YS+TWS+   I
Sbjct: 444 LGDNFLTAAYVVYDLENLEVSMAQANYDGGSEDIEVISSTIPGAVKAPGYSSTWSSRIPI 503

Query: 506 VPGGNIF 512
             GGNIF
Sbjct: 504 STGGNIF 510

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 238/471 (50%), Positives = 324/471 (68%), Gaps = 28/471 (5%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV ++F+K  G+S+E A       A L +R+D YE +++ NE +FYS+EL+IGTP Q +T
Sbjct: 31  YVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNVT 90

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VL+DTGSSDLWV+   NPYC              I  D+   V     T++S  +T++  
Sbjct: 91  VLLDTGSSDLWVSSPENPYC--------------IDSDDTKPV-----TQLS-TSTLATS 130

Query: 156 EATATLD-NTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLN 214
             TAT   N+ +A+  ++C  YGTFD SKS++F SN T FSI+YGD+TFASGTWG D  +
Sbjct: 131 SGTATSSGNSGIAT--VDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFD 188

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG 274
           L +LNVT LSFAVAN++NSTVGV+GIGL GL+STY GV+ S+   +Y Y NFPM LK+ G
Sbjct: 189 LGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVN-SASSGAYQYENFPMALKSQG 247

Query: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334
            I  +AYSLF N+ +++ G++LFGAVDH KY+G LYT+P++N+ +N G ++PI+F VT+Q
Sbjct: 248 IIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDVTVQ 307

Query: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394
           G++V +G  + N   LT T+ PALLDSGTT+SY+P  L +L+A  VGA YS   GYY M 
Sbjct: 308 GVSVTSGSTIRN---LTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMR 364

Query: 395 CIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVST 454
           C  E   D  + FDFGGF IS+ LS++ L + SSS  C LG  P +    I GDNFLV  
Sbjct: 365 CPSE-NNDTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFLVHA 423

Query: 455 YIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESI 505
           Y+VYDL+N EISMA A F+++D  I+VI  ++PSA++A  YS+TWST ++I
Sbjct: 424 YVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQAI 474

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  441 bits (1134), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 244/491 (49%), Positives = 330/491 (67%), Gaps = 29/491 (5%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           Y+ + F+K  G+SF+ +S D       +++  +Y +  LTN+ SFYSVEL IGTP Q +T
Sbjct: 39  YLKLGFDKYVGESFDKSSKDS------LQKRAEYAIFNLTNQASFYSVELAIGTPSQNVT 92

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSD--FSFKQIHKDNPASVVESVITEISYD---- 149
           VLVDTGSSDLWVTGS+NP CST   D  D  ++FK+   +      E+ ITE   +    
Sbjct: 93  VLVDTGSSDLWVTGSDNPLCSTDSSDDDDDSYAFKKKRAETIVVTEEATITENGNNLDGL 152

Query: 150 --------TTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDS 201
                   +T +      +  ++  +S   +C  YGTF+++ SST+ SN T F I+YGDS
Sbjct: 153 DPFGWLGGSTATSGSFETSFPSSSSSSGDFDCSEYGTFNTNDSSTWSSNHTSFFISYGDS 212

Query: 202 TFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSY 261
           + A G WG D L++++++V+G+SFAVAN TNSTVGVLGIGL GLE+TYSG S S   +SY
Sbjct: 213 SVAEGVWGQDVLSISDVDVSGVSFAVANYTNSTVGVLGIGLSGLETTYSGTSSS---ESY 269

Query: 262 TYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNN 321
            Y N PM+LK+SG I + AYSLF N+ +   G +LFGAVDH KY+G LYT+PI+N+  + 
Sbjct: 270 IYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGNLLFGAVDHSKYSGSLYTLPIVNVYASE 329

Query: 322 GYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVG 381
           GYK+P++F VT+ G+ ++T    D+ TT+ T KIPALLDSGTTI Y P  L+EL+AD++G
Sbjct: 330 GYKNPLEFDVTMYGLGISTS---DSNTTIATMKIPALLDSGTTIVYFPETLLELVADQLG 386

Query: 382 ASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSD 441
           ASYS E G+Y M+C+     D   VFDFGGFHI+  LS+F +    S   CIL  A Q D
Sbjct: 387 ASYSDELGFYAMSCVSS-SDDTEFVFDFGGFHITVPLSDFLIRVSGSE--CILAMAAQDD 443

Query: 442 PTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWST 501
            ++ILGD FL + Y+VYDL+N EISMA A++   DE I+VI S VPSA+KA +YSN+WS+
Sbjct: 444 ESIILGDYFLTNAYVVYDLENYEISMAQANYDSEDEDIEVISSTVPSAVKAASYSNSWSS 503

Query: 502 YESIVPGGNIF 512
             SI  GG+IF
Sbjct: 504 TGSITSGGDIF 514

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  434 bits (1117), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 235/479 (49%), Positives = 308/479 (64%), Gaps = 47/479 (9%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           Y+ +NFEK+YGDSF N+S+     A L++R+D YE V LTN+ SFYSVE+++GTP QK+T
Sbjct: 33  YLALNFEKRYGDSFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYSVEVEMGTPSQKLT 92

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VL+DTGSSD WVT S+NPYC T   + S +  +                           
Sbjct: 93  VLLDTGSSDFWVTSSDNPYCGTTSTEGSLYGGE--------------------------- 125

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                          I+C TYGTFDSSKSSTF+SN T F I+YGD +FA GTWG D + L
Sbjct: 126 -----------TQDTIDCSTYGTFDSSKSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKL 174

Query: 216 NN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG 274
           ++ L++  +S AVA+ TNS++GVLGIGL  LE+TYS     + + SY Y+NFP+ LK SG
Sbjct: 175 DDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYMYDNFPISLKKSG 234

Query: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334
            I+S+AYSL+ N  +S+ G ILFG VDH KYTG LYT+P+++      YK P++F VTL 
Sbjct: 235 LIESTAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYTVPMLS--STTSYKTPVEFDVTLN 292

Query: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394
           GI +    G  N  TLT T+   LLDSGTT SYLP  LV ++ +++GASY S  GYY ++
Sbjct: 293 GIGIIDSSG--NKKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTID 350

Query: 395 CIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVST 454
           C  E   D  +VFD GGFHI++ LS+F +    S+  CIL   PQ D  V+LGD+FL + 
Sbjct: 351 CSAEDSDDTKIVFDMGGFHINTTLSDFVI--QISTSTCILSIVPQ-DGKVVLGDSFLNNA 407

Query: 455 YIVYDLDNMEISMANADFSDNDEY-IDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           YIVYDLDN EI+MA A +    E  IDVI + +PSA++AP YS+TWST  SI  GG+IF
Sbjct: 408 YIVYDLDNYEIAMAQAAWDSTREANIDVISTTIPSAIRAPGYSSTWSTSRSISSGGDIF 466

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  432 bits (1111), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 235/478 (49%), Positives = 313/478 (65%), Gaps = 49/478 (10%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           ++   F+K YGDS++N+S        +V+R D YE ++L NE+SFYS++L IGTP Q +T
Sbjct: 44  FIKFKFDKSYGDSYKNSSKRNKPKLDIVKR-DGYEEIELKNESSFYSIKLSIGTPAQNVT 102

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VL+DTGSSDLWVTGS+NP CS+                                      
Sbjct: 103 VLIDTGSSDLWVTGSDNPLCSSD------------------------------------- 125

Query: 156 EATATLDNTPLASQK-INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLN 214
              AT   +  +SQ  I+C  YGTFD   SS+F SN T F+ITYGD ++A G WG D L+
Sbjct: 126 --DATFTGSDGSSQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLS 183

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG 274
           L +++VTGLSFAVAN TNSTVGVLGIGLP LE+TYSG SL+     Y Y+N P+VL+NSG
Sbjct: 184 LQDIDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSG-SLAG-SNPYQYDNLPLVLRNSG 241

Query: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334
           A+KS AYSLF N  +S  G+ILFG VDH KY G L T+P++N  +++G++ P +F +TLQ
Sbjct: 242 AVKSYAYSLFLNDEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQ 301

Query: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394
           G+ ++T       TT++ T+I ALLDSGTT++YLPV L  LLA ++ ASYS+  GYY M+
Sbjct: 302 GLGISTS---SKNTTVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMS 358

Query: 395 CIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVST 454
           C         +VFDFGGFHI+  L++F     SS +VCILG  P+S    ILGD+FL   
Sbjct: 359 CPSS-SDSTEIVFDFGGFHINVPLTSF--IVTSSMNVCILGIIPRSGDQAILGDSFLQHA 415

Query: 455 YIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           Y+VYDL+N+EIS+A A +  + E I+ I S+VPSA++A +YSNTWST  +I  GG+IF
Sbjct: 416 YVVYDLENLEISLAQAKYGSSSEDIEAIVSSVPSAVRAASYSNTWSTAATINSGGDIF 473

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/483 (49%), Positives = 321/483 (66%), Gaps = 61/483 (12%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV + F+K YGDSFE ++      + L +R   YELV L N  +FYSV+LDIGTP Q IT
Sbjct: 34  YVNLKFKKTYGDSFEGST----TWSALAKRTRGYELVDLVNRQNFYSVDLDIGTPSQTIT 89

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VLVDTGSSDLWVTGS+NPYC                     SV  ++++           
Sbjct: 90  VLVDTGSSDLWVTGSDNPYC--------------------VSVKSNLVS----------- 118

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                      ++ K +C TYGTFD ++SST+ SN T FSITYGD++FA GTWG D+L+L
Sbjct: 119 -----------STNKFDCNTYGTFDKNQSSTWSSNDTLFSITYGDTSFARGTWGQDKLHL 167

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGA 275
           ++L+V+GLSFAVAN TNSTVGVLGIGLPGLE TY    +++ +  Y Y+NFPM+LKNSGA
Sbjct: 168 DDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVTY----INAPRNRYQYDNFPMILKNSGA 223

Query: 276 IKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG 335
             S+ YSL  +   +EHGT+LFGAVDH KYTG LYTIP++N L+ +G+ DP +F VTLQG
Sbjct: 224 THSNLYSLHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFSDPAKFEVTLQG 283

Query: 336 IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
           + +      +  TTLT TKI ALLDSGTT++YLP  LV+++AD +GA +SS YGYY+++C
Sbjct: 284 VGIV---ANNTQTTLTNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSC 340

Query: 396 IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDP-TVILGDNFLVST 454
                 D T+VFDFGGFHI+  L++F    ++  +VC+L    ++   + ILGDNFL++ 
Sbjct: 341 RAVENSDTTLVFDFGGFHINGKLTDF--IVETFGNVCLLTIIEETGSNSAILGDNFLINA 398

Query: 455 YIVYDLDNMEISMANADFS-DNDEYIDVIES--AVPSALKAPNYSNTWSTYESIVP--GG 509
           Y+V+DL+N EISMA A  + D+D+ I+++ S   V SA+ A  YS+TW+   S +    G
Sbjct: 399 YVVFDLENNEISMAQALHNVDDDQDIEIVTSNAGVASAVTALGYSSTWTAEPSTIETFAG 458

Query: 510 NIF 512
           +IF
Sbjct: 459 DIF 461

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  421 bits (1081), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 230/480 (47%), Positives = 307/480 (63%), Gaps = 54/480 (11%)

Query: 36  YVIMNFEKKYGDSFENASND-RNAGAHLVRRE-DDYELVKLTNENSFYSVELDIGTPPQK 93
           +V + F KKYGD ++ AS D R     LV+R+  DYE V+LTN+ SFYSVE+D+GTP Q+
Sbjct: 33  FVNLRFNKKYGDHYDTASTDSRKPKLELVKRDGSDYEEVELTNQQSFYSVEVDVGTPSQR 92

Query: 94  ITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTIS 153
           +TVL+DTGSSD WV GS+NPYCS    DTS                              
Sbjct: 93  VTVLLDTGSSDFWVMGSDNPYCS---DDTS------------------------------ 119

Query: 154 VIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQL 213
                         +  I+C  +GTFDSS SSTF +N T F+I YGD +FA GTWG D +
Sbjct: 120 --------------TTGIDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWGTDTV 165

Query: 214 NLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNS 273
           +++++ +  LS AVAN +NS++GV+G+GL GLE+TYS        ++Y Y NFP+ LKN+
Sbjct: 166 SIDDITLDALSLAVANSSNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQYANFPLALKNA 225

Query: 274 GAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTL 333
           G + ++AYSL+ N      G ILFGAVDH  Y+G LYTIP++NI   +G+K+ ++F VTL
Sbjct: 226 GIVAANAYSLYLNDPEETTGNILFGAVDHSLYSGQLYTIPLVNIYSGSGFKNAVEFDVTL 285

Query: 334 QGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVM 393
            GI +    G  +ATT++TT I ALLDSGTT++Y P + V LLA ++GA YSS  GYY +
Sbjct: 286 NGIGIVDSSG--SATTVSTTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTI 343

Query: 394 NCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVS 453
           +C         +VFDFGGFHI++ L++F +   S +  C L   PQ+  + ILGD FL +
Sbjct: 344 SCDAMQDTTTKLVFDFGGFHINATLADFVV--QSGTSTCFLSIIPQNSSSAILGDTFLNN 401

Query: 454 TYIVYDLDNMEISMANADF-SDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            Y+VYDLDN+EISMA A +   +DE I+VI S+VPSA+KAP YSNTWST  SI  GGNIF
Sbjct: 402 AYVVYDLDNLEISMAQAKWDQSSDEDIEVISSSVPSAVKAPGYSNTWSTTMSITSGGNIF 461

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  417 bits (1071), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 234/500 (46%), Positives = 327/500 (65%), Gaps = 36/500 (7%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V M+F+K  G+    AS  +    HL +R D Y  V++ N+N+FYSV+L+IGTP QK+ 
Sbjct: 36  HVFMSFDKLRGNDASEASLSKRRVGHLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVG 95

Query: 96  VLVDTGSSDLWVTGSNNPYC----------------------STKGKDTS-DFSFKQIHK 132
           VL+DTGSSDLWV GS NP+C                      S  G D + D+++  I  
Sbjct: 96  VLIDTGSSDLWVPGSGNPFCSASRSSSKKKRQDYTALLSSLLSVFGTDVATDYTYTGIAS 155

Query: 133 DNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKT 192
              ++  ++V T ++  T      A  ++ + P +   ++C  +GTFD+SKSS+++SN T
Sbjct: 156 ATGSAGTQTVPTALTSGTV-----AATSIRSVPSSLATLDCSEFGTFDTSKSSSWQSNDT 210

Query: 193 KFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGV 252
           +F I+Y D TFA G WG D+++L+++NVTGLSFAV+N T+S  GVLGIGL G ESTYSG 
Sbjct: 211 RFYISYADGTFADGDWGVDEIHLDDVNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSG- 269

Query: 253 SLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTI 312
            LS+  + Y Y+NFP+VL+ +G I+ +AYS+F N  +++ G+ILFGAVDH KYTG LYT+
Sbjct: 270 QLSTYNR-YQYDNFPIVLQRNGVIEKNAYSVFLNDLDADSGSILFGAVDHSKYTGTLYTV 328

Query: 313 PIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
           P++N L++ GY + I+  +TLQGI V +  G +   T+T TK PALLD+G T  Y P  L
Sbjct: 329 PMVNALRSIGYTEQIRLSITLQGIGVTSSYGNE---TVTQTKYPALLDTGATFCYFPSSL 385

Query: 373 VELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVC 432
              +A  V A+YSS  GYY ++C  +   D  +VFDFGGFHI S LS++ + T SSS  C
Sbjct: 386 AAAIASSVSATYSSSSGYYFVDC--DSGSDYDLVFDFGGFHIISPLSDY-IVTTSSSSQC 442

Query: 433 ILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKA 492
           +LG  PQSD  + LGD FL S Y+VYDL+ +EIS+A A ++  DE I+VI  +VPSA+ A
Sbjct: 443 VLGILPQSDNEITLGDAFLTSAYVVYDLEELEISLAQASYTSGDEKIEVIRDSVPSAVAA 502

Query: 493 PNYSNTWSTYESIVPGGNIF 512
           P YS+TWST  S+  GGNIF
Sbjct: 503 PGYSSTWSTAASLSTGGNIF 522

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  404 bits (1037), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 228/503 (45%), Positives = 310/503 (61%), Gaps = 58/503 (11%)

Query: 62  LVRRE--DDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCST-- 117
           L +R+  D Y L+ + N+ SFYSV+L+IGTPPQK+TVLVDTGSSDLWV G++NP C++  
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64

Query: 118 KGK----DTSDFSFKQIHKDNPASVVESVITEISYD-------------------TTISV 154
           +GK    D  D   +   +     V   V+T    D                   T ++ 
Sbjct: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWTMMTG 124

Query: 155 IEATATLDNT----------------PLASQKINCGTYGTFDSSKSSTFESNKTKFSITY 198
            E T  +  T                  A   + C TYGTFD SKSSTF+SN T F+I+Y
Sbjct: 125 AENTMMMTGTGTETAVATGVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184

Query: 199 GDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQ 258
           GD+++ASG+WG D +++N LNV+G+SFAVAN +NS++GVLGIGLPGLE T    + +S +
Sbjct: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244

Query: 259 KS--------YTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLY 310
           K         Y Y NFPMVLKN G I   AYSLF N    + G++LFGAVDH KYTG LY
Sbjct: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLY 304

Query: 311 TIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPV 370
           T+P+++I  ++    P++F +TL G+ V   D   + +T+ TT IPALLDSGTTISY P 
Sbjct: 305 TVPLVDIYHDSASSKPVEFDITLYGLGV---DKDGSQSTIATTTIPALLDSGTTISYFPA 361

Query: 371 KLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSD 430
           +L   +A K  A+Y S  G+Y M+C ++   +  +VFDFGGFHI++ L +F +    SS 
Sbjct: 362 QLANEIARKFNATYDSRSGFYTMSCSYDT-SNTNLVFDFGGFHITAPLDDFVV--QQSSQ 418

Query: 431 VCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADF-SDNDEYIDVIESAVPSA 489
            C+L   PQ +  V+LGD FL + Y+VYDL+N+E+SMA A+F S   E ++VI S VPSA
Sbjct: 419 TCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSA 478

Query: 490 LKAPNYSNTWSTYESIVPGGNIF 512
           +KA +YSN WS+   +  GGNIF
Sbjct: 479 VKAASYSNPWSSAVMMSTGGNIF 501

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  402 bits (1032), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/491 (45%), Positives = 309/491 (62%), Gaps = 63/491 (12%)

Query: 36  YVIMNFEKKYGDSFENAS--NDRNAGAHLV---------RREDDYELVKLTNENSFYSVE 84
           ++ + F K YG SF+ A    D N G H +         R   DY+ +++ N+ SFYS++
Sbjct: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLD 95

Query: 85  LDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVIT 144
           L IGTP Q +TV +DTGSSDLWVTGSNNPYC+                            
Sbjct: 96  LFIGTPGQNVTVQIDTGSSDLWVTGSNNPYCNG--------------------------- 128

Query: 145 EISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFA 204
                         +T  +T  + +  NC  YGTF+++KSST+ SN ++F I YGD+TFA
Sbjct: 129 --------------STFSDTVPSRELFNCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFA 174

Query: 205 SGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYN 264
           SGTWG D +++N LNVTGL+FAVAN +NS+  VLGIGL  LE+TY+G   S+   SYTY 
Sbjct: 175 SGTWGRDVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQLETTYNG---SNSSHSYTYA 231

Query: 265 NFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYK 324
           NFP+VLKN+G  +S +YSLF N+ ++E G+ILFGAVDH KY+G+LYT+P++N  ++ G+ 
Sbjct: 232 NFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFP 291

Query: 325 DPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASY 384
           +PI+F VTLQGI + +G      TT+T TK+ A+LDSGT+++ LP  ++  +A  +   Y
Sbjct: 292 NPIEFAVTLQGIGIVSG---SKKTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRY 348

Query: 385 SSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTV 444
           S     Y+++C      +  +VFDFGGF I   LSNF L  +   D+CILG +   + +V
Sbjct: 349 SPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL--EIEDDICILGLSSVDENSV 406

Query: 445 ILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIE--SAVPSALKAPNYSNTW-ST 501
           ILGD FL S Y+VYDL+N++ISMA A F ++   IDVI   S VPSA+KAP YS+TW +T
Sbjct: 407 ILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAPGYSSTWTAT 466

Query: 502 YESIVPGGNIF 512
             SI  GGNIF
Sbjct: 467 PSSISTGGNIF 477

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  398 bits (1023), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 279/461 (60%), Gaps = 59/461 (12%)

Query: 54  NDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNP 113
           N   AG  L +R + +E   L NE SFYSVEL IGTP Q +TVL+DTGS+DLWV    N 
Sbjct: 36  NQDGAGNVLGKRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGN- 94

Query: 114 YCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINC 173
                                                              P     ++C
Sbjct: 95  ---------------------------------------------------PYCGSVMDC 103

Query: 174 GTYGTFDSSKSSTFESNKTK-FSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETN 232
             YG FD +KSSTF++NK+  F   YGD TFA G +G D+L  N L+++GLSFAVANE+N
Sbjct: 104 DQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGLSFAVANESN 163

Query: 233 STVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEH 292
           ST GVLGIGLP LE TYSG      +KSY Y+NFP+ LK SGAI ++AYSLF N  +   
Sbjct: 164 STFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLNDESQSS 223

Query: 293 GTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTT 352
           G+ILFGAVDH KY G LYT+P++N+ ++ GY+ P+ F VTL GI + T     + TTLT 
Sbjct: 224 GSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTD---RHNTTLTA 280

Query: 353 TKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGF 412
           TKIPALLDSGTT++YLP + V LLA  + A+YS   GYY   C      D +V FDFGGF
Sbjct: 281 TKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSS-DNDTSVAFDFGGF 339

Query: 413 HISSWLSNFQLFTDSSSDVCILGFAPQS-DPTVILGDNFLVSTYIVYDLDNMEISMANAD 471
           HI++ +S+F + T S    C+L   PQ+ + T ILGD+FL + Y+VYDLDN E+S+A A 
Sbjct: 340 HINAPVSDFTMQT-SVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLAQAK 398

Query: 472 FSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           +    E I+ I+S VPSA +AP Y++TWS Y S+  GGNIF
Sbjct: 399 YGTGAEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGNIF 439

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  396 bits (1018), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/479 (46%), Positives = 287/479 (59%), Gaps = 70/479 (14%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV + F KK     +N  N       L +R + +E   L NE SFYSVEL IGTP Q +T
Sbjct: 28  YVKIPFTKK-----KNGDN-----GELSKRSNGHEKFVLANEQSFYSVELAIGTPSQNLT 77

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VL+DTGS+DLWV G  N                                           
Sbjct: 78  VLLDTGSADLWVPGKGN------------------------------------------- 94

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTK-FSITYGDSTFASGTWGHDQLN 214
                    P     ++C  YG FD +KSSTF++NK+  F   YGD T+A G +G D+L 
Sbjct: 95  ---------PYCGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLK 145

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG 274
            N L+++GLSFAVANE+NST GVLGIGL  LE TYSG      ++SY Y+NFP+ LK+SG
Sbjct: 146 YNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSG 205

Query: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334
           AI ++AYSLF N  +   G+ILFGAVDH KY G LYTIP++N+ ++ GY+ P+ F VTLQ
Sbjct: 206 AIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQ 265

Query: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394
           G+ + T        TLTTTK+PALLDSGTT++YLP + V LLA  + ASYS   GYY   
Sbjct: 266 GLGLQTD---KRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYT 322

Query: 395 CIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQS-DPTVILGDNFLVS 453
           C     K  +V FDFGGF I++ LS+F + T  S   C+L   PQ+ + T ILGD+FL +
Sbjct: 323 CPSSDNK-TSVAFDFGGFRINAPLSDFTMQT--SVGTCVLAIIPQAGNATAILGDSFLRN 379

Query: 454 TYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            Y+VYDLDN EIS+A A +    E ++VI+S VPSA++AP+Y+NTWS Y S   GGNIF
Sbjct: 380 AYVVYDLDNYEISLAQAKYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASATSGGNIF 438

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  396 bits (1018), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/479 (47%), Positives = 285/479 (59%), Gaps = 70/479 (14%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV M F KK G+S  +          L +R   +E   L NE SFYSVEL IGTP Q +T
Sbjct: 28  YVKMPFVKK-GNSESSV---------LSKRSSGHENFVLANEQSFYSVELAIGTPSQNLT 77

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VL+DTGS+DLWV G  N                                           
Sbjct: 78  VLLDTGSADLWVPGKGN------------------------------------------- 94

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTK-FSITYGDSTFASGTWGHDQLN 214
                    P     ++C  YG FD SKSSTF++NK+  F   YGD TFA G +G D+L 
Sbjct: 95  ---------PYCGSVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLK 145

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG 274
            NNL+++GL FAVANE+NST GVLGIGL  LE TYSG      ++SY Y+NFP+ LK+SG
Sbjct: 146 YNNLDLSGLPFAVANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSG 205

Query: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334
           AI ++AYSLF N  +   G+ILFGAVDH KY G LYTIP++N+ ++ GY+ P+ F VTLQ
Sbjct: 206 AIDATAYSLFLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQ 265

Query: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394
           G+ + T       TTLTTTK PALLDSGTT++YLP + V LLA  + ASYS   GYY   
Sbjct: 266 GLGLQTD---KRNTTLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYT 322

Query: 395 CIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQS-DPTVILGDNFLVS 453
           C     K  ++ FDFGGF I++ LS+F + T  S   C L   PQ+ + T ILGD+FL +
Sbjct: 323 CPSSDNK-TSIAFDFGGFRINAPLSDFTMQT--SVGTCALALIPQAGNATAILGDSFLRN 379

Query: 454 TYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            Y+VYDLDN EIS+A A +    E I+ I+S VP A +AP+Y+NTWSTY S+  GGNIF
Sbjct: 380 AYVVYDLDNYEISLAQAKYGKAKENIEAIKSTVPGATRAPSYNNTWSTYASVTSGGNIF 438

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  399 bits (1024), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/509 (45%), Positives = 324/509 (63%), Gaps = 40/509 (7%)

Query: 37  VIMNFEKKYGDSFENASNDRNAGAHLVRRED-DYELVKLTNENSFYSVELDIGTPPQKIT 95
           V ++F+K++G+++E +   +      V+R+D +YEL  L N  +FYSV+L++G+P QKIT
Sbjct: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYEL-SLRNRQNFYSVDLEVGSPSQKIT 91

Query: 96  VLVDTGSSDLWVTGSNNPYC-----STKGKDTSDFSFKQIHKDNPASVVESVITEI---- 146
           VL+DTGSSDLW+TGS+NPYC     S+K +D  D S   I  D  A    ++   +    
Sbjct: 92  VLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLTLTG 151

Query: 147 -----------SYDTTISVIEATATLDNTPLASQK------------INCGTYGTFDSSK 183
                      S D +   IE T T+      S              I+C  YGTFD ++
Sbjct: 152 GSMPSSFGSFGSIDVSTGGIEPTETISGGGGGSGGSPTGSSSSGGQSIDCSRYGTFDKNQ 211

Query: 184 SSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLP 243
           SST++SN T F I+YGD +FASG WG D + L +LN++ +S AVAN+TNSTVGVLGIGLP
Sbjct: 212 SSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLP 271

Query: 244 GLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHG 303
           GLE+TYS          + Y+NFPMVLK  G  K + YSL+ N  ++ +G+ILFGAVD  
Sbjct: 272 GLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKS 331

Query: 304 KYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGT 363
           K+ G LYTIPI+N+ ++ G   PIQF VTLQG+ ++      + TTL+TTKIPALLDSG+
Sbjct: 332 KFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN---QTSTTTLSTTKIPALLDSGS 388

Query: 364 TISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQL 423
           T++YLP  L+E++AD +GA +S    YY+M+C  +   +  +VF+FGGF+I + L+ +  
Sbjct: 389 TLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSK-HDETKIVFNFGGFNIETNLTTYT- 446

Query: 424 FTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIE 483
            T  SSD C+L   P  D + ILGD FLV  Y+VYDL++ EISMA A+F  N E I+V+ 
Sbjct: 447 -TPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVS 505

Query: 484 SAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           S++P A  A  YS+T+S+ +SI  GGNIF
Sbjct: 506 SSIPQATAAAGYSSTYSSSKSITSGGNIF 534

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  394 bits (1013), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/494 (46%), Positives = 317/494 (64%), Gaps = 24/494 (4%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V ++F+K  GD+ E+A+    A   L +R D  E V + N+ +FYSVEL +G+P Q +T
Sbjct: 34  FVKVSFDKLRGDTAEDATAGAVAHGVLAKRADGSETVVIKNQQTFYSVELGVGSPAQNVT 93

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPA--------SVVESVITEIS 147
           +L+DTGSSD+WV GSNNPYC       S       H D+          S + S +T  +
Sbjct: 94  LLIDTGSSDMWVMGSNNPYCEGGSSGNSKHVLLGDHVDSRDEEVNRDWFSTLRSFLTATA 153

Query: 148 YDTTISVIEATATLDN-------TPLASQ--KINCGTYGTFDSSKSSTFESNKTKFSITY 198
             T  +   AT + D+       T + SQ   + C +YGTF +  SS+F+SN T F I Y
Sbjct: 154 TATATATATATGSADSGGNAPSRTSVNSQYATLTCSSYGTFATDSSSSFQSNNTAFYIEY 213

Query: 199 GDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQ 258
           GDST+A GTWG D + L ++ ++G+S AVANE+NST GVLGIGL  LE T  G +L++  
Sbjct: 214 GDSTYALGTWGRDNVTLQDITLSGISMAVANESNSTFGVLGIGLAALEVTNVG-TLATRG 272

Query: 259 KSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINIL 318
            SYTY N P  + + G I  +AYSLF +  +++ G++LFGAVDH KYTG LYT+P+ N  
Sbjct: 273 NSYTYENLPAKMVSEGIIHKNAYSLFLDSLDAKEGSVLFGAVDHSKYTGSLYTLPLSNSY 332

Query: 319 QNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLAD 378
           ++ GY DPIQ  VTLQG  +      +  +T TTT + ALLDSGTT++YLP  LV  +A 
Sbjct: 333 KSMGYSDPIQLEVTLQGFGMTA---NNTNSTFTTTPLTALLDSGTTLTYLPTTLVRQVAA 389

Query: 379 KVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAP 438
           K GA Y S YGYY+++C  +VK    +VFDFGGFHI+S + NF +   ++S++C LG  P
Sbjct: 390 KYGARYDSSYGYYLLSC-SDVKDTDELVFDFGGFHINSKVENFLI--RATSNICALGLIP 446

Query: 439 QSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNT 498
           QS  ++ILGDNFL + Y+VYDLDN+EIS+A A++      I+VI S+VPSA+K P+YS+T
Sbjct: 447 QSSSSLILGDNFLTAAYVVYDLDNLEISLAQANYDGGSSNIEVISSSVPSAVKGPSYSST 506

Query: 499 WSTYESIVPGGNIF 512
           WST   I  GGNIF
Sbjct: 507 WSTSVPISTGGNIF 520

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  387 bits (994), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/476 (43%), Positives = 302/476 (63%), Gaps = 27/476 (5%)

Query: 37  VIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITV 96
           V  +F K  G +F        A   L +R+ D     L NE +FYS++L +GTP Q++ V
Sbjct: 38  VKFSFNKHQGRTF-------TASEELSKRDKDVTF-DLKNEQNFYSIKLSVGTPGQEVVV 89

Query: 97  LVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIE 156
           L+DTGSSDLW+ GS+NPYC    K++S FS     K+N A        E  + T    + 
Sbjct: 90  LLDTGSSDLWIPGSDNPYC----KESSSFSISNQGKENGA--------EGPFQTLPGGVT 137

Query: 157 ATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLN 216
           AT  +     AS  ++C  +GTF+   S TF SN T+FS++YGD+++A GTWG+D +N+N
Sbjct: 138 AT-NMSGGSTASATLDCKEFGTFNREDSKTFHSNDTEFSVSYGDTSYAIGTWGYDSININ 196

Query: 217 NLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAI 276
           ++N+T +S  VAN+TNS+VG++GIGL  LE+TY+GV     + ++ Y NFPM+LK  G I
Sbjct: 197 DVNLTNVSIGVANKTNSSVGIMGIGLSNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFI 256

Query: 277 KSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGI 336
           + + YSLF N+  +  G+ILFGAVDH KY+G LYT+P++N+ Q  G KDP+Q  VTLQG+
Sbjct: 257 EKNVYSLFLNRREAFEGSILFGAVDHSKYSGQLYTVPMLNLYQQQGLKDPLQLQVTLQGV 316

Query: 337 AVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCI 396
            +   +  +   T +TT +PALLDSGTT+ YLP K++ +LA+++ A +    GYYV +C 
Sbjct: 317 GI---EANNMTNTTSTTPVPALLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDCS 373

Query: 397 HEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYI 456
                +  + F+FGGF+I S +S + + + S+ + C+LG  P      ILGD F+   YI
Sbjct: 374 R--VDNTNLYFNFGGFNIVSNMSTY-VVSRSNENSCVLGLQPGGPEAAILGDMFMQHAYI 430

Query: 457 VYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           V+DLD+ EISMA A+++     ++ +   VPSA+KAP YS+T+S  + I  GGNIF
Sbjct: 431 VFDLDDFEISMAQANYAGGKNQLEAVTQQVPSAMKAPGYSHTFSGSQGITGGGNIF 486

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  386 bits (991), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 231/508 (45%), Positives = 305/508 (60%), Gaps = 45/508 (8%)

Query: 39  MNFEKKYGDSFENASND-----RNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQK 93
           ++  K YGDS  N  ++         A LV+RED +E++++ N+ +FYSV+L +GTPPQK
Sbjct: 32  LDINKFYGDSKFNLGSEIDEDISTPSARLVKREDGHEIIEIQNQQAFYSVDLMLGTPPQK 91

Query: 94  ITVLVDTGSSDLWVTGSNNPYC--STKGKDTSDFSFKQIHKDNPAS-VVESVITEISY-- 148
           +TVLVDTGSSDLWVTG+NNPYC   T  K  S          NP S VV + I +I    
Sbjct: 92  VTVLVDTGSSDLWVTGNNNPYCIDGTSSKAVSSNIEDDSQTKNPISKVVGTTINKIRKYF 151

Query: 149 -----------DTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSIT 197
                      D+      ++   D TP  +  I+C TYGTFD SKSSTF SN T F I 
Sbjct: 152 SHNLPDLSFLEDSGSGKYNSSQLKDVTPQDAH-IDCSTYGTFDPSKSSTFVSNDTNFMIR 210

Query: 198 YGDSTFASGTWGHDQLNL-NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSS 256
           YGD TFASGTWG D +   ++LN+T  SF VA+ TNST+ VLG+GLP LE TYSG+SL  
Sbjct: 211 YGDRTFASGTWGRDSIEFSDHLNLTDFSFGVADLTNSTISVLGMGLPRLEVTYSGLSLD- 269

Query: 257 VQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIIN 316
            +  YTY NFPM LK SG I    YSL+ NK+ +  G++LFGAVDH KY G L TIP+I+
Sbjct: 270 -RSPYTYANFPMALKQSGLIDRMVYSLYLNKAGASTGSVLFGAVDHSKYHGSLNTIPLIS 328

Query: 317 ILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELL 376
           +   +G   PI F+V LQG+ +++        T  +T +PALLDSGTT++YLP  LV  +
Sbjct: 329 L---SGSGIPIAFNVALQGLGMSSDS--QGTQTFLSTPLPALLDSGTTMTYLPDALVATV 383

Query: 377 ADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGF 436
           A  +GAS+    G Y+++C      D    FDFGGF IS  LSNF L  ++  DVC+L  
Sbjct: 384 ASTLGASFDEAQGLYLLDC-PSGSDDREFNFDFGGFQISVPLSNFIL--EALPDVCVLTL 440

Query: 437 APQSDPTVILGDNFLVSTYIVYDLDNMEISMANADF------------SDNDEYIDVIES 484
                   ILGD+FL   Y+VYDL+N+EISMA A +            +DN   ++V+ S
Sbjct: 441 FESHAERAILGDSFLTEAYVVYDLENLEISMAQARYDDDNDSDIEKYNADNKVLLEVVTS 500

Query: 485 AVPSALKAPNYSNTWSTYESIVPGGNIF 512
            +PSA +AP YS+T     +I P GN++
Sbjct: 501 NIPSANQAPGYSSTLINRSTIQPSGNMY 528

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  383 bits (983), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 232/497 (46%), Positives = 307/497 (61%), Gaps = 32/497 (6%)

Query: 37  VIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITV 96
           V ++F K +G ++E +S +R +     R   ++  + + N+ +FYSV+L +GTP Q ITV
Sbjct: 30  VKLSFNKWHGPTYEESSLERRS--LETRNNKEFNFI-VENQQNFYSVDLLVGTPGQNITV 86

Query: 97  LVDTGSSDLWVTGSNNPYC-STKGKDTSDFSFKQIHKDNPASVVESVIT-------EISY 148
           L+DTGSSDLW+T  NNPYC S  G +     ++    DN + V  S++T        I  
Sbjct: 87  LLDTGSSDLWLTAKNNPYCKSNAGSNDKKEDYRLEDGDNQSIV--SMLTASGTGTNPIGG 144

Query: 149 DTTISVIEATATLDNT--------PLASQK---INCGTYGTFDSSKSSTFESNKTKFSIT 197
               + I  +A L  T        P  S     ++C  YGTFD +KS +F SNKT+F I+
Sbjct: 145 SGIPTAISGSAQLTGTYTSGTGTGPSGSSPEPTMDCSQYGTFDVNKSKSFRSNKTEFYIS 204

Query: 198 YGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSV 257
           YGD +FASG WG D +N  N+N+ G+SFAVANETNSTVGV GIGLP  E+TY+     + 
Sbjct: 205 YGDGSFASGYWGTDSVNFANMNLEGVSFAVANETNSTVGVFGIGLPENEATYTPDPSLND 264

Query: 258 QKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINI 317
              Y Y NFP VLK+ GAI  +AYSLF N  ++  G ILFGAVD  KY GDLYT+P++N 
Sbjct: 265 FHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDASSGDILFGAVDRSKYKGDLYTLPLLNS 324

Query: 318 LQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLA 377
                YK+P++F VTLQG+    G    + TT TTTKIPALLDSGT++ YLP  L + +A
Sbjct: 325 -DPTKYKNPMEFDVTLQGVGFTNG---SSKTTFTTTKIPALLDSGTSLIYLPDALAKGIA 380

Query: 378 DKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFT--DSSSDVCILG 435
            K+G SY+ + GYYV+ C  E   D  +VFDFGGF I + LSN+ L +  D     C+LG
Sbjct: 381 HKLGGSYNEDIGYYVIGCPSE-NDDSQLVFDFGGFTIKNNLSNYLLGSPDDGDDSQCVLG 439

Query: 436 FAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNY 495
             P SD   ILGD FL   Y+VYDLD+ E+S+A A F ++ E I +I  ++P A +AP Y
Sbjct: 440 ILP-SDVQAILGDVFLADAYVVYDLDDYEVSLAQASFDNSKEDIQIISDSIPGAKRAPGY 498

Query: 496 SNTWSTYESIVPGGNIF 512
           S TWST  SI  GGNIF
Sbjct: 499 SKTWSTPASIKSGGNIF 515

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  385 bits (988), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 201/360 (55%), Positives = 256/360 (71%), Gaps = 12/360 (3%)

Query: 158 TATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNN 217
           TAT D  P + + ++C  YGTF+SS+SSTF++N T FSI+YGDSTFASGTW  D LNL++
Sbjct: 230 TATND-IPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSD 288

Query: 218 LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIK 277
           LNVTGLSFAVAN TNSTVGVLGIGLP LESTYSG S ++ ++ Y Y NFPMVLK SGAI 
Sbjct: 289 LNVTGLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIH 348

Query: 278 SSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIA 337
           ++ YSLF +  +  HG++LFGA+DH KYTG LYT+P+INI++N+GY +PIQF VTL GI 
Sbjct: 349 TTTYSLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIG 408

Query: 338 VATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIH 397
           +  G   +   TLTTTK+ ALLDSGTTISY P  +VEL+A ++ A YS+  G+Y + C  
Sbjct: 409 LQNG---ERNLTLTTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPC-R 464

Query: 398 EVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIV 457
            V  +  +VFDFGGFHIS  L +F     +S   CIL  APQ    VILGD FL   Y+V
Sbjct: 465 SVSSNTNLVFDFGGFHISGPLQDF--LIQTSQQTCILAMAPQESQHVILGDIFLTHAYVV 522

Query: 458 YDLDNMEISMANADFSDNDEY----IDVI-ESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           YDLDN  I++A AD S +++     I++I  S +P A++AP YS TW+    +  GGNIF
Sbjct: 523 YDLDNYVIALAQADTSTSNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (75%), Gaps = 4/86 (4%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDD----YELVKLTNENSFYSVELDIGTPP 91
           YV + FEK  GDSFE+A+ +      L++R+++    YE VK+TN+ SFYSVEL IGTPP
Sbjct: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116

Query: 92  QKITVLVDTGSSDLWVTGSNNPYCST 117
           Q +TVLVDTGS+DLWVTGS NP+C +
Sbjct: 117 QHVTVLVDTGSADLWVTGSMNPFCQS 142

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  380 bits (977), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/483 (46%), Positives = 296/483 (61%), Gaps = 29/483 (6%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDD------YELVKLTNENSFYSVELDIGT 89
           ++ + F++ YG+S+E+++  ++   HL +R  D      YE V LTN+ +FYSVELDIGT
Sbjct: 46  FLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSYEDVILTNQLTFYSVELDIGT 105

Query: 90  PPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSD-----FSFKQI-------HKDNPAS 137
           P QK+TV+VDTGSSDLW+T ++NP+CST   DT D     F  K         HK    +
Sbjct: 106 PAQKVTVVVDTGSSDLWITETSNPFCSTGDDDTEDSVWSPFLLKDKIDPRVLKHKGKRTT 165

Query: 138 VVESVITEISYDTTISV-IEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSI 196
            ++   T  +    IS+ + +  TL    L    INC  +GTF++ KSSTF++N T F I
Sbjct: 166 SIDVTATATTGSINISIDLGSNFTLPPEFL----INCTEFGTFNTKKSSTFKNNHTDFFI 221

Query: 197 TYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSS 256
           +YGD+TFASG WG D L+  ++NVTGLSF VAN TNSTVGVLGIGLP LESTY G   S 
Sbjct: 222 SYGDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPELESTYFGTVNSV 281

Query: 257 VQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIIN 316
            + SY YNNFP VLKNSG I  +AYSLF NKS+S  G++L GAVD  K+   LYT+P++N
Sbjct: 282 NESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKFADKLYTVPMLN 341

Query: 317 ILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELL 376
           I  + GY DP  F V +Q +   T         + +++IP LLDSGTT+ YLP  +VE +
Sbjct: 342 INPSKGYTDPSAFLVLMQKM---TRYKYGQGHLVPSSRIPVLLDSGTTMVYLPRSIVEQI 398

Query: 377 ADKVGASYSSEYGYYVMNCIHEVKKDIT-VVFDFGGFHISSWLSNFQLFTDSSSDVCILG 435
                A Y  E   Y + C    KK+ T   FDFGGF I + LS+F + TD+    CI G
Sbjct: 399 MRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVPTDNGQ--CIFG 456

Query: 436 FAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNY 495
             PQ     ILGD+FL   Y+VYDL++ EISMA A +   +     I S VPSA++A  Y
Sbjct: 457 MIPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVYDGGEPNYIPIVSTVPSAVRAKYY 516

Query: 496 SNT 498
           S T
Sbjct: 517 SAT 519

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  385 bits (989), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 278/464 (59%), Gaps = 60/464 (12%)

Query: 52  ASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSN 111
           A      G+ L +R    E   L+NE SFYSVEL +GTP Q +TVL+DTGS+DLWV  + 
Sbjct: 35  AKRQNGPGSELGKRAGGDENFVLSNEQSFYSVELALGTPSQNVTVLLDTGSADLWVPSNA 94

Query: 112 NPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKI 171
           N                                                    P     +
Sbjct: 95  N----------------------------------------------------PYCGSAM 102

Query: 172 NCGTYGTFDSSKSSTFESNKTK-FSITYGDSTFASGTWGHDQLNLNN-LNVTGLSFAVAN 229
           NC  YG FD + SSTF +N +  F  +YGD TFA G +G D+L+ +  L+++GLSFAVAN
Sbjct: 103 NCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSGLSFAVAN 162

Query: 230 ETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSN 289
           ++NSTVGVLGIGLP LE TYSG    + ++SY Y+NFP+ LK SGAI ++AYSLF N   
Sbjct: 163 KSNSTVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDATAYSLFLNDET 222

Query: 290 SEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATT 349
              G++LFGAVDH KY G LYTIP++N+ +  GY+ P+ F VTLQG+ + T     + TT
Sbjct: 223 QTSGSVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQT---RAHNTT 279

Query: 350 LTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDF 409
           LTTT+IPALLDSGTT++YLP   V L+A  + A++S E GYY   C        +VVFD 
Sbjct: 280 LTTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNATSVVFDL 339

Query: 410 GGFHISSWLSNFQLFTDSSSDVCILGFAPQS-DPTVILGDNFLVSTYIVYDLDNMEISMA 468
           GGFHI++ LS+F + T+  +  C+L   PQ+ + T ILGD+FL S Y+VYDLDN E+S+A
Sbjct: 340 GGFHINAPLSDFTMQTNVGT--CVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLA 397

Query: 469 NADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            A +    E I+ I S+VP A +AP Y++TW  Y S+  GGNIF
Sbjct: 398 QAKYGSGKEDIEAIRSSVPGATRAPGYNSTWVNYASVTSGGNIF 441

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  381 bits (979), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/506 (44%), Positives = 306/506 (60%), Gaps = 35/506 (6%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V ++F+K  GD  ENA   +      V+R+D     ++ N+++FYSV + +G+P Q +T
Sbjct: 34  FVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVT 93

Query: 96  VLVDTGSSDLWVTGSNNPYCS-TKGK-------DTSDFSFKQIHKDNPASVVE------- 140
           +L+DTGSSD+WV GSNNPYC  + GK       + S F      KD  + ++        
Sbjct: 94  LLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGT 153

Query: 141 --------SVITEISYDTTISVIEATATLDNTPLASQK--INCGTYGTFDSSKSSTFESN 190
                   +  T+++ +TT    + T     T + S +  I+C  YGTF +  SS+F+SN
Sbjct: 154 AEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSN 213

Query: 191 KTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYS 250
            T+F I YGD ++A G WG D + L ++ V+ +S AVAN +NST GVLGIGLPGLE T  
Sbjct: 214 GTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT-- 271

Query: 251 GVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLY 310
                S   +YTY NFP +L + G I+ SAYSLF N  N+ HG++LFGAVDH KYTG L 
Sbjct: 272 NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQ 331

Query: 311 TIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPV 370
           TIP++N +++     PIQF VTL G+ +      D  TT+TTT  PALLDSGTT ++LP 
Sbjct: 332 TIPLVNSIKSAQVPKPIQFDVTLHGLGITL---NDTNTTITTTPFPALLDSGTTFTHLPG 388

Query: 371 KLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFT----D 426
            LV  +A K+ A Y  E G+Y   C  E+     +VFDFGGFHI S L NF L T    D
Sbjct: 389 YLVSAIAKKLNAEYGDEDGFYRYQC-DEISDSDELVFDFGGFHIKSKLDNFALATYDDDD 447

Query: 427 SSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAV 486
           + +DVC L   P +   +ILGDNFL + Y+VYDL+N+EISMA A+     E I+ I S V
Sbjct: 448 NETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTV 507

Query: 487 PSALKAPNYSNTWSTYESIVPGGNIF 512
           PSA+KAP YS+TW++   I  GGNIF
Sbjct: 508 PSAVKAPGYSSTWTSAIPISTGGNIF 533

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  373 bits (958), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 197/476 (41%), Positives = 278/476 (58%), Gaps = 53/476 (11%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V M+F+KK G SF  A + R A   L +R +D+  +++ N+  FYSV L IGTPPQ++ 
Sbjct: 30  FVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVDIEIDNQQMFYSVNLSIGTPPQEVR 88

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VL+DTGSSDLWV G+                                             
Sbjct: 89  VLMDTGSSDLWVVGAG-------------------------------------------- 104

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                 +N P  +Q +NC  +G+FD+S+SST++ N T+F I YGDST+A GTWG D+L+L
Sbjct: 105 -VRCGPNNYPNPNQ-LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDL 162

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGA 275
              NV GL+FAVA+ +NS+V VLGIGLP +E+T     +SS Q  Y Y+N PMVLK +  
Sbjct: 163 GQANVDGLTFAVAHASNSSVAVLGIGLPAMETT-----MSSQQFGYQYDNLPMVLKRNNV 217

Query: 276 IKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG 335
           IK + YS+F N+ N++ G++LFGAVDH KY G L T+P++N         P++ HVTL  
Sbjct: 218 IKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAA 277

Query: 336 IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
           I + TG   D   TL  +K+PALLDSGTT++Y P++L + LA   GA + SE   Y+++C
Sbjct: 278 IGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDC 337

Query: 396 IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTY 455
                     ++DFGGF I S LS++ + T+     C  G  P S   VILGD FL   Y
Sbjct: 338 NSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRG-TCRFGIMPHSSDYVILGDVFLTRAY 396

Query: 456 IVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNI 511
           +V+DL+ +E+SMA A++    E I+VI  AVP A++AP Y++ W  Y  +V  G +
Sbjct: 397 VVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  372 bits (955), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 203/479 (42%), Positives = 290/479 (60%), Gaps = 57/479 (11%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV  + +K  G+ F ++         L +R+D+Y  VK+ NE +FYSV L IGTP Q++T
Sbjct: 31  YVRFDLDKTRGNDFRSSEKGVMPFGELKKRDDEYVDVKIHNEQTFYSVNLSIGTPAQEVT 90

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VLVDTGSSDLW+ G++   C   G D SD                               
Sbjct: 91  VLVDTGSSDLWIIGADVD-C---GPDNSD------------------------------- 115

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                      +++ ++C  YG FD SKSS++++N T+F I+YGD++FASG WG D+L+L
Sbjct: 116 -----------STEPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDL 164

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGA 275
            +LN  GL+FAVA  +NS+V VLGIGL G+E     V+ +S    Y Y+N P+VLK +G 
Sbjct: 165 GDLNADGLTFAVATASNSSVAVLGIGLTGIE-----VTRASGDNGYEYDNLPIVLKRNGV 219

Query: 276 IKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG 335
           I  +AYSL+ N  ++  G++LFGAVDH KYTG L T+P++N+    G+  PI+ H+TL G
Sbjct: 220 IDKTAYSLYLNDLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNG 279

Query: 336 IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
           +  ++G       T++ TK+PALLDSGTT+SY P +L   +A  VGA +++    +++ C
Sbjct: 280 LGFSSG---KKRGTISATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPC 336

Query: 396 IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTY 455
               + +I ++++FGG  I+S L N+ L   +  DVC+LG  P S   +ILGD FL S Y
Sbjct: 337 SQAKRNNIDLIYNFGGVEITSPLVNY-LSETNVEDVCLLGIVPTSSNDIILGDVFLTSVY 395

Query: 456 IVYDLDNMEISMANADF--SDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            VYDL+ +E+S+A A +  S   E I+VI+S VP A KAP YSNTWSTY  I  GGN+F
Sbjct: 396 TVYDLEALEVSIAQAAYGASAEKENIEVIKSTVPGATKAPGYSNTWSTYAPISTGGNMF 454

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  374 bits (960), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/345 (57%), Positives = 259/345 (75%), Gaps = 10/345 (2%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNN-LNVTGLSFAVAN 229
           INC  YGTFD   SST++SN+T F+I Y D++FASG WG D L  ++ LNVTGLSFAVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 230 ETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSN 289
           +TNSTVGVLGIGLP LE TY+GV  ++  K YTY+NFP+VLKNSGAI  SAYSL+ NK +
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAGVYQTT--KPYTYDNFPLVLKNSGAIHKSAYSLYLNKQS 399

Query: 290 SEHGTILFGAVDHGKYTGD-LYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNAT 348
           +++G +LFGA+DH +Y GD LYTIP++N   ++GY  PI+F VTLQG+ V+  D  +   
Sbjct: 400 AKNGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVS--DNRNGNF 457

Query: 349 TLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFD 408
           T+TTT+I ALLDSGTT++Y P  ++ LLA ++ ASYS   GYYVMNC  + + +  +VFD
Sbjct: 458 TVTTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNC-PDSRDNTQLVFD 516

Query: 409 FGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMA 468
           FGGFHI + L+NF L   S+S  C+LG  P +  + ILGD FL   Y+VY+LD++EISMA
Sbjct: 517 FGGFHIKTNLTNFVL--SSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMA 574

Query: 469 NADFSD-NDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            A+F++ NDE I+VI S +P+A+KAP YS T+S  +SIVPGG+IF
Sbjct: 575 QANFNNGNDEDIEVISSTIPNAVKAPGYSYTYSVSKSIVPGGDIF 619

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 42/67 (62%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query: 62  LVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCS-TKGK 120
           L++R D YE +++ N+ SFYSV L IGTP Q ITVLVDTGSSDLWVTGSNNPYC    GK
Sbjct: 81  LIKRHDGYEKIQIINQQSFYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNPYCKGNSGK 140

Query: 121 DTSDFSF 127
              +  F
Sbjct: 141 AMENIGF 147

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  362 bits (928), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 203/451 (45%), Positives = 271/451 (60%), Gaps = 46/451 (10%)

Query: 72  VKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIH 131
           V  TN   FYSVEL +GTP QK++VL+DTGSSDLWV G++N +C       S+ + K + 
Sbjct: 61  VNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHAVSDSNSTDKPLK 120

Query: 132 KDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNK 191
                                     + TL   P     I+C  YGTFD SKSS+F++N 
Sbjct: 121 --------------------------SPTL---PSPQPTIDCNQYGTFDYSKSSSFKAND 151

Query: 192 TKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSG 251
           +   I YGD ++A G +G D + +N+L++  +S  VA++ N T GVLGIGL GLE+T +G
Sbjct: 152 SSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSLGVAHQANVTQGVLGIGLAGLETTNTG 211

Query: 252 VSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYT 311
            S +   KSYTY NFP VLK+ G I ++AYSLF N   +  G ILFG VDH KYTG LYT
Sbjct: 212 FSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNSPGASQGGILFGGVDHSKYTGPLYT 271

Query: 312 IPIINILQNNGYKDPIQFHVTLQGIAVA----------TGDGMDNATTLTTTKIPALLDS 361
           +PIIN        +PIQF VTLQG+ ++            D   N  TLT +K P LLDS
Sbjct: 272 VPIINT---GAPGNPIQFQVTLQGVGISLDKSNGTNTNAADSTSNV-TLTASKFPVLLDS 327

Query: 362 GTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNF 421
           GTT+  LP  + + +A ++GA+Y+SE  YY + C  +   +  ++ DFGGF +++ ++N 
Sbjct: 328 GTTLMTLPRPVTDQMAKQLGATYNSETSYYQLKCPSQ-NDNTRLILDFGGFQVNAKITNH 386

Query: 422 QLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDV 481
              T S +  C+LG  P    +  LGD FLV  Y+VYDLDN EIS+A ADFSD+ + I+ 
Sbjct: 387 --ITRSQNGECLLGITPSDTDSGTLGDVFLVDAYVVYDLDNYEISLAQADFSDSAQSIEP 444

Query: 482 IESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           I S+VPSA KAP YSNTW+  ESI  GGNIF
Sbjct: 445 ISSSVPSATKAPGYSNTWTGSESIKTGGNIF 475

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  360 bits (925), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/344 (57%), Positives = 254/344 (73%), Gaps = 10/344 (2%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNN-LNVTGLSFAVAN 229
           INC TYGTFD   SSTF+SNKT F+I Y D+++A+G WG D L  ++ LNVTGLSFAVAN
Sbjct: 261 INCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVAN 320

Query: 230 ETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSN 289
           +TNSTVGVLGIGLP LE TYSGV  S+  K Y Y+NFP+VLKNSGAI  S YSL+ NK N
Sbjct: 321 QTNSTVGVLGIGLPQLEVTYSGVYQST--KPYIYDNFPLVLKNSGAIHKSVYSLYLNKQN 378

Query: 290 SEHGTILFGAVDHGKYTGD-LYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNAT 348
           +++G +LFGAVDH +Y GD LYT+P++N   ++GY  PI+F +TLQG+ V       N  
Sbjct: 379 AKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGVTD---NTNNY 435

Query: 349 TLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFD 408
           T+TTT+I ALLDSGTT++Y P  ++ LLA  + ASYS   GYYVMNC  +   +  +VFD
Sbjct: 436 TVTTTQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNC-PDSDDNTQIVFD 494

Query: 409 FGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMA 468
           FGGFHI++ L+NF L   S+S  C+LG  P +  + ILGD FL   Y+VY+LD++EISMA
Sbjct: 495 FGGFHINANLTNFVL--SSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMA 552

Query: 469 NADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            A++ +++E I+VI S VP+A+KAP YS T+ST +SIV GGNIF
Sbjct: 553 QANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596

 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 50/63 (79%), Gaps = 1/63 (1%)

Query: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYC-STKG 119
           +L++R D YE +++ N+ SFYSV L IGTP Q ITVLVDTGSSDLWVTGS+NPYC S  G
Sbjct: 87  NLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNSG 146

Query: 120 KDT 122
           K T
Sbjct: 147 KST 149

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  347 bits (889), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/462 (43%), Positives = 275/462 (59%), Gaps = 39/462 (8%)

Query: 39  MNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLV 98
           ++F K  G++FE A  + N  A+            + N+ +FYSVEL +GTP Q + VL+
Sbjct: 28  LSFNKLRGETFEKAVGNSNGHANF----------DIKNQQNFYSVELKVGTPAQNVLVLL 77

Query: 99  DTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEAT 158
           DTGSSDLW+TGS NPYCS                  P++    + +  S  +T +   +T
Sbjct: 78  DTGSSDLWITGSGNPYCS------------------PSTRNSHLGSAGSNSSTNNGPSST 119

Query: 159 ATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNL 218
           A   N P +S  I+C  YGTF+   S TF+SN + F +TYGD +FA G WG D + L+ L
Sbjct: 120 A---NFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKGLWGMDHVYLDGL 176

Query: 219 NVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKS 278
           NV+ +SFAVANE+NSTVGV G+GLPG E+T   V+       Y Y NFP VLK++G ++ 
Sbjct: 177 NVSDVSFAVANESNSTVGVFGVGLPGEEAT---VTPGVNGNHYQYKNFPQVLKDNGVVQK 233

Query: 279 SAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAV 338
           +AYSL+ N  +S  G ILFGAVDH KY+G+LYT+PI+N   + G   P +F VT+QGI V
Sbjct: 234 NAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGVA-PREFDVTVQGITV 292

Query: 339 ATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHE 398
                  + +T+++ K  ALLDSGTT+ YLP  L + LA  +G  +S   GYY++    E
Sbjct: 293 GN---SSSNSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSE 349

Query: 399 VKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVY 458
              D  + FDFGGFHI + LSN+ L      DV ILG         I GD FLV  Y+VY
Sbjct: 350 -NDDTKITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDRAIFGDVFLVDAYVVY 408

Query: 459 DLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWS 500
           DL++ EIS+A A+F+     I+ I  +VP A +AP YS T++
Sbjct: 409 DLEDYEISLAQANFNSGSSDIEAISGSVPGASRAPGYSQTYT 450

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  347 bits (889), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 213/480 (44%), Positives = 292/480 (60%), Gaps = 55/480 (11%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V + F K+YG S  ++S    A  +LV+R    + V+L NE+ FY+++++IGTP Q +T
Sbjct: 27  FVGVQFSKRYGKSISDSSL---AKGNLVKRSSGTDEVELINESVFYAIDMEIGTPKQSVT 83

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VLVDTGSSD WV  S NPYC +K                                     
Sbjct: 84  VLVDTGSSDFWVPSSTNPYCESK------------------------------------- 106

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
            AT+T+ ++ L    I+C TYGTF  S SS+F  N T F   Y D + A+G WGHD ++ 
Sbjct: 107 SATSTIASSDL----IDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSATGFWGHDVVDF 162

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKS-YTYNNFPMVLKNSG 274
               ++ +S AVA++T+S+ GVLGIGL GLESTYSG + +S     Y Y+NFP+ L    
Sbjct: 163 GGQELSDISIAVADQTDSSFGVLGIGLTGLESTYSGSAAASSSTGRYQYDNFPIRLVQEN 222

Query: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334
            I+++AYSL+ + +    GTILFG VDH KY+GDL TIP+IN L+ NGY  PI+  VTL 
Sbjct: 223 VIQANAYSLYLDPATGSSGTILFGGVDHNKYSGDLNTIPLINTLEANGYTSPIKLQVTLN 282

Query: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394
           G+ V+ G    + +T+TTT+IPALLDSGTT++YLP  + +LLA+++GA+YSS    YV++
Sbjct: 283 GLGVSDG---SSTSTVTTTQIPALLDSGTTLTYLPTAMFDLLAEQIGATYSSTSNGYVLS 339

Query: 395 CIHEVKKDITVVFDFGGFHISSWLSN--FQLFTDSSSDVCILGFAPQSDPTVILGDNFLV 452
           C + V +D  +V+DFGGF I + L+   +QL    S D C L     S     LGD FL 
Sbjct: 340 CAN-VDEDSMIVYDFGGFQIQTPLAGSLYQL----SDDQCELAIGSTSSSYATLGDLFLT 394

Query: 453 STYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
             Y+VYDLDN EISMA  +++   E I++I  +VP A KA  Y NTW+T ESI  GGNIF
Sbjct: 395 HAYVVYDLDNKEISMAQINYNATTEDIEIISDSVPGATKAAGYYNTWTTSESITAGGNIF 454

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  338 bits (868), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/480 (42%), Positives = 284/480 (59%), Gaps = 27/480 (5%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV M F K    SF +       G  L RR DDY  V + N+  +YSVEL +GTPPQ ++
Sbjct: 27  YVQMGFHKSR--SFSSG------GDSLARRADDYLSVDVENQQLYYSVELYVGTPPQNVS 78

Query: 96  VLVDTGSSDLWVTGSNNPYC-STKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISV 154
           VL+DTGSSDLW+T  +NPYC   K   ++ F+ ++    N A+V+ +   E    ++ + 
Sbjct: 79  VLIDTGSSDLWLTSPDNPYCIGFKQPGSAKFALEEKEAAN-ATVLTAQNAEGPTRSSKAA 137

Query: 155 IEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLN 214
                 LD       + +C   GTF++S+SS+F+SN T F   Y D+TFASG WG D + 
Sbjct: 138 KATGGHLD-------QFDCALLGTFNNSESSSFKSNNTDFLTGYADNTFASGFWGTDVVR 190

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSG 274
           + +++V+ +S AV N TNST  VLGIG+P LES+ +G   +    SY Y+NFP+ LKN G
Sbjct: 191 IGDVDVSDVSLAVVNLTNSTSPVLGIGMPVLESSNAGRLAAETNSSYEYDNFPVQLKNKG 250

Query: 275 AIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQ 334
            I+  AYSLF N S++  G++LFGAVDH KY   L+T+P++N  ++ G + PI+F+VT+ 
Sbjct: 251 VIEKIAYSLFLNDSDATEGSVLFGAVDHSKYENGLFTVPMVNTYKDQGVQHPIEFYVTMY 310

Query: 335 GIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMN 394
           G+     DG  N  T+TTT  P LLDSG+T SYLP  LV +LA  + A++S +   Y + 
Sbjct: 311 GLGFKK-DGFLN--TITTTNFPVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLK 367

Query: 395 CIHEVKKDITVV-FDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPT--VILGDNFL 451
           C  E  +D T + FD GGF I   LS+  L      + C+L    Q +     ILGD FL
Sbjct: 368 CPSE--EDATFLSFDLGGFLIDVPLSD--LVAKRHKNQCVLMVKGQGEGEGGYILGDTFL 423

Query: 452 VSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNI 511
            S Y+VYDL++ EIS+  A   D  E I+VI+S VP A++AP Y   W+    I   GNI
Sbjct: 424 SSAYVVYDLESYEISIGQASTGDAAEDIEVIKSTVPGAVRAPFYDRPWTGGTVISMSGNI 483

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  337 bits (864), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/463 (41%), Positives = 280/463 (60%), Gaps = 40/463 (8%)

Query: 63  VRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDT 122
           +++ D Y  V ++ E  +Y V+L +GTP Q +T+LVDT SSD+WVT  +NP C       
Sbjct: 56  LQKRDTYATVNISAE-FYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLCD------ 108

Query: 123 SDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPL------------ASQK 170
                  I  DN     + V+   + ++T+S  ++   LD  P+            A   
Sbjct: 109 -----GDIFYDNVEKTAKHVVVAAAEESTVSDGDSNGLLDGEPVSTTPFESSVIYPAEGL 163

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANE 230
           ++CG +GTF+ + SST+ +N T F ITY D++ A G WG D L++  L+++G+ FAVAN 
Sbjct: 164 VDCGFFGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANY 223

Query: 231 TNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNS 290
           TNS++GVLGIGLPG E+TY       +  SY Y+N PMVLK SG I S+AYSL     N+
Sbjct: 224 TNSSLGVLGIGLPGSETTY-------LTNSYMYDNLPMVLKKSGVIDSAAYSLLLAAYNN 276

Query: 291 EHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTL 350
               +LFGAVDH KY+G LYTIP+INI ++ GY+ P++F VT+ G+ +++    D+ TT+
Sbjct: 277 YTSGLLFGAVDHSKYSGSLYTIPMINIYESRGYESPVEFDVTIYGLGISS---TDSNTTI 333

Query: 351 TTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFG 410
            T K PALLDSG+T  + P  L+ L A+++ A+YS E G Y    I     +I+ VFDFG
Sbjct: 334 ATMKTPALLDSGSTAIFFPTTLLNLAAEQLNATYSEEKGLY---TIPYSPANISFVFDFG 390

Query: 411 GFHISSWLSNFQLFTDSSSDV-CILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMAN 469
           GFHI+  L   +L + S  +   IL     ++  ++LG+ FL   Y+V+D +N EISM  
Sbjct: 391 GFHIN--LPIRELCSVSYGEPEYILNIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQ 448

Query: 470 ADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           + +   +E I+ I S VP A+K  +YSN+WS++ SI  GG+IF
Sbjct: 449 SSYDYAEEDIEAIISTVPGAVKVASYSNSWSSFGSITSGGDIF 491

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  338 bits (867), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/470 (43%), Positives = 274/470 (58%), Gaps = 38/470 (8%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRRED---DYELVKLTNENSFYSVELDIGTPPQ 92
           YV  NF K  G SF  A      G  L RR+    D  L  L NE  FYSV+L+IGTPPQ
Sbjct: 28  YVSFNFGKSLGSSFHGARGGSRPG-KLHRRDSGSSDSALSVLKNEEVFYSVKLNIGTPPQ 86

Query: 93  KITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTI 152
            ITVL DTGSSDLWV+ ++NP+C   G +              A +  S    ++  TTI
Sbjct: 87  DITVLFDTGSSDLWVSSNSNPFCEADGVNRR------------ADLKSSSTYSVAPSTTI 134

Query: 153 SVIEATATLDNTPLASQKINCGTYGTFDSSKSSTF--ESNKTKFSITYGDSTFASGTWGH 210
              E   T+D          C  +GTF+ +KSSTF  + N T F I YGD TFA+G W  
Sbjct: 135 DGFEVAPTVD----------CAEFGTFNPNKSSTFRPQGNDT-FMIMYGDGTFANGLWAK 183

Query: 211 DQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVL 270
           D L+L+  +++ L FAVAN ++S VGVLG+GL GLES+         Q    Y NFP+VL
Sbjct: 184 DTLSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLESSADPFDDEPSQ----YPNFPVVL 239

Query: 271 KNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFH 330
           K +  I   AYSL+ N  ++E G++LFGAVDH KYTG LYTIP++N L      + ++F 
Sbjct: 240 KQNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEILEFD 299

Query: 331 VTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGY 390
           VT+QG+ + +        TLTT + PAL+DSGTT+ Y+   L + +AD +GA+ S +Y  
Sbjct: 300 VTVQGLGIESKKNCFQK-TLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYEL 358

Query: 391 YVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNF 450
           Y   C  +   D  +VFDFGGF I++ LSN+ L TD    VC LG  P    + ILGD F
Sbjct: 359 YTFECPAK-DDDTQLVFDFGGFQITNPLSNYVLETDDEK-VCGLGVVPSY--SNILGDEF 414

Query: 451 LVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWS 500
           L S Y+V+DL+N+E+S+  A+ +   E I+ I S VP A KAP YS+TW+
Sbjct: 415 LASAYVVFDLENLELSIGQANLNPGPEDIEPIISTVPGAQKAPGYSSTWT 464

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/491 (40%), Positives = 284/491 (57%), Gaps = 34/491 (6%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V + F+K  G +F  +++       L +R DDYE + L  +   Y VEL +GTP QK  
Sbjct: 28  HVSIPFKKAKGKTFSGSADSNKWRNRLSKRGDDYENLGLKTDKLAYYVELSLGTPGQKFE 87

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTT---- 151
           V +DTGSSDLWV  S+NPYC            +  H  N     E+   E ++D T    
Sbjct: 88  VQLDTGSSDLWVYDSHNPYCMPS---------ETTH--NEKVYGEAAYGETAFDQTALDQ 136

Query: 152 ISVIEATATLDN--------TPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTF 203
              + A+AT D+         P +   I+C ++GTF+ + SS+F +N T+F I+Y DST 
Sbjct: 137 FETLLASATEDDPSYTQTEAVPSSEATIDCASFGTFNYTLSSSFSANDTEFYISYLDSTA 196

Query: 204 ASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTY 263
           A G W  D L L +L ++ + FAVA   +    V G+G PG EST    + SSV++ Y Y
Sbjct: 197 AYGIWAQDVLKLGDLEISDMPFAVAVVGDVQTPVFGVGFPGTEST----AGSSVKEPYEY 252

Query: 264 NNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGY 323
            NFP++LK+ G +K   YSLF +  +S  G+ L GAVDH KY+G LYT+P+ +    +  
Sbjct: 253 ANFPVLLKSQGYVKKVVYSLFLDAQDSSSGSFLLGAVDHSKYSGGLYTLPMYSGTDGDDT 312

Query: 324 --KDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVG 381
               P +F +TLQG+ ++  D  +N T  TT  +   LDSG+T +  P +  EL+AD +G
Sbjct: 313 LSSTPSRFIITLQGLGIS--DKGENKTVATTRSL-VYLDSGSTGTVFPSEYAELIADSLG 369

Query: 382 ASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSD 441
           ASYS +Y  YVM C  +   D   V+DFGGF ISS LSN+   T   S VC+L       
Sbjct: 370 ASYSGDYEAYVMKCPSK-DDDTNFVYDFGGFTISSPLSNYMEATGDDS-VCVLDIDTDDI 427

Query: 442 PTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWST 501
           P ++LGD FLVS Y+VYDL++ EIS+A A++    E I+V+  ++PSA+KAP YS+TWST
Sbjct: 428 PYIVLGDAFLVSAYVVYDLEDYEISIAQANYDGGSENIEVVSDSIPSAVKAPFYSSTWST 487

Query: 502 YESIVPGGNIF 512
           Y +   GGNIF
Sbjct: 488 YVTATSGGNIF 498

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  338 bits (868), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 201/473 (42%), Positives = 281/473 (59%), Gaps = 31/473 (6%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELV--KLTNENSFYSVELDIGTPPQK 93
           YV ++F K  G S+++A           R     E +  +L N N FYSV LDIGTPPQ+
Sbjct: 35  YVAIDFAKAKGISYQDARVGARPAKLQKRALSQGETLNSELVNNNVFYSVGLDIGTPPQQ 94

Query: 94  ITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTIS 153
           +TVL DTGSSDLWV+ ++NPYCS      S  +++   K + A             TTIS
Sbjct: 95  VTVLFDTGSSDLWVSSNDNPYCSNGDSTESYANYRADLKSSSALTAAPT-------TTIS 147

Query: 154 VIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTK-FSITYGDSTFASGTWGHDQ 212
            I    T+D          C  YGTF++ +S++  +N +K F ++Y D ++A G W  D+
Sbjct: 148 GITIAPTID----------CAQYGTFNADRSTSLFANYSKPFFVSYNDDSYALGYWARDK 197

Query: 213 LNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLEST--YSGVSLSSVQKSYTYNNFPMVL 270
           L ++  +++ L FAVA  +NSTVGVLG+GL GLEST  Y   ++SS+     Y NFPMVL
Sbjct: 198 LVVDGDDISSLEFAVAEISNSTVGVLGVGLQGLESTVHYRSPNISSI-----YPNFPMVL 252

Query: 271 KNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFH 330
           K +GAI   AYSL+ N  ++  G++LFG VDH KYTG LYT+P++N  ++ G K P+QF 
Sbjct: 253 KENGAIDKIAYSLYLNSLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTYKDYGVKTPVQFD 312

Query: 331 VTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGY 390
           VT+QGI + +        T TTTKI AL+DSGTT+ Y   ++V  +A  V AS+S  YG 
Sbjct: 313 VTVQGIGIESEKACRQE-TFTTTKIAALMDSGTTLMYTAPEIVNKIALYVNASFSPGYGL 371

Query: 391 YVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNF 450
           ++  C  +   D   +FDFGGF I S LSN+ L TD   ++C LG    S+   I GD F
Sbjct: 372 FMFRCPSD-GDDTQFIFDFGGFQIKSPLSNYILRTD-DENICGLGLI-SSNQGTIFGDEF 428

Query: 451 LVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYE 503
           L S Y+VYDL+N+E+S+A A+++     I+ I S +P A +A  Y NTW + E
Sbjct: 429 LASAYVVYDLENLELSLAQANWNPGSPEIEKIVSEIPRAQRASQYWNTWVSDE 481

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/517 (38%), Positives = 280/517 (54%), Gaps = 57/517 (11%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRR-EDDYELVKLTNENSFYSVELDIGTPPQKI 94
           Y+ ++FEK   D  E      +A   L +R  DD     L  + ++YS+ L++GTPPQ +
Sbjct: 21  YLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAFPLVAQENYYSINLEVGTPPQNV 80

Query: 95  TVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDN-------------------- 134
           ++L+DTGSSD+WV GSNN YC  K  D    +   +  +                     
Sbjct: 81  SLLLDTGSSDMWVIGSNNGYC--KNSDNKSRNLDALGSNRFAKRASSVASASPSSATDSD 138

Query: 135 -PASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTK 193
                 +S   E  Y T  S I         P A++ ++C +   FD  KSS+F+SN T 
Sbjct: 139 GGDDGDDSGDAEQFYPTAASEI---------PAAAKTLDCQSLSLFDLEKSSSFKSNSTP 189

Query: 194 FSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVS 253
           F  +YGD+++ASG WG D + L NL++  + FAVAN +NS+ GVLG+GLP LES    +S
Sbjct: 190 FFTSYGDNSYASGLWGTDDVRLGNLSIADVFFAVANFSNSSTGVLGVGLPALESYNPALS 249

Query: 254 -----------------LSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTIL 296
                            + ++ K  TY NFP +LK    I+  AYSLF N +N+ +G IL
Sbjct: 250 DNFNVSDYLPVNASDADIDNISKP-TYANFPQILKQKNVIEKVAYSLFLNDTNATNGQIL 308

Query: 297 FGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIP 356
           FGAVDH KYTG L T+P++N L   G  D  Q  +TL G+ +    G     T+   K+P
Sbjct: 309 FGAVDHSKYTGSLSTLPLVNSLYVEGINDTTQLEITLDGMGLKNSQGQ---FTIYNQKMP 365

Query: 357 ALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISS 416
           ALLDSGTT+SYLP+ L  L+A ++      + G+  +        +  +VF+FGG  IS 
Sbjct: 366 ALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTGFIELKNCPAKNDNTQLVFNFGGAFISI 425

Query: 417 WLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDND 476
             + F     S  D C + F PQ +P ++LGDNFL + YIVYDL++MEIS+A A+F+   
Sbjct: 426 KYTEF--IEKSDDDNCYVTFMPQGEPGILLGDNFLRNAYIVYDLEDMEISIAQANFNGGA 483

Query: 477 EYIDVIESAVPSALKAPNYSNTWSTY-ESIVPGGNIF 512
           E I+ I   VPSA+KAP YS +++ +  S    GNIF
Sbjct: 484 ENIEAIVKNVPSAVKAPGYSASFTEFPSSYATTGNIF 520

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  319 bits (818), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/457 (42%), Positives = 260/457 (56%), Gaps = 68/457 (14%)

Query: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK 120
            LVRRED  + V L  +  FYS++L IGTP QK+TVL+DTGSSDLWVTG+NNPYC T   
Sbjct: 32  QLVRREDG-DSVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGANNPYCQTS-- 88

Query: 121 DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD 180
                                                        L+S+   C  YGTFD
Sbjct: 89  ---------------------------------------------LSSE---CKEYGTFD 100

Query: 181 SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNN--LNVTGLSFAVANETNSTVGVL 238
             +SSTF+   +   I Y D T   G WG D L LNN  + +      VA+ ++S  GV+
Sbjct: 101 YGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVADSSDSVAGVI 160

Query: 239 GIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFG 298
           G+G PGLE+T +   + +  +SYTY NFPM LK  G   ++ +++  +  NS  G ILFG
Sbjct: 161 GLGFPGLETTNN---VQANGESYTYANFPMQLKQQGVTDATVFAIALD--NSYGGDILFG 215

Query: 299 AVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPAL 358
           AVD GKY G LYT+P++N   + G   PI+  VTLQGI V + DG D  T  ++T + AL
Sbjct: 216 AVDEGKYIGGLYTLPVVN---SRGTATPIRMEVTLQGIGVDS-DGGDQET-FSSTPMLAL 270

Query: 359 LDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWL 418
           +DSG+T+ YLP  +   + +KVGA Y      Y ++C   V+ D  ++FDFGGFHIS+ +
Sbjct: 271 VDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVEND-NLIFDFGGFHISTPV 329

Query: 419 SNFQLFTD--SSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDND 476
           SN+ + TD  SS+  C+ G   QS  TV+LGD FL S Y+V+DLD+ EISMA  + ++ D
Sbjct: 330 SNY-IITDQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHYEISMAQGNSNNGD 388

Query: 477 EYI-DVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
             + DV    +P+A KAP YS TWST   +  GGNIF
Sbjct: 389 GNVKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIF 425

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  306 bits (784), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/452 (40%), Positives = 252/452 (55%), Gaps = 54/452 (11%)

Query: 55  DRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPY 114
           D + G  L +R  +   + L NE  FY+ +L++GTPPQ +TVL+DTGSSDLWVTGS+NPY
Sbjct: 34  DVSYGNSLWKRNQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPY 93

Query: 115 CSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCG 174
           C                      +     TE S + T SV++                C 
Sbjct: 94  C----------------------LSNETTTEPSKNITKSVVD----------------CS 115

Query: 175 TYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNST 234
            YGTF+   S TF  + ++F I Y D+TFA+G W  D ++  +  +  + FAVANETNST
Sbjct: 116 RYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNFIADMQFAVANETNST 175

Query: 235 VGVLGIGLPGLEST--YSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEH 292
           VGVLGIG   LES   Y G        +Y Y NFP+ LKN+G I  +AYSL+ N  +S  
Sbjct: 176 VGVLGIGFERLESVKGYEGAP-----NTY-YQNFPLALKNNGVIDKTAYSLYLNSLDSSS 229

Query: 293 GTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTT 352
           G+ILFG +D  KYTGDLYT P++NI   +    P +FHVT+QGI V +       + L +
Sbjct: 230 GSILFGGIDSNKYTGDLYTFPLVNI-HPSVVNKPAKFHVTVQGIGVQSSGS--EQSILMS 286

Query: 353 TKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGF 412
           TK PALLDSGTT+   P +  + +A+ V A+Y+   G Y M C  E   D   +FDFG  
Sbjct: 287 TKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPE-NDDTEFLFDFGDL 345

Query: 413 HISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADF 472
            I   L NF +     ++ C  G  P  D T+ILGD FL + Y+VYDL++ E+S+A A++
Sbjct: 346 KIKVPLKNF-ILAPEDNEYCGFGVLPTVD-TMILGDMFLSAAYVVYDLESYEVSLAQANW 403

Query: 473 SDNDEYIDVIESAVPSALKAPNYSNTWSTYES 504
           + ++  I  I   VP A KA   + TWS YE+
Sbjct: 404 NSDESEIQAIRHTVPGATKAT--AATWSPYET 433

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  315 bits (807), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 193/482 (40%), Positives = 260/482 (53%), Gaps = 71/482 (14%)

Query: 38  IMNFEKKYGDSFENAS-NDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITV 96
           ++ F K Y DS E    N   +   LV+R  D E + LTN N+FYS E+++GTP Q + V
Sbjct: 31  VIPFRKYYADSLEELDYNTSTSETKLVKR--DGEDIVLTNRNTFYSAEIEVGTPAQTMNV 88

Query: 97  LVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIE 156
           +VDTGSSDLWV G +N  C                                         
Sbjct: 89  IVDTGSSDLWVIGHDNLTC----------------------------------------- 107

Query: 157 ATATLDNTPLASQ-KINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                   PLAS    NC  +G+F  SKSSTF  N T+F+ITY       G WG D L +
Sbjct: 108 --------PLASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLII 159

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGA 275
             +N TGLSF V + T S+ G+LGIGLP  E+T  G         Y Y+NFPMVLKN G 
Sbjct: 160 GGVNATGLSFGVVHTTTSSAGILGIGLPDTETTAVG-----QYGHYKYDNFPMVLKNKGI 214

Query: 276 IKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG 335
           I    YS++ + S+S +G  L G VD  KYTG LY +P++N   N  +  P  FHVTLQG
Sbjct: 215 ISHQGYSIYLDSSSSTYGEFLLGGVDTSKYTGTLYKLPLVN-WYNTYFSSPGDFHVTLQG 273

Query: 336 IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
           + + T  G  +A TLT TK+  +LD+G+T++ +P  L   L   +G  YSS +G YV  C
Sbjct: 274 LGLITNSG--SAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTC 331

Query: 396 IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTY 455
             E  K   +VF+FGG +    +S+F        +VC L  + +SD   ILGD+FL + Y
Sbjct: 332 PTETSK---LVFNFGGINYKLPMSSF--INTLGDNVCSLKVSSRSDSNFILGDDFLRNVY 386

Query: 456 IVYDLDNMEISMANADF--SDNDEYIDVI---ESAVPSALKAPNYSNTWSTYESIVPGGN 510
             +DL+N EI +A ADF  S N++  D +   ES +P A++AP YS TW TYE++V GG+
Sbjct: 387 AAFDLENKEIGLAMADFDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGS 446

Query: 511 IF 512
           +F
Sbjct: 447 MF 448

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  300 bits (768), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 179/485 (36%), Positives = 277/485 (57%), Gaps = 47/485 (9%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           Y+ ++FEK              A + LV+R+D+Y  V L N+   Y V+L +GTPPQ IT
Sbjct: 16  YLKLDFEKS-----------PKASSDLVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNIT 64

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           V +DTGSSDLW   ++NP+C            K+  K  P       + +  Y +  + +
Sbjct: 65  VQLDTGSSDLWFPSADNPFC------------KENKKYAPKGKDVQPLDDSGYPSASNQV 112

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                    P +S+ +NC  YG F+SS+SSTF+ N ++F ++Y D +FA+G WG D ++ 
Sbjct: 113 ---------PKSSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSF 163

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGV---SLSSVQKSYTYNNFPMVLKN 272
           N LN++ ++FA+ +  NS+ GVLG+GLP +ESTY G    S  ++  S+ Y NFP+ LK 
Sbjct: 164 NELNISNVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLKQ 223

Query: 273 SGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVT 332
           +G I   AYSL+ N S S+ G++LFGAVDH +Y G LYT+P+ N L  N + DP Q  +T
Sbjct: 224 NGVIDKIAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSLFQN-FTDPFQLEIT 282

Query: 333 LQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYV 392
           + G+ +    G D   TL   K  ALLDSGTT++ +   + +L+A +V  + + +     
Sbjct: 283 MNGLGL---QGNDANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIR 339

Query: 393 MNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPT---VILGDN 449
           +      K++  ++F+F G  ++    +     +     C L FA   D +   +I GDN
Sbjct: 340 LPKCPSKKENKKLIFNFSGAEVA---VDINQMMNKHKGKCYLQFAVHEDTSNDAIIFGDN 396

Query: 450 FLVSTYIVYDLDNMEISMANADFSDN-DEYIDVIESAVPSALKAPNYSNTWSTYESIVP- 507
           FL S Y+VY+L++ EIS+A A+F+ +  E I+ I+S VPSA++AP Y NT+S + +    
Sbjct: 397 FLRSVYLVYNLEDKEISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEHATATAV 456

Query: 508 GGNIF 512
            G+IF
Sbjct: 457 TGDIF 461

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  297 bits (761), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 194/496 (39%), Positives = 290/496 (58%), Gaps = 47/496 (9%)

Query: 41  FEKKYGDSFENASN----DRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITV 96
           F K+YG SF+ +      ++  G       DD E + ++N+N +YS  + +GTP Q++T+
Sbjct: 34  FSKRYGKSFDESRQISFSEKGTGG------DDQE-IDISNQNVYYSASIYLGTPGQELTL 86

Query: 97  LVDTGSSDLWVTGSNNPYC------STKGKDTSD----FSFKQIHKDNPASVVESVITEI 146
           L+DTGSSDLW+      +C      +TKGK +      FS        P+  + + +   
Sbjct: 87  LLDTGSSDLWIPQKGGYHCQSDSDDATKGKSSGIASQLFSIASAEG-GPSPSLTTTLIGS 145

Query: 147 SYDTTISVIEATATLDNTPLA----SQKINC-GTYGTFDSSKSSTFESNKT--KFSITYG 199
           S  +    +E T      P A    + + +C  + G FD + SS+F  N T   F I YG
Sbjct: 146 SGGSHPDPLEPTNRNVQPPAAITASALEESCQSSSGNFDPNSSSSFNKNDTVDGFFIEYG 205

Query: 200 DSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQK 259
           D+++ASG W  D L + +++V  ++ AVA++TNS+V V GI   GLES+  G +L   Q 
Sbjct: 206 DNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYRGLESSVFGDNL---QD 262

Query: 260 SYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQ 319
            + Y NFP +LK+ G +K +AYSL+ N + +  G ILFG VDH KY+GDLYT+P++   +
Sbjct: 263 PHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFGGVDHNKYSGDLYTLPVLKGQE 322

Query: 320 NNGYKDPIQ-FHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLAD 378
           ++   DP + F VT+QGI +    G +   TLTTT    LLDSGTT  YLP  + +++A+
Sbjct: 323 DS---DPWERFVVTVQGIGIK---GSETQNTLTTTPFIGLLDSGTTAVYLPEPVADMVAN 376

Query: 379 KVGASYSS--EYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGF 436
             G S+    E   YV++C  + +K   +VF+FGGF+I + LSN+   TD+ +  CIL  
Sbjct: 377 AYGGSFDDDPEVQSYVISCPSDDEK---IVFNFGGFNIETSLSNY--ITDNGNGQCILNI 431

Query: 437 APQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYS 496
           +P SD   ILGD+FL  +Y+VYD+DN EIS+A A+F D+ E ++ I   VP A KAP YS
Sbjct: 432 SPTSDYMGILGDSFLRDSYVVYDMDNNEISLAQANF-DSTEDVEAITGPVPGATKAPGYS 490

Query: 497 NTWSTYESIVPGGNIF 512
           +T+S  ++   GGNIF
Sbjct: 491 STYSGPQTFQTGGNIF 506

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  294 bits (752), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 178/446 (39%), Positives = 251/446 (56%), Gaps = 31/446 (6%)

Query: 62  LVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKD 121
           L +R+D    ++L N    Y+V+L +GTPPQ ITV +DTGSSDLW T   NPYC      
Sbjct: 31  LNKRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYC------ 84

Query: 122 TSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDS 181
                 K   K +P       + +  Y T+ + I         P + + I+C  +G F++
Sbjct: 85  ------KNNRKHSPKKSQIEPLNDADYPTSPNQI---------PKSLRDIDCKAFGFFNT 129

Query: 182 SKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIG 241
           SKSST+++N T F+++Y D+TFASG WG D L+ N + V  ++F +A  +NST  V GI 
Sbjct: 130 SKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFNGVKVDNVTFGLAAFSNSTTPVFGIS 189

Query: 242 LPGLESTYSGVSLSSV--QKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGA 299
           LP  E+T    +  S     SY Y+NFPM+LK  G +K  AYS++ N + S++G+ILFGA
Sbjct: 190 LPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQGIVKKIAYSVYLNDTRSKYGSILFGA 249

Query: 300 VDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALL 359
           VD  KY G LYT+P++N L     K P QF +TL GI + T    D   TL   K+  LL
Sbjct: 250 VDQSKYIGTLYTLPLVNSLYKQVSK-PFQFEITLNGIGLQTA---DKNYTLYDQKLATLL 305

Query: 360 DSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLS 419
           D+G T S LP K+  L+A KV  +   + G+  ++     K+  TVVF+FGG  IS  + 
Sbjct: 306 DTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEKRTVVFNFGGAEISIDIR 365

Query: 420 NFQLFTDSSSDVCILGFAPQSD-PTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEY 478
           +    T      C L    + D     LGD FL   Y+VY+L++ EIS+ANA+F+ +   
Sbjct: 366 D---LTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIANANFNYSTPD 422

Query: 479 IDVIESAVPSALKAPNYSNTWSTYES 504
           I  I S VP A+KAP Y NT+S Y +
Sbjct: 423 IQEIVSTVPGAVKAPQYYNTYSVYPT 448

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  294 bits (753), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 183/478 (38%), Positives = 257/478 (53%), Gaps = 24/478 (5%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           YV M F+K    S  +A+ D        +R+ DY LV L NE   Y+V+L +GTPPQ IT
Sbjct: 34  YVQMGFDK----SCTSATGD----MVFAKRDGDYVLVDLINEKILYTVQLAVGTPPQNIT 85

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           V ++ GS+D W+T  +NPYC  K     +   KQ+  +   S++ S+  +     T+S  
Sbjct: 86  VSINIGSADPWMTSPDNPYCEIKKHSGYE---KQVGANTSVSLLSSLSND---RVTMSGT 139

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
             T T  ++ +    I+C  YGTF+ S SS+F++N T F++ Y D T AS  WG D + +
Sbjct: 140 VTTGT--SSSMVQPIIDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRV 197

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGA 275
             L +  +SF VAN  N+T GV GIG P LE+T    +      SY Y NFP  L N G+
Sbjct: 198 ELLEILDMSFGVANVFNATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQALNNQGS 257

Query: 276 IKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG 335
           +   AYSLF N S++  G++LFGAVDH KY  DL+T+P++N  ++ G   P  F+V    
Sbjct: 258 VDKVAYSLFLNDSHAMKGSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFNVFNAR 317

Query: 336 IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
                     N       +   +LDSG T+S LP KLV+ L   + A++  E   Y + C
Sbjct: 318 RGCPNKRRPQNR---RHDEFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKC 374

Query: 396 IHEVKKDITVV-FDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVST 454
               KKD +V  FD G FHI   LSNF        + CIL   P  +   IL DNFL   
Sbjct: 375 --PSKKDTSVASFDIGRFHIDGPLSNF--VRKYEKNKCILRLDPADNQPYILCDNFLSRA 430

Query: 455 YIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
           Y+V+DL++ EISM  A+     E I+ I+S VP  ++AP+Y  TW     + P GNI+
Sbjct: 431 YVVHDLESYEISMGQANTEYAPEQIEAIKSKVPGTVRAPSYDKTWGNGTDVSPSGNIY 488

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  287 bits (734), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 187/498 (37%), Positives = 262/498 (52%), Gaps = 42/498 (8%)

Query: 39  MNFEKKYGDSFENASNDRNAGAHLVRR----EDDYELVKLTNENSFYSVELDIGTPPQKI 94
           + F K YG SF  A+ DR    +L R     +D+ E+    N N++YSV + +GTP Q +
Sbjct: 34  IGFNKVYGKSFSEATADRKY-VNLFRNKNISDDNDEVALQNNANTYYSVNISLGTPGQNM 92

Query: 95  TVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEI-SYDTTIS 153
           T+ +DTGSSDLWV       C+    DT+ F  K+   DN    + S I+++ SY+ + S
Sbjct: 93  TIQLDTGSSDLWVIKPGGLQCTDN--DTNLFK-KRSENDNDNDAISSFISQLESYEGSFS 149

Query: 154 VI---------EATATLDNTPLA--------------SQKINCGTYGTFDSSKSSTFESN 190
            +           T T+ ++  A                  NC     F++  S TF  N
Sbjct: 150 TLFGPGPGSVGTPTGTISSSMPAPTGNGSYDGGDSDSDGSNNCNATAFFEADNSKTFHRN 209

Query: 191 KT-KFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTY 249
           +T  + I Y D ++ASG WG D L L +L V  +SFAVAN+TNST  V GIG PG ES++
Sbjct: 210 RTDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVANDTNSTTPVFGIGFPGGESSF 269

Query: 250 SGVSLS-SVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGD 308
           + V         + Y NFP  LKN G I+  AYSL+ N  NS +G +LFG VDH +Y G 
Sbjct: 270 ASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPNSTYGNVLFGGVDHSQYQGQ 329

Query: 309 LYTIPIINILQNNGYKDPIQ-FHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISY 367
           LYT+PI+ +       DP     +TLQG++V       +   + T  IP +LDSGTT  Y
Sbjct: 330 LYTLPILQLGNLTSDGDPYNTLAITLQGVSVTR---RGSKHKVKTKPIPVVLDSGTTAMY 386

Query: 368 LPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDS 427
           LP KL + +A +       E   Y+++C      D  + FDFGG  I + + N+ +F + 
Sbjct: 387 LPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDY-ITFDFGGVTIKTDIRNY-IF-EQ 443

Query: 428 SSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVI-ESAV 486
           S + C+LG  P SD   + GD FL   Y+VYDL+  EIS+A A F+ + E I+ I  S V
Sbjct: 444 SENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISLAQASFNSSSEQIEAITSSGV 503

Query: 487 PSALKAPNYSNTWSTYES 504
           P A +AP YS TW    S
Sbjct: 504 PGAKRAPGYSKTWKVVHS 521

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  285 bits (730), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 172/454 (37%), Positives = 257/454 (56%), Gaps = 35/454 (7%)

Query: 64  RREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTS 123
           R ++D  +  L N    Y+V++ +GTPPQ +TV +DTGSSDLW   ++NPYC    K   
Sbjct: 34  RADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASNPYCKNNKK--- 90

Query: 124 DFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSK 183
              F    +D     +  + ++  + T+ + +         P A + INC  YG F++S 
Sbjct: 91  ---FAPKKQD-----LMPITSDDGFPTSPNQV---------PKALRNINCNKYGFFNASG 133

Query: 184 SSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLP 243
           SST+  N T FS++YGD TFASG WG D ++LN + V  ++F +A+ +NST  V GIGLP
Sbjct: 134 SSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKVENVTFGLASFSNSTNPVFGIGLP 193

Query: 244 GLESTYSGVSLSSVQKSYT-YNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDH 302
           G ESTY+  S  +   + T Y+NFP+ LK  G I   AYS++ N + S+ G+ILFGAVDH
Sbjct: 194 GDESTYAMFSEDTNGTTNTQYSNFPLQLKQQGKIDKVAYSIYLNSTKSKQGSILFGAVDH 253

Query: 303 GKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNAT---TLTTTKIPALL 359
            KY+G LYT+PI+N    +  ++P +  VTL G+      G+  AT   TL    +PALL
Sbjct: 254 SKYSGPLYTLPIVNRF-GHLVENPYELEVTLSGL------GLQRATSNITLFDQLLPALL 306

Query: 360 DSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLS 419
           D+GTT +Y+P  + + LA++       +     +      K + T+VF+F G  I   + 
Sbjct: 307 DTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKSNDTIVFNFSGAQIKIKMV 366

Query: 420 NFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYI 479
           +   F +     C L    Q     +LGD+F+   Y V+DLD+ EIS+A A+F+   E I
Sbjct: 367 D---FVEKHKGKCYLPCVSQESSFFLLGDSFMRHVYTVFDLDDKEISIAQANFNSTKEDI 423

Query: 480 DVIESAVPSALKAPNYSNTWSTYES-IVPGGNIF 512
           + I S VPSA+KAP Y +++  + + I   G+IF
Sbjct: 424 EEISSTVPSAVKAPQYYSSYVDFPTEISVTGDIF 457

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  283 bits (724), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 177/481 (36%), Positives = 257/481 (53%), Gaps = 43/481 (8%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENS--FYSVELDIGTPPQK 93
           YV ++FEK +GD              LV+R  D + VKL N      Y+++L +GTPPQ 
Sbjct: 14  YVALDFEKSHGD-------------DLVKR--DVQDVKLINSQKAMLYNIQLSVGTPPQN 58

Query: 94  ITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTIS 153
           IT  +DTGSSDLW   S NPYC            K   K  P S+            ++ 
Sbjct: 59  ITAQLDTGSSDLWFPDSTNPYC------------KANKKQAPKSIA-----------SLD 95

Query: 154 VIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQL 213
                 +    P + + ++C  +G F+SS S+TF SNKT+F I+Y DS++A G W  D L
Sbjct: 96  AGTRPTSPAQVPKSLRNLDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNL 155

Query: 214 NLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNS 273
            LN LN++GL+F +A  +NS+  VLG+GL  LE++Y           + Y NFP +LK  
Sbjct: 156 YLNGLNISGLNFGLAYFSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQILKQK 215

Query: 274 GAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTL 333
           GAI    YSL+ N + S++G ILFG VDH KY G LYTIP++N              VTL
Sbjct: 216 GAISKVTYSLYLNDTKSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADLEVTL 275

Query: 334 QGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVM 393
            G+ +   +  +  TTL T K+PAL DSGT+ SY+P  + +++A +V  +  ++     +
Sbjct: 276 NGLGI-RDNTTNTNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRL 334

Query: 394 NCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVS 453
                 K    VVF+F G  I+  L  F         + ++   P + P ++LGD FL  
Sbjct: 335 PKCPSKKDTREVVFNFNGVEIAIPLKQFYQKKSGKCYLDLMVAPPNNGPGLLLGDTFLRQ 394

Query: 454 TYIVYDLDNMEISMANADFSDN-DEYIDVIESAVPSALKAPNYSNTWSTYESIVP-GGNI 511
            Y V+DL+  E+S+A A+F+ +    ++ I+S VPSA+KAP Y NT+S Y++     GNI
Sbjct: 395 VYTVFDLEAQELSIARANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAYDNATQVVGNI 454

Query: 512 F 512
           F
Sbjct: 455 F 455

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  278 bits (712), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 176/446 (39%), Positives = 251/446 (56%), Gaps = 34/446 (7%)

Query: 64  RREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYC-STKGKDT 122
           R +DDY  V+L NE  FY VE+ IG+  Q +T+LVDTGSSD WV G+ NPYC S +GK  
Sbjct: 31  RADDDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSNRGK-- 88

Query: 123 SDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSS 182
                K   KD P+SV         Y T    I         P A +  +C  + TF+SS
Sbjct: 89  -----KPKKKDQPSSVDPG---RNGYPTKAEAI---------PYAERTFDCSDFKTFNSS 131

Query: 183 KSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGL 242
            S+TF+SN T F ITYGD ++  GTWG DQ+ L    +  ++FAVA  TN++ G+LGIGL
Sbjct: 132 SSNTFKSNDTDFFITYGDGSYVEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIGL 191

Query: 243 PGLES-----TYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILF 297
           P LES     T    + SSV+K+  Y NFP  LK +  I    YS++ N++N + G+ILF
Sbjct: 192 PELESSITIDTAQLTNTSSVKKN-PYMNFPESLKLNKLINKVVYSIYLNRTNDKFGSILF 250

Query: 298 GAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPA 357
           GAVDH +Y G+L T+P++   ++ G   P +  VTL G++    DG        T+K PA
Sbjct: 251 GAVDHNRYDGNLTTVPLVFSNRDFGTPRPNELMVTLNGMSFEATDGNVTQILNATSKFPA 310

Query: 358 LLDSGTTISYLPVKLVELLADKVGASY-SSEYGYYVMNCIHEVKKDITVV-FDFGGFHIS 415
           LLD+G+T ++LPV +   LA+    +Y  ++    +  C+   KKD T++ F  GG +I 
Sbjct: 311 LLDTGSTDTHLPVDVYNALAESTNGTYDQTQNKIRIPKCLS--KKDKTILNFSLGGVNIG 368

Query: 416 SWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDN 475
                ++         C +  AP      ILGD+ +   Y+V+DL++ EIS+A A F+D 
Sbjct: 369 ---VPYKEMVKKIKGKCYINVAPTGSDFAILGDDVIRYAYMVFDLEDREISLAQASFNDT 425

Query: 476 -DEYIDVIESAVPSALKAPNYSNTWS 500
             E I+V+ S +P A +A  YS T+S
Sbjct: 426 LPEDIEVVVSTIPGATRASAYSETYS 451

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  276 bits (706), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 176/450 (39%), Positives = 255/450 (56%), Gaps = 36/450 (8%)

Query: 62  LVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKD 121
           L +R DD   V L N+   Y V+L +GTPPQ ++V +DTGS+DLW +G++NPYC T    
Sbjct: 30  LEKRADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTN--- 86

Query: 122 TSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDS 181
                     K  P S     +    + T    I   A         + ++C  YG F+ 
Sbjct: 87  ---------KKKAPKSKDLQPVDNSGFPTNPDQIGKKA---------RNLDCKKYGFFNM 128

Query: 182 SKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIG 241
           S SSTF++N T   + Y D +F  GTWG D ++L  LN++G++FAVA  +NS+ GVLG+ 
Sbjct: 129 SSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEISNSSSGVLGVS 188

Query: 242 LPGLESTYSGVSLSSVQKS-YTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAV 300
           LP  ESTYS  S  +   + Y Y+N P+ LK  G I    YS++ N + S++G+ILFGAV
Sbjct: 189 LPSEESTYSINSNGTTNATNYQYSNLPLQLKEQGIIDKVTYSIYLNDTKSKYGSILFGAV 248

Query: 301 DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLD 360
           DH KYTG LYT+P++N  + +    P +  +TL GI   +   M +  TL   K+ AL+D
Sbjct: 249 DHSKYTGTLYTLPLVNS-EYDVVNKPYELDITLNGIGYQS---MSSNMTLYDQKVAALID 304

Query: 361 SGTTISYLPVKLVELLADKVGASYSSE-YGYYVMNCIHEVKKDITVVFDFGGFHISSWLS 419
           SGTTIS  P ++VE++A ++ A+      G  +  C  + K +  ++F+ GG  I     
Sbjct: 305 SGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSK-KDNAKLLFNLGGALI---YV 360

Query: 420 NFQLFTDSSSDVCILGFAP---QSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDN- 475
           + + FT      C L   P   +SD  VILGDNF+ S Y V+DL+  E+S+A A+F+ + 
Sbjct: 361 DIKEFTTKVKGKCYLEIIPSGAESD-LVILGDNFMRSVYTVFDLEANEVSIAQANFNSSL 419

Query: 476 DEYIDVIESAVPSALKAPNYSNTWSTYESI 505
              I+ I+S VPSA+KAP Y NT+S   SI
Sbjct: 420 PAQIEEIKSTVPSAVKAPQYYNTFSAIASI 449

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  274 bits (700), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 163/430 (37%), Positives = 246/430 (57%), Gaps = 31/430 (7%)

Query: 71  LVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQI 130
           L+ + +    Y V+++IGTPPQ   + +DTGSSD+ +  ++  YC +             
Sbjct: 60  LINMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCESLAD---------- 109

Query: 131 HKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESN 190
                    E+ I+  +Y+ T + IE  +T    P A+    C  +GTF  + SSTF+ N
Sbjct: 110 ---------ENNISTSNYELTATAIEILSTA--APSAAYNAPCSYWGTFSPNSSSTFKYN 158

Query: 191 KTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLEST-Y 249
           +T F++TYGD+++ +GT+G D ++L N+ ++  +F V+N+T +  G+LG+ LP  E T  
Sbjct: 159 ETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTNNGGILGVSLPSAEVTDD 218

Query: 250 SGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDL 309
           +  +LSS    + YNNFPM LK+ G IK  AYSLF N+ ++  G+ILFGAVD  +Y+G L
Sbjct: 219 TEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSARFGSILFGAVDKSEYSGQL 278

Query: 310 YTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLP 369
           YT+P++         D   F VT Q +A+   D      T++  + P L DSGT+ S LP
Sbjct: 279 YTLPMLQAYNTLDATDAGMF-VTAQSVAIL--DSKSGNKTVSEVQFPVLFDSGTSTSVLP 335

Query: 370 VKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSS 429
            K+ + +       YSS+   Y+ +C      +  + FDFGGF+IS+ +SN   F   + 
Sbjct: 336 TKIADAIGRSFDGKYSSDDQGYIFDCAK--VNNTLLSFDFGGFNISANISN---FVTPAK 390

Query: 430 DVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSA 489
           D CIL   P SD   +LGD FLV TY+VYDL+N E+S+A A F + +E I +I  +VP A
Sbjct: 391 DHCILQILP-SDTIFVLGDAFLVDTYVVYDLENHEVSVAQASFDNKEEDIGIISDSVPGA 449

Query: 490 LKAPNYSNTW 499
             AP YS+TW
Sbjct: 450 TPAPGYSSTW 459

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  271 bits (692), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 165/461 (35%), Positives = 256/461 (55%), Gaps = 33/461 (7%)

Query: 56  RNAGAHLVRRED-DYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPY 114
           +  G+ L +R+  D E  +LT +   Y VE+ +GTPPQK+ + +DTGSSDL+V   +NPY
Sbjct: 24  KTPGSDLAKRDVVDPEAAQLTFDKDQYIVEVAVGTPPQKVLLQIDTGSSDLFVIEESNPY 83

Query: 115 CSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCG 174
           C             +   D                      +   T +  P + + ++C 
Sbjct: 84  CKNNKNKAPKKKDLESPGD----------------------DYPRTPNQVPKSDRTLDCK 121

Query: 175 TYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNST 234
            YG ++ ++SSTF SN T   ITYGD+ F  GTWG D +++ NLN++ LS  V+  TN++
Sbjct: 122 KYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIGVSPMTNTS 181

Query: 235 VGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGT 294
            G+LG+GLPG EST++  S  +   +Y Y+NFP+ LK  G I+  AYS++ N++ S++G+
Sbjct: 182 TGILGVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAYSIYLNETGSKYGS 241

Query: 295 ILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTK 354
           ILFGAVDH KY G LYT P++N     G  DP QF +T+ G+ +    G  +  TL   K
Sbjct: 242 ILFGAVDHSKYQGPLYTFPLVNSKYKEG-SDPFQFEITMNGVGLV---GKTDNITLYDQK 297

Query: 355 IPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHI 414
           +P LLDSG+TIS LP  + +L+A +V  +   +     +      K +  ++F+F G   
Sbjct: 298 LPTLLDSGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSGAEF 357

Query: 415 SSWLSNFQLFTDSSSDVCILGFAPQSDPT-VILGDNFLVSTYIVYDLDNMEISMANADFS 473
           S  +++F    +     C L F+        +LGDNF+ + Y V++LD+ E+S+A A+++
Sbjct: 358 SVNVTDFM---EKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQANYN 414

Query: 474 DN-DEYIDVIESAVPSALKAPNYSNTWSTYESIVP-GGNIF 512
            +    I+ I+  VPSA+ AP Y NT+S   +     GNIF
Sbjct: 415 SSLKPDIEEIKDTVPSAVLAPQYYNTFSADPTATAVTGNIF 455

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 175/465 (37%), Positives = 249/465 (53%), Gaps = 57/465 (12%)

Query: 48  SFENASNDRNAGA-HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLW 106
           S +N    RN+G+ HL     + EL  +  E ++Y+  L+IGTPPQ +TVL D+GSSDLW
Sbjct: 35  SSKNQYAKRNSGSGHL-----EIELQHI--EQTYYATTLEIGTPPQNLTVLFDSGSSDLW 87

Query: 107 VTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPL 166
           V  ++NPYC ++   +  ++   I++                                  
Sbjct: 88  VMDASNPYCESQYTGSQTYNGSSINQ---------------------------------- 113

Query: 167 ASQKINCGTYGTFDSSKSSTFESNKT-KFSITYGDSTFASGTWGHDQLNLNNLNVTGLSF 225
            +  I+C ++ TF+ S SS+F++  T +F   Y D TFA G+W  ++L +N ++V+ L F
Sbjct: 114 -ASTIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDKTFADGSWATEKLTMNGVDVSSLQF 172

Query: 226 AVANETNSTV-GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLF 284
            + N   + V GVLGIG P  ES    V       +  Y NFP VLKN G I   AYS+F
Sbjct: 173 GLGNCVTTPVSGVLGIGFPRRES----VKGYDNAPNEFYPNFPQVLKNQGIIDVVAYSMF 228

Query: 285 SNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGM 344
            NK  S+ G+ILFGA+D  KYTGDL T P++NI  +   K P    V LQG+  A  +  
Sbjct: 229 LNKLESDTGSILFGAIDTSKYTGDLVTFPMLNIYPDVTDK-PATLMVILQGLG-AQDNAN 286

Query: 345 DNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKKDI 403
             A T  T+KIP LLDSGTT+   P ++ +++AD + A++S + G Y+M C   E   + 
Sbjct: 287 CKAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANT 346

Query: 404 TVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNM 463
             +FDFGG  I   LSNF L   S    C     P    T++LGD FL S Y+V+DLDN 
Sbjct: 347 DYIFDFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDSNTMVLGDIFLSSAYVVFDLDNY 406

Query: 464 EISMANADFSDNDEYIDVIESAVPSALKAPNYS----NTWSTYES 504
           +IS+A A+  +N    D I + +PS    PN      + WSTYE+
Sbjct: 407 QISLAAANLDNNVSLEDSIIN-IPSDGNIPNAKMATVDPWSTYET 450

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  267 bits (682), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 171/427 (40%), Positives = 245/427 (57%), Gaps = 44/427 (10%)

Query: 81  YSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVE 140
           Y V+++IGTPPQ + + +DTGSSD+ V  ++  YC +   D SD++      DN      
Sbjct: 67  YVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSM-SDGSDYA----STDN------ 115

Query: 141 SVITEISYDTTISVIEATATLDNTP---LASQKIN--CGTYGTFDSSKSSTFESNKTKFS 195
                          E TAT +  P   ++S+  N  C  +GTFD+S SSTFE+N T F+
Sbjct: 116 --------------YELTATFNGLPSTTISSEAYNTLCSYWGTFDASNSSTFENNATFFN 161

Query: 196 ITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANET-NSTVGVLGIGLPGLESTYSGV-- 252
            TYGD T+ +GT+G D ++  N+ +   +F V+N+T  +  G+LGI LP  E T  G+  
Sbjct: 162 NTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGNPSGILGISLPIAEFT-DGIEY 220

Query: 253 SLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTI 312
           +L+  +  + Y+NFPM LKN G I   AYSLF N  ++  G+ILFGAVD  KYTG LYT+
Sbjct: 221 ALALNRTPFIYDNFPMELKNQGKINKIAYSLFLNGPDAHFGSILFGAVDKSKYTGQLYTL 280

Query: 313 PIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
           P++      G  +P    +T Q +A+   D      T++  + P +LDSGTT SYLP ++
Sbjct: 281 PMLQAFNTLG-SNP-GMIITAQSVAIL--DSESGNKTVSDIQFPVMLDSGTTFSYLPTEI 336

Query: 373 VELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVC 432
            E +       YSS+   Y+ +C      D  +  DFGGF+IS+ +SNF     S+ D C
Sbjct: 337 AEAIGKSFDGEYSSDDQGYIFDCSK--VNDTLLSVDFGGFNISANISNF---VTSAKDRC 391

Query: 433 ILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKA 492
           +L    QS+ T +LGD FLV  Y+VYDL+N EIS+A A F++ +E I+VI   VP A  A
Sbjct: 392 VLN-VKQSESTYMLGDAFLVDAYVVYDLENYEISIAQASFNNQEEDIEVISDTVPGATPA 450

Query: 493 PNYSNTW 499
           P Y +TW
Sbjct: 451 PGYFSTW 457

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  261 bits (667), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 167/458 (36%), Positives = 256/458 (55%), Gaps = 42/458 (9%)

Query: 50  ENASNDRNAGAHLVRREDDYE--LVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWV 107
           +  +N  N+ + + +R + +   L+ + +    Y VE++IGTPPQ     +DTGSSD+  
Sbjct: 33  QKLANIPNSASGISKRSEAFNSTLINMFSSAHIYVVEMEIGTPPQAAYFQLDTGSSDMCA 92

Query: 108 TGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYD--TTISVIEATATLD--- 162
             +++ YC          SF            ES I   +Y+   T S I +TAT     
Sbjct: 93  NEADSSYCE---------SFTD----------ESNIWTSNYELTATASEISSTATSSKAY 133

Query: 163 NTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTG 222
           NTP       C  +GTF  + SSTF+ N+T F+I+Y D+ + +GT+G D ++L N+ ++ 
Sbjct: 134 NTP-------CSYWGTFSPNVSSTFKYNETIFNISYADNMYYAGTYGTDVVSLGNITLSN 186

Query: 223 LSFAVANETNSTVGVLGIGLPGLESTYS-GVSLSSVQKSYTYNNFPMVLKNSGAIKSSAY 281
            +F V+N+T  + G+LG+ LP +E T     +LSS    + Y NFPM LK+ G I+  AY
Sbjct: 187 FTFGVSNDTKMSYGILGVSLPSVEETDDIEDALSSNTTPFVYENFPMALKSQGKIEKIAY 246

Query: 282 SLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATG 341
           SLF N+ ++  G+ILFGAVD  KY+G LYT+P   +LQ     D +   + +   + A  
Sbjct: 247 SLFLNEPSARFGSILFGAVDKSKYSGQLYTLP---MLQAYNTLDALYSGMFVTAQSAAII 303

Query: 342 DGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKK 401
           D      T++  + P L DSGT+ S LP ++ + +       YSS+   Y+ +C      
Sbjct: 304 DSKSGNKTVSEVQFPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNT 363

Query: 402 DITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLD 461
            +++  DFGGF+IS+ +SNF   T  + D C+L   P SD   +LGD FLV TY+VYDL+
Sbjct: 364 QLSI--DFGGFNISANISNF--VTPLTKDHCVLQILP-SDTVSVLGDAFLVDTYVVYDLE 418

Query: 462 NMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTW 499
           N E+S+A A F++ +E I++I  +VP A  AP YS+TW
Sbjct: 419 NHEVSVAQASFNNEEEDIEIISDSVPGATPAPGYSSTW 456

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  255 bits (651), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 179/476 (37%), Positives = 264/476 (55%), Gaps = 71/476 (14%)

Query: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95
           +V MNF + YG S + A + R+  +H ++R ++YE V+L NE  FYS++L IG+  Q +T
Sbjct: 31  FVSMNFNRLYGASPDTAVSKRSM-SH-IKRSENYEQVRLKNEACFYSMDLAIGSNHQNVT 88

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           VLVD        TGS++ +    G D+S                                
Sbjct: 89  VLVD--------TGSSDLWV--PGPDSS-------------------------------- 106

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                              +YG F    S++ + N T+FS  Y D T A G W +D + L
Sbjct: 107 ------------------ASYGVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVAL 148

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGA 275
            +  V+ ++FAV N+T+S  GVLG+GL GLE+TY+    +++   Y Y+NFP+ L   G 
Sbjct: 149 GDTTVSNVTFAVVNDTDSNFGVLGLGLTGLEATYT----NALSSPYQYDNFPVKLVRQGL 204

Query: 276 IKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG 335
           I+++AYSL+ NK+++  G +LFGAVDH KYTG L+TIP +N L++ GY   I+FHVTL G
Sbjct: 205 IQANAYSLYLNKADASSGNVLFGAVDHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDG 264

Query: 336 IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
           + ++T DG    TTLTT+K P L+DSG T SYLP  L++ +A ++GA+YS+EY  YV+ C
Sbjct: 265 MDLSTNDGQ---TTLTTSKFPVLVDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTC 321

Query: 396 IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTY 455
             E   D  + ++FGGF+I + LS         S+ CIL  AP       LGD FL + Y
Sbjct: 322 PSE-DDDTVISYNFGGFNIDTPLSGSVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVY 380

Query: 456 IVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGNI 511
                    +S+A A ++D +E I++I S++P A+KA  YS+ WS        GN+
Sbjct: 381 ASSTWTIESLSLAQAQYTDEEE-IEIISSSIPGAIKAAGYSDIWSASAKNSTSGNV 435

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  239 bits (609), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 160/467 (34%), Positives = 242/467 (51%), Gaps = 65/467 (13%)

Query: 62  LVRREDDYELVKLTNE--NSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKG 119
            ++R+     + L N   +   +V + IG   Q +  + DTG SD WV G N+ YC  + 
Sbjct: 82  FIKRDGSARELDLYNRAYSGLLNVIISIGKEGQNMFFVADTGLSDTWVVGQNSVYCDIEN 141

Query: 120 KDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTF 179
             T            PA            + T +  E T    N         C     F
Sbjct: 142 GTT------------PA------------NHTANFSENTFAFKN-----HAFPCYLADVF 172

Query: 180 DSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLG 239
           + + S++  SN T F   + D TFASGTW  D + + ++ +   +F VA ETN+T+G LG
Sbjct: 173 EVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVAQETNATIGSLG 232

Query: 240 IGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGA 299
           +GL G E T  G        +YTY NFP  LKNSG IK   YS+++ K ++E G++LFGA
Sbjct: 233 LGLEGNEITNEG------DYTYTYENFPTKLKNSGMIKRVIYSIYAGKIDTEDGSLLFGA 286

Query: 300 VDHGKYTGD-LYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPAL 358
           V+H +Y GD LYT+P++N+  NN   DP++FHVTLQ + V+        TT+ + +  AL
Sbjct: 287 VEHSRYVGDTLYTLPLVNV--NNASSDPVEFHVTLQNLVVSVN---KTNTTIMSDRYAAL 341

Query: 359 LDSGTTISYLPVKLVELLADKVGASYSSE-YGYYVMNCIHEVKKDITVVFDFGGFHISSW 417
           L++G  ++YLP  L      K G S S + YG YV +C  E    I+  +DFGGF I S 
Sbjct: 342 LNTGAIVTYLPTHLFSDFIKKTGLSESQKYYGMYVTDCSSE----ISFSYDFGGFKIESS 397

Query: 418 LSNFQLFTDSSSDV----CILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANA--- 470
           L+++ LF    S++    C +      +  ++LG  F  S Y+V+DL+ +E+S+A A   
Sbjct: 398 LNDY-LFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSSAYVVFDLERLEVSIAQAAHV 456

Query: 471 -------DFSDNDEYIDVIESAVPSALKAPNYSNTWSTYESIVPGGN 510
                  +  DN + ++++  ++PSA KA +YSNTW T++     GN
Sbjct: 457 YDNFTYSNIEDNPD-VEIVIDSIPSATKAASYSNTW-TFDRAPENGN 501

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  228 bits (581), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/326 (41%), Positives = 198/326 (60%), Gaps = 13/326 (3%)

Query: 187 FESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLE 246
           F+ N+T F+ITY D+++ +GT+G D ++L ++ ++  +F V+N+T    G+LGI LP  E
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 247 STYSGV-SLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKY 305
            T SG  +LSS    + Y+NFPM LKN G I+  AYSLF N+ N+  G+ILFGAVD  KY
Sbjct: 61  ITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKY 120

Query: 306 TGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTI 365
           TG LYT+P   +LQ     D +   + +   +VA  D +    T++  + P L DSGT+ 
Sbjct: 121 TGQLYTLP---MLQAYNTLDALGGGMLVTAQSVAILDSISGNKTVSEVQFPVLFDSGTST 177

Query: 366 SYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFT 425
           S LP ++ + +       YSS+   Y+ +C       +++  DFGGF+IS+ +SNF   T
Sbjct: 178 SVLPTEIADAIGRSFDGKYSSDDEGYIFDCSKVNNTQLSI--DFGGFNISANISNF--VT 233

Query: 426 DSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESA 485
             + D C+L   P SD   +LGD FLV TY+VYDL++ E+S+A A F++ +E I++I  +
Sbjct: 234 PLTKDHCVLQILP-SDTVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEIISDS 292

Query: 486 VPSALKAPNYSNTWSTYESIVPGGNI 511
           VP A  AP YS+TW       PGG I
Sbjct: 293 VPGATPAPGYSSTW----VYTPGGPI 314

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  231 bits (589), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 154/425 (36%), Positives = 233/425 (54%), Gaps = 29/425 (6%)

Query: 80  FYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVV 139
            Y+V+L +GTPPQ +TV +DTGSSDLW   ++NPYC    K  +  + K++ K  PA+  
Sbjct: 52  MYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYC----KRNAKLAPKKV-KALPAT-- 104

Query: 140 ESVITEISYDTTISVIEATATLDNTPLASQKINCGTYG-TFDSSKSSTFESNKTKFSITY 198
               TE        V +   T D          C  +G    S  SS   ++ ++F + Y
Sbjct: 105 -GFATE-----NDQVAKKLRTFD----------CDAFGLFNSSMSSSFKSNDSSEFFVKY 148

Query: 199 GDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQ 258
            D T+ASG WG D   LN+ NV+ ++FA+AN  N+++GVLG+G P  E+T      S + 
Sbjct: 149 EDGTYASGMWGTDTFKLNHHNVSNITFALANIANASMGVLGVGFPAEETTDDPSPGSLID 208

Query: 259 KS-YTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINI 317
           K  Y Y+NFP+ LK +  IK  +YS+F N +NS+ G ILFG VDH KY G L+T+P++N 
Sbjct: 209 KEHYQYDNFPIALKRTRTIKKVSYSIFLNDTNSKKGVILFGGVDHSKYQGTLWTVPMVNN 268

Query: 318 LQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLA 377
           L         +  +TL G+     D   N  TL   KIP LLD+GTT++Y P ++V+++A
Sbjct: 269 LLTLNQTTTSRPEITLNGLGFR--DDKKN-VTLWGEKIPVLLDTGTTLAYAPKQVVDVIA 325

Query: 378 DKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFA 437
            +V  +  S+ G   +      K +  ++F+F G  I   L N          + I    
Sbjct: 326 KRVNGTIDSKTGGIKLKKCPNAKDNSELIFNFAGAEIPVSLLNMVEKRKGKCYLEIRYHE 385

Query: 438 PQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEY-IDVIESAVPSALKAPNYS 496
             S   ++LGD F+   Y V+++++ME+S A A+ +D+    I+ I S VPSA+KAP Y 
Sbjct: 386 ELSKTGMLLGDIFMRHVYSVFNMEDMEVSFAVANGNDSAPLQIEAIISDVPSAVKAPQYY 445

Query: 497 NTWST 501
           NT+++
Sbjct: 446 NTFAS 450

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  228 bits (582), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 156/426 (36%), Positives = 229/426 (53%), Gaps = 51/426 (11%)

Query: 72  VKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIH 131
           + L N N  Y  E+++GTPPQK+ VL DTGS+DLW   S+N YC+         S+ Q  
Sbjct: 43  MDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAA--------SYPQ-- 92

Query: 132 KDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNK 191
            DN                      +T T DN    +    C +  T++  +SSTF    
Sbjct: 93  GDN----------------------STNTNDNE--QNMASFCSSSRTYNFQRSSTFTPTG 128

Query: 192 TKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST-- 248
            KF I Y + TF+ G W  D+L + N +V+GL F V+N +N+T+ G+LG+G   LES   
Sbjct: 129 YKFFIDYVN-TFSRGIWAKDRLVIGNADVSGLQFGVSNISNTTINGILGVGYERLESVKG 187

Query: 249 YSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGD 308
           YSG        + TY N PM+LK SG I   AYS+F N  NS   T+ FG VD  KYTGD
Sbjct: 188 YSGA------PNRTYPNLPMLLKESGKIDKVAYSVFLNHLNSNVSTVTFGGVDSEKYTGD 241

Query: 309 LYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYL 368
           LY  P++NI ++     P +FH+TLQ + V  G+      T++ T +PAL D+GT    +
Sbjct: 242 LYKFPLVNIYKS--IPRPSKFHITLQALEVH-GNYSSLNKTVSNTPLPALFDTGTNGMVV 298

Query: 369 PVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQL-FTDS 427
           P  + E +A  + A++  ++  Y+  C  E + D  +VFDFG   I + L+NF +   + 
Sbjct: 299 PPNVAENIASTIHATFDEKFSLYLFACPAE-EDDTKLVFDFGDIQIEAPLANFIVPAAEL 357

Query: 428 SSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFS-DNDEYIDVIESAV 486
            ++ C +   P+ D T  LG  FL STY+VY+L++ E+++A A++  D    I  I S +
Sbjct: 358 GTEQCGVAIIPE-DGTFTLGIPFLRSTYVVYNLEDYEVALAQANWKWDGKSKITPIISNI 416

Query: 487 PSALKA 492
           P A +A
Sbjct: 417 PGATQA 422

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  228 bits (582), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 153/451 (33%), Positives = 232/451 (51%), Gaps = 53/451 (11%)

Query: 70  ELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQ 129
           EL     E  +Y+  LDIGTP Q++TVL DTGS+D WV  S+NP+CS K    S+ S  Q
Sbjct: 34  ELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPK----SNPSLYQ 89

Query: 130 IHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFES 189
               N + +  SV                             +C +  T++ + SST++ 
Sbjct: 90  NATYNGSKITPSV-----------------------------DCSSMSTYNENSSSTYQD 120

Query: 190 -NKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLES 247
            +  +F I Y D TF+ G+WG + +++N +++  + F +A    + V GVLGIG P  ES
Sbjct: 121 LDNGRFYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLAKYATTPVSGVLGIGFPRRES 180

Query: 248 T--YSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKY 305
              Y G           Y NFP +LK+   I   AYSLF N  +S  G+I+FGA+D  K+
Sbjct: 181 VKGYEGA------PDKYYPNFPQLLKSEQIIDVVAYSLFLNSPDSGMGSIVFGAIDESKF 234

Query: 306 TGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTI 365
            GDL T P++N         P    +T+QG+      G +  T + TTK P LLDSGT++
Sbjct: 235 YGDLLTFPMVNEYPTI-VDAPATLAMTIQGLGAQNKSGCERETFM-TTKYPVLLDSGTSL 292

Query: 366 SYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFT 425
              P  + + +A  V ASYS++ G Y++NC  +   DI   FDFG   I+  L++  L  
Sbjct: 293 LNAPKTIADKMASFVNASYSADEGIYILNC-PDSADDIEYTFDFGDLQINVPLTSLILSP 351

Query: 426 DSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVI--- 482
           +     C     P +D +++LGD FL S Y+V+DLDN +IS+A A+++ +++   VI   
Sbjct: 352 EVEGGYCGFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQANWNASEDSKQVINIP 410

Query: 483 -ESAVPSALKAPNYSNTWSTYESIVPGGNIF 512
            + ++P    A   +  WST E      +I+
Sbjct: 411 TDGSIPGGKSA--TAEPWSTNEPFTVTSDIY 439

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  228 bits (582), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 154/449 (34%), Positives = 231/449 (51%), Gaps = 56/449 (12%)

Query: 77  ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPA 136
           + ++Y+  L +GTPPQ ITVL+D+GSSD W+  S NP+C     +++     +I K N  
Sbjct: 52  QQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFCMENYCNST-----EIPKYNND 106

Query: 137 SVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFE---SNKTK 193
            + +++                            I+C  +  ++   SST++   ++ ++
Sbjct: 107 LITQNL---------------------------TIDCSYFNKYNPEISSTYQKLPNDNSR 139

Query: 194 FSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST--YS 250
           F + Y D +F  G W  + + ++N N+T L  AVAN   + V G+LGI  P  ES   Y 
Sbjct: 140 FYLQYTDGSFEDGIWSKETVQIDNYNITSLQLAVANYATTPVGGLLGISFPRRESVKGYD 199

Query: 251 GVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLY 310
           G        +  Y NFP VLKN   I    YS++ N  N + G++LFGA+D  K+ GD+ 
Sbjct: 200 GA------LNEYYPNFPQVLKNENIIDIVLYSMYLNDLN-QDGSLLFGAIDTSKFEGDMI 252

Query: 311 TIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPV 370
           T P++N+  N   K P    +T+QG+A    +      T  T+K P LLDSGTT+   P 
Sbjct: 253 TYPMVNVYPNVVDK-PATLALTIQGVAAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPK 311

Query: 371 KLVELLADKVGASYSSEYGYYVMNCI-HEVKKDITVVFDFGGFHISSWLSNFQLFTDSSS 429
           +L + +AD V A+YS +   Y++NC   EV  DI  +FDFGG  +   L  F L +D  S
Sbjct: 312 ELADKMADFVNATYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQVKIPLEKFILPSDDGS 371

Query: 430 DVCILGFAPQSDP-TVILGDNFLVSTYIVYDLDNMEISMA----NADFSDNDEYIDVIES 484
             C  G  P++    ++LGD FL   Y V+DLD+ +IS+A    NA+   N++ I  I S
Sbjct: 372 GPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHYQISLANINKNANSESNEDSIINIPS 431

Query: 485 --AVPSALKAPNYSNTWSTYESIVPGGNI 511
             A+P A  A      WST+E I    NI
Sbjct: 432 NGAIPGAKVA--TVKPWSTHEPITVTTNI 458

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  222 bits (565), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 179/310 (57%), Gaps = 10/310 (3%)

Query: 190 NKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTY 249
           N T+F  TYGD T+  GT+G D ++L N+ +   SF VAN T +  G+LGI LP  E+T+
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 250 SGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDL 309
           S +  +     + Y NFPM LK+ G I+  AYSLF N+  +  G+ILFGAVD  KY+G L
Sbjct: 61  S-LGGAYNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQL 119

Query: 310 YTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLP 369
           YT+P++          P  F VT Q +AV  GD  +   T++  + P L DSGTT S LP
Sbjct: 120 YTLPMLQAYDTLDSVSPGMF-VTAQSVAVLNGDSGNK--TVSKVRFPVLFDSGTTYSSLP 176

Query: 370 VKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSS 429
            ++   +       YSS    Y  +C     KD  +  DFGGF+IS+ +SNF   T    
Sbjct: 177 TEVAHAIGKSFDGKYSSGDQGYTFDC--SKVKDTLLSIDFGGFNISANISNFVTRT---K 231

Query: 430 DVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSA 489
           D C+L     +D   +LGD FLV  Y+V+DL++ E+S+A A F D  E I+VI   VP A
Sbjct: 232 DHCLLNIE-AADSGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGA 290

Query: 490 LKAPNYSNTW 499
           ++AP YS+TW
Sbjct: 291 IRAPGYSSTW 300

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  226 bits (575), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 147/416 (35%), Positives = 214/416 (51%), Gaps = 48/416 (11%)

Query: 56  RNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYC 115
           + A   L +R   +E  KL  ++ FY+VEL +GTP QKI  + DTGSSDLWV   +NP+C
Sbjct: 36  KPADRSLQKRSKSFE-SKLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFC 94

Query: 116 STKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGT 175
                DT+     + H            TEI                 TP+    ++C  
Sbjct: 95  LGNKLDTN--GTNEFHG-----------TEI-----------------TPI----LDCDK 120

Query: 176 YGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV 235
            G FD   S +  +    FS  Y D +++ G W  D +++ +  V  L FAVAN +++  
Sbjct: 121 IGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQQVPDLQFAVANISSAPS 180

Query: 236 GVLGIGLPGLEST--YSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHG 293
           GVLG+GLP LE+   Y G        +  Y+NFP  LK++  I    YSL+ +  + E G
Sbjct: 181 GVLGVGLPRLEAVRGYDGA------PNANYDNFPQTLKSNRLINRVLYSLYFDSGDLESG 234

Query: 294 TILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTT 353
           T+LFG +D  KY G LYT+P++NI +     +P  F +TLQG+ + +     + T +   
Sbjct: 235 TVLFGGIDEKKYDGVLYTLPLVNIYEQ--IDEPAAFDITLQGLGIRSESNCKD-TVIAHK 291

Query: 354 KIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFH 413
           K PALLDSG+TI   P + +E +A ++GA++S   G YV++C      D T  FDFG   
Sbjct: 292 KAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPAS-NDDRTFYFDFGELK 350

Query: 414 ISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMAN 469
           +   + +     +S  + C L     S    ILGD  L S Y+VYDLDN+EIS+A 
Sbjct: 351 LKVPIHDLLYLPESGQNYCGLAII-ASGEEWILGDLVLKSAYVVYDLDNLEISIAQ 405

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  225 bits (573), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 152/446 (34%), Positives = 225/446 (50%), Gaps = 62/446 (13%)

Query: 77  ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPA 136
           + SFY+  L IG PPQ+ITV+ D+GS+D WV    NP+C +    T++            
Sbjct: 53  DESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSSSNITAN------------ 100

Query: 137 SVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTF-ESNKTKFS 195
                                  TL +      K++C    T+++++S++F E N  +F 
Sbjct: 101 --------------------GLKTLYDGKAIIPKVDCSQIKTYNANRSTSFQELNNGRFY 140

Query: 196 ITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLESTYSGVSL 254
           I YGD TFA G WG +      + +  + F +A+   + + GVLGIG    ES       
Sbjct: 141 IIYGDKTFADGIWGTETFEFGGVKIPNVQFGLADYATTPIGGVLGIGFQRRESV------ 194

Query: 255 SSVQKSYT------YNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGD 308
               K YT      Y NFP VLKN G I + AYSL  +   S H  I+FGA+D   Y GD
Sbjct: 195 ----KGYTNAPEVFYPNFPQVLKNEGIIDTVAYSL--SLGQSSH--IMFGAIDRNSYIGD 246

Query: 309 LYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYL 368
           + T P+IN+   N    P    +T+QG+  A         T +TTK PALLDSG+T+   
Sbjct: 247 MVTFPMINMFP-NAVSKPATLSITIQGLG-AQNKQECKFQTFSTTKYPALLDSGSTLISA 304

Query: 369 PVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSS 428
           PV++ + +A  +GA +S   G Y + C ++   +I  +FDFG    +  LSN  L +   
Sbjct: 305 PVEIADKMAAFIGAQWSESDGIYTLECPNDT-TNIDYIFDFGDMKFTLPLSNLILPSQGG 363

Query: 429 SDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIES--AV 486
           S+VC  G   +SD  ++LGD FL ST +V+DLD+ +IS+A ++   + E I  I S   +
Sbjct: 364 SNVCGFGLQ-RSDNEIVLGDVFLCSTLVVFDLDHYQISLAKSNQKSSAEDIVNIPSDGKI 422

Query: 487 PSALKAPNYSNTWSTYESIVPGGNIF 512
           P A+ A   +  W+TYE I    ++F
Sbjct: 423 PGAIIAK--AEAWTTYEPITATTDMF 446

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  225 bits (574), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/407 (35%), Positives = 215/407 (52%), Gaps = 47/407 (11%)

Query: 70  ELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQ 129
           E +    E  +Y+  LDIGTP Q +TVL DTGS+D WV  S+NP+C     +TS +S   
Sbjct: 34  EFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFC-LPNSNTSSYS--- 89

Query: 130 IHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFES 189
                              + T +  E   ++D          C +  T++  +SST++ 
Sbjct: 90  -------------------NATYNGEEVKPSID----------CRSMSTYNEHRSSTYQY 120

Query: 190 -NKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLES 247
               +F ITY D TFA G+WG + +++N +++  + F VA    + V GVLGIG P  ES
Sbjct: 121 LENGRFYITYADGTFADGSWGTETVSINGIDIPNIQFGVAKYATTPVSGVLGIGFPRRES 180

Query: 248 T--YSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKY 305
              Y G        +  Y NFP +LK+   I   AYSLF N  +S  G+I+FGA+D  K+
Sbjct: 181 VKGYEGA------PNEYYPNFPQILKSEKIIDVVAYSLFLNSPDSGTGSIVFGAIDESKF 234

Query: 306 TGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTI 365
           +GDL+T P++N         P    +T+QG+        ++  T TTTK P LLDSGT++
Sbjct: 235 SGDLFTFPMVNEYPTI-VDAPATLAMTIQGLGAQNKSSCEHE-TFTTTKYPVLLDSGTSL 292

Query: 366 SYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFT 425
              P  + + +A  V ASYS E G Y+++C   V  D+   FDFG   IS  LS+  L  
Sbjct: 293 LNAPKVIADKMASFVNASYSEEEGIYILDCPVSV-GDVEYNFDFGDLQISVPLSSLILSP 351

Query: 426 DSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADF 472
           ++    C     P +D +++LGD FL S Y+V+DLDN +IS+A A++
Sbjct: 352 ETEGSYCGFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQANW 397

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  214 bits (546), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 144/444 (32%), Positives = 229/444 (51%), Gaps = 53/444 (11%)

Query: 77  ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPA 136
           E+ +Y+  LDIGTP Q++TVL DTGS+D W+  S+NP+C +    +S  +          
Sbjct: 41  EDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFCLSTSSTSSYLN---------- 90

Query: 137 SVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFES-NKTKFS 195
                                 AT D + + +  ++C +  T+    SST+++ +  +F 
Sbjct: 91  ----------------------ATYDGS-IITPSVDCQSMVTYSEGNSSTYQNLDNGRFY 127

Query: 196 ITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST--YSGV 252
           I Y D TFA GTWG + ++++ + +  + F +A    + V GVLGIG P  ES   Y G 
Sbjct: 128 IIYADGTFADGTWGTETVSIDGIVIPNIQFGLAKYATTPVSGVLGIGFPRRESVKGYEGA 187

Query: 253 SLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTI 312
                  +  Y NFP +LK+   I   AYSLF N   S  G+I+FGA+D  K++GDL+T 
Sbjct: 188 ------PNKYYPNFPQILKSEQIIDVVAYSLFLNSPESGTGSIIFGAIDESKFSGDLFTF 241

Query: 313 PIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
           P++N   N     P    +T+QG+     +  +  T + TTK P LLDSGT++   P  +
Sbjct: 242 PMVNEYPNI-VDTPATLAMTIQGLGAQNKNSCEYETFM-TTKYPVLLDSGTSLLNAPKVI 299

Query: 373 VELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVC 432
            + +A  V A+YS+E G Y+++C      +I   FDFG   IS  L++  L  ++    C
Sbjct: 300 ADKMASFVNATYSAEEGIYILDC-PAFADEIEYTFDFGDLKISVPLTSLILSPEAEGGYC 358

Query: 433 ILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVI----ESAVPS 488
                P +D +++LGD FL S Y+V+DLDN +IS+A A++  ++    ++    + ++P 
Sbjct: 359 GFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQANWDVSEITTKLVNVRADGSIPG 417

Query: 489 ALKAPNYSNTWSTYESIVPGGNIF 512
              A   +  W+  E      NIF
Sbjct: 418 GKTA--TAEPWTANEPFTVTSNIF 439

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  202 bits (514), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 154/446 (34%), Positives = 215/446 (48%), Gaps = 57/446 (12%)

Query: 78  NSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPAS 137
           + FYS  L+IG+P QK+ ++VD+GS+D WV  S NP+CS+  K  +  ++    K     
Sbjct: 44  DEFYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSGASKNYTYNGK----- 98

Query: 138 VVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFES-NKTKFSI 196
                ITE                         I+C      D + SS F   N  +F I
Sbjct: 99  ----AITET------------------------IDCQGLTALDVNSSSQFRDLNVGRFYI 130

Query: 197 TYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST--YSGVS 253
            Y D +F  G W  D+++    +++GL F VA   +  + G+LG+G P  ES   Y G  
Sbjct: 131 NYTDGSFDDGYWATDEVSAAGAHISGLQFGVAQYASEEIPGILGLGFPRRESVRGYPGA- 189

Query: 254 LSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSN-SEHGTILFGAVDHGKYTGDLYTI 312
                 +  Y+NFP +LK  G I   AYS++ N  N S  G++LFG VD  KY+GDLYT 
Sbjct: 190 -----PNKFYDNFPQMLKKDGIIDVVAYSMYLNDPNGSGGGSVLFGGVDPSKYSGDLYTF 244

Query: 313 PIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
           P+ N   N   K P    VTLQG   A         T  T     LLDSGT++   P ++
Sbjct: 245 PMANQYPNIVSK-PATLAVTLQGFG-AQKKSEGRQETFDTNNYAVLLDSGTSLMGAPEEV 302

Query: 373 VELLADKV--GASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSD 430
           V  +A  +   A +S + G YVM+C  +   D   VFDFG   I+  +S   +   S   
Sbjct: 303 VSKMAHFINKNARFSEDDGIYVMDCPPK-DDDTEFVFDFGDLQIAVPVSTL-ILPPSGES 360

Query: 431 VCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFS-DNDEYIDV---IESAV 486
            C LG  P+ D T  LGD FL   Y+V+DLDN ++SMA A FS D D+   +    +  +
Sbjct: 361 YCGLGVLPK-DGTWTLGDVFLSYAYLVFDLDNYKVSMAKAKFSGDGDQSPQIKIQTDGTI 419

Query: 487 PSALKAPNYSNTWSTYESIVPGGNIF 512
           P A  A   +  WS+ E     G+IF
Sbjct: 420 PGAKSAS--AKPWSSSEPSTVSGSIF 443

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  195 bits (496), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 141/396 (35%), Positives = 198/396 (50%), Gaps = 59/396 (14%)

Query: 78  NSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPAS 137
           N +Y   L+ GTPPQ I +++DTGSSDLWVT   NP C  KG               P  
Sbjct: 50  NLYYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSG------------KPPK 97

Query: 138 VVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNK-TKFSI 196
            +                               I+C     +D  KS TF+  K   F I
Sbjct: 98  CL-------------------------------IDCSGLVFYDMDKSQTFDYLKNVTFKI 126

Query: 197 TYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLESTYSGVSLS 255
            Y D+T+ SG W  D + L   ++  L F +A  TN+T  GVLGIG P +ES    V+  
Sbjct: 127 GYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPAMES----VNGY 182

Query: 256 SVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPII 315
                  Y NFP+ LKN+G    +AYS+  N   S+ G+ILFG++D  ++ G LYT P+I
Sbjct: 183 EFAPGKFYPNFPLALKNAGFTNIAAYSIEYND-ESKKGSILFGSIDTSRFIGPLYTFPMI 241

Query: 316 NILQNNGYKD-PIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVE 374
           N  +  G  D P    +TL GI +   DG      ++ TK+PALLD+G+T+  LP  + +
Sbjct: 242 N--EFPGIADEPSTLSLTLDGIGI---DGSCEQWVISNTKLPALLDTGSTLIELPHPITQ 296

Query: 375 LLADKVGASYSSEYGYYVMNCIHEVKKDIT-VVFDFGGFHISSWLSNFQLFTDSSSD-VC 432
            +A  + A++S ++G +V+ C  +     T + F FG  H+   L +F L  D  S+ +C
Sbjct: 297 SIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFILLPDEESNGLC 356

Query: 433 ILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMA 468
            LG    S   VILGD+FL   Y V+DLDN  IS+A
Sbjct: 357 GLGIT-SSKGRVILGDSFLTHVYTVFDLDNYMISLA 391

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  194 bits (493), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 153/422 (36%), Positives = 212/422 (50%), Gaps = 48/422 (11%)

Query: 57  NAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCS 116
           N     ++R    E+        +YS  L+IGT  Q++ VL D+GSSD+WV+ S+NPYC 
Sbjct: 44  NLSKRKLQRRKSTEIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYCL 103

Query: 117 TKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTY 176
                                  E  + +     T+           TP     I+C   
Sbjct: 104 ES---------------------EGYVNQTYNGETV-----------TPF----IDCKAL 127

Query: 177 GTFDSSKSSTFES-NKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV 235
           GTFD + SS+FE  +  +F I Y D +FA G W  ++L LN ++++ L F VA+     V
Sbjct: 128 GTFDYNGSSSFERLDIGRFYIKYSDESFADGFWAKEKLRLNGIDISTLQFGVADYATVPV 187

Query: 236 G-VLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGT 294
           G VLGIG P  ES    V       +  Y NFP VLKN G I  +AYS+F N+ +S+ G+
Sbjct: 188 GGVLGIGFPRRES----VKGYDDAPNEFYPNFPQVLKNEGVIGVAAYSMFLNEVSSDAGS 243

Query: 295 ILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTK 354
           ILFGAVD  KYTG LYT P++N   N   K P    +TLQ +  A  D      T TTTK
Sbjct: 244 ILFGAVDPTKYTGSLYTFPMVNEYPNVVDK-PATLAMTLQALG-AKSDSSCKYKTFTTTK 301

Query: 355 IPALLDSGTTISYLPVKLVELLADKV-GASYSSEYGYYVMNCIHEVKKDITVVFDFGGFH 413
              LLDSGTT+   P ++ E +A    G +Y+   G +  +C  +   D   +FDFG   
Sbjct: 302 QAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNESEGIFYFDCPSD-DDDTEFIFDFGDLK 360

Query: 414 ISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFS 473
           I+  L++  + + S    C  G  P S  ++ LG  FL S Y+VYDLDN +IS+A A + 
Sbjct: 361 ITLPLASL-VISSSGDGHCGFGLTPASY-SMTLGAIFLSSAYVVYDLDNYQISIAQAKWD 418

Query: 474 DN 475
            N
Sbjct: 419 GN 420

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  189 bits (481), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 134/429 (31%), Positives = 203/429 (47%), Gaps = 53/429 (12%)

Query: 67  DDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFS 126
           D +  + L + +  Y +E+++GTPPQK+  ++DTGS+DLW+   NNP+C           
Sbjct: 32  DGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGA-------- 83

Query: 127 FKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSST 186
                KD    V    +T                          I+C    TF +  S+T
Sbjct: 84  -----KDEKQEVRGVTVTP------------------------SIDCRGIKTFCNESSTT 114

Query: 187 FESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-GVLGIGLPGL 245
                  F I Y D TF  G+W  D+L +   +V+G+ F V   +N+ + GVLG+G   L
Sbjct: 115 LRILPNPFYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGRTSNTELSGVLGVGHANL 173

Query: 246 EST--YSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHG 303
           ES   Y+G        + TY N P  LK  G+++  AYS+   K++   G ILFGA+D  
Sbjct: 174 ESVRGYAGA------PNATYPNLPRQLKLDGSVQKLAYSVSLQKTSERDGEILFGAIDTS 227

Query: 304 KYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGT 363
           KY G L+T PI+NI  +     P  F++ LQGI +  G        L  +   ALLD+GT
Sbjct: 228 KYVGKLHTFPILNI--DPHLNSPSNFYIALQGIDIQGGRS-STGRPLINSSFHALLDTGT 284

Query: 364 TISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQL 423
               +   L E +   + A+Y +E   +V+ C  E        F+FG   I+  +SNF +
Sbjct: 285 G-GMVVSSLAEDIGAALNATYDTEQCVFVIQCPTE-DDTRQFNFNFGELQIAVPISNFVV 342

Query: 424 FTDS-SSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVI 482
                 +  C L   P +  T  LG  FL   Y V++L++ EISMA A+ +  +  I  I
Sbjct: 343 PASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNEISMARANTNPQEPDIRPI 402

Query: 483 ESAVPSALK 491
            + VP+A++
Sbjct: 403 PAGVPAAIR 411

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  183 bits (465), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 131/425 (30%), Positives = 216/425 (50%), Gaps = 60/425 (14%)

Query: 87  IGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEI 146
           +GTP Q I  L+DT SSD+W+  SN+ +C +                      E+    I
Sbjct: 84  VGTPSQAIRFLLDTDSSDIWLLNSNSTFCES----------------------ENGTVNI 121

Query: 147 SYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASG 206
             ++  ++   TA+       S    C     F    SS+F  N   F + Y D ++A+G
Sbjct: 122 DSNSNSTLANETAS------RSDAYQCKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYANG 175

Query: 207 TWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNF 266
           TW  D  +    +   ++ A+ +ETN TVG LG+GL   ++T  G         + YN+ 
Sbjct: 176 TWSQDTFSFGYPSFYNVNIALVSETNLTVGSLGLGLRANQATNQG------DDPFVYNSL 229

Query: 267 PMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGD-LYTIPIINILQNNGYKD 325
              LK  G I+  AYS+++++ N   G I FG + H  Y G+ LYT+P++N+  +    +
Sbjct: 230 LYRLKTQGWIEKIAYSVYTSELNGTGGGIFFGGLYHDLYKGNVLYTLPLVNV--DPELDE 287

Query: 326 PIQFHVTLQGIAVATGDGMDNATTLT--TTKIPALLDSGTTISYLPVKLVELLADKVGAS 383
           P +FH+TLQ +  +      N T  +  + K PALL +G+  +YLP +L +   D++   
Sbjct: 288 PARFHITLQNLTTSI-----NGTNFSVLSEKYPALLSTGSMFTYLPEELFDSFVDEMDLE 342

Query: 384 YSSEYG-YYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDS---SSDVCILGFAPQ 439
             +++   YV+ C      + T ++DFGGF I + LS +    +S   + D+C +   P 
Sbjct: 343 KGAKHKDLYVIPC----DTNATFIYDFGGFEIETPLSGYTFKVESNRTADDMCAVMVKPH 398

Query: 440 SDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDV-----IESAVPSALKAPN 494
           +   + LG+ F  +TY++++L+++EISMA A      EY+D      IES++PSA +A +
Sbjct: 399 NKSYLTLGNGFFAATYVLFNLEDLEISMAPA---SGIEYLDAFDYEYIESSIPSASRAAS 455

Query: 495 YSNTW 499
           YSNTW
Sbjct: 456 YSNTW 460

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  166 bits (420), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 132/232 (56%), Gaps = 9/232 (3%)

Query: 268 MVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPI 327
           M LK+ G I+  AYSLF N+  +  G+ILFGAVD  KY+G LYT+P++          P 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 328 QFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSE 387
            F VT Q +AV  GD  +   T++  + P L DSGTT S LP ++   +       YSS 
Sbjct: 61  MF-VTAQSVAVLNGDSGNK--TVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSG 117

Query: 388 YGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILG 447
              Y  +C     KD  +  DFGGF+IS+ +SNF      + D C+L     +D   +LG
Sbjct: 118 DQGYTFDC--SKVKDTLLSIDFGGFNISANISNF---VTRTKDHCLLNIE-AADSGFVLG 171

Query: 448 DNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTW 499
           D FLV  Y+V+DL++ E+S+A A F D  E I+VI   VP A++AP YS+TW
Sbjct: 172 DAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW 223

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  160 bits (406), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 166/354 (46%), Gaps = 58/354 (16%)

Query: 48  SFENASNDRNAGAHLVRREDDYELVKLTNE---NSFYSVELDIGTPPQKITVLVDTGSSD 104
           S EN     N   H  R  D++  ++L  +     FYS  L  G P Q +TVLVDTGSSD
Sbjct: 29  SSENNFRSSNNNVHYSRSYDNHNYLELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSD 88

Query: 105 LWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNT 164
           LWV+  NN YC   GK+T+                                         
Sbjct: 89  LWVSSPNNIYCYEDGKNTN----------------------------------------- 107

Query: 165 PLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLS 224
              +  INC  +GT+   KSST      +  I YGD +FA G W  D L +   ++  + 
Sbjct: 108 --INHSINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQ 165

Query: 225 FAVANETNSTV-GVLGIGLPGLEST--YSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAY 281
           F ++N  ++ + GVLG+G    ES   Y G        +  Y N P  LK+     ++A+
Sbjct: 166 FGISNNASTIISGVLGLGFLRTESIDGYDG------SPNKLYYNLPAYLKDQEITNTNAF 219

Query: 282 SLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATG 341
           SLF N SN   GT+LFG +D+ K++GDL T P++NI       +P  F +TLQ +     
Sbjct: 220 SLFLNNSNDASGTVLFGGIDYSKFSGDLVTFPLVNIYP-KLINEPCTFTITLQQLYGKIN 278

Query: 342 DGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC 395
            G   +  L   K+PALLDSG+++  +P+++ + +A  V ++  +    + +NC
Sbjct: 279 GG--KSIGLIKEKVPALLDSGSSLISMPIEITDEIALMVNSTLDTMTSLHNINC 330

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  139 bits (351), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 121/213 (56%), Gaps = 10/213 (4%)

Query: 261 YTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQN 320
           Y Y+NFPM LK  G I+  AYSLF N+ N+  G+ILFGAVD  KY+G LYT+P++     
Sbjct: 21  YVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYSGQLYTLPMLKAY-- 78

Query: 321 NGYKDPIQFHVTLQGIA---VATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLA 377
           N         +T Q +A   VA  D      T++  + P L DSGT+ S LP ++ + + 
Sbjct: 79  NTLDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVLFDSGTSTSALPTEIADAIG 138

Query: 378 DKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFA 437
                 YSS+   Y+ +C  +V   +  + DFGGF+IS+ +SN    T  + D C+L   
Sbjct: 139 RSFDGKYSSDNQGYIFDC-SKVNNTLLSI-DFGGFNISANISN--SVTPITKDHCLLNIE 194

Query: 438 PQSDPTVILGDNFLVSTYIVYDLDNMEISMANA 470
              D   +LGD FL+ TY+V+DL++ E+S+A A
Sbjct: 195 AD-DSGYVLGDAFLIDTYVVFDLESHEVSVAQA 226

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  134 bits (336), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 118/426 (27%), Positives = 188/426 (44%), Gaps = 78/426 (18%)

Query: 77  ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPA 136
           ++S+Y   + IG PPQ I VLVDTGSSDLWV   NNP C     D + F+F         
Sbjct: 27  DDSYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGNIDCTGFTF--------- 77

Query: 137 SVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFES--NKTKF 194
                                                     F+ S S TF +    + F
Sbjct: 78  ------------------------------------------FNKSNSKTFSNIYKNSIF 95

Query: 195 SITYGDSTFASGTWGHDQLNLNN------------LNVTGLSFAVANETNSTV-GVLGIG 241
            I Y D+++  G WG D +++N+             N+    FA+A  +N  V  VLG+G
Sbjct: 96  QIGYQDASYTFGKWGVDSISINSSYSDSNEDTGLYANIPNAQFAIATNSNVPVQAVLGLG 155

Query: 242 LPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVD 301
            P  E+  +G  L++ +    Y N P ++K  G   +   +++   SN  + +I+FGA D
Sbjct: 156 FPRREAV-NGYKLATNK---FYPNLPQLIKQHGYSDNVTIAMYL-GSNETYNSIMFGAYD 210

Query: 302 HGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGM-DNATTLTTTKIPALLD 360
             +Y GDL+  P++N   N   K P  F +TL  + ++  +   DN       K   +LD
Sbjct: 211 KTRYIGDLHNFPMVNQYPNVTDK-PATFAITLDSMYISMDNNQSDNIYISNDEKYSVVLD 269

Query: 361 SGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVK--KDITVVFDFGGFHISSWL 418
           SGT++   P   V  +A  + A++ +    Y++    ++   KD+ + F F  F++   +
Sbjct: 270 SGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMIINFKFMDFNVPINM 329

Query: 419 SNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEIS--MANADFSDND 476
             F L  D S    IL      +   +LGD FL   Y +++LDN  IS  ++N + + N+
Sbjct: 330 LEFILPYDDSYVFAILP-TKNVNTGFVLGDIFLPHVYTIFNLDNYTISLGLSNQNITSNE 388

Query: 477 EYIDVI 482
             I  I
Sbjct: 389 REITWI 394

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 110/445 (24%), Positives = 183/445 (41%), Gaps = 99/445 (22%)

Query: 38  IMNFEKKYGDS-FENASNDRNAGAHLVRREDDYELVKLTNE-NSFYSVELDIGTPPQKIT 95
           +  F+K Y ++ F+N  +D ++  +          V LTN  N+ Y  E+ +GTPPQ   
Sbjct: 60  LTQFQKAYPEAVFKNDHDDESSSYYPFGFYQSGHSVPLTNYLNAQYYTEVSLGTPPQNFK 119

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           V++DTGSS+LWV  +    CS+                                      
Sbjct: 120 VILDTGSSNLWVPSTE---CSS-------------------------------------- 138

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                          + C  +  +D   SS+++ N T+F+I YG  +   G    D LNL
Sbjct: 139 ---------------LACFLHSKYDHDSSSSYKPNGTEFAIRYGSGSL-EGYISQDTLNL 182

Query: 216 NNLNVTGLSFAVANETNSTV-------GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPM 268
            +L++T   FA A              G+LG+G       Y  +S+  V   + YN +  
Sbjct: 183 GDLSITKQDFAEATSEPGLQFAFGKFDGILGLG-------YDTISVDGVVPPF-YNAWKQ 234

Query: 269 VLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQ 328
            L +       A+ L  +  + + G   FG VD  KY G++  +PI         +    
Sbjct: 235 GLLDEPKF---AFYLGRDGESQDGGVATFGGVDDSKYEGEITWLPI---------RRKAY 282

Query: 329 FHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEY 388
           + V   GI +    G + A         A +D+GT++  LP  L E++  ++GA   S  
Sbjct: 283 WEVKFDGIGL----GEEYAELENHG---AAIDTGTSLIALPSGLAEIINAEIGAK-KSWT 334

Query: 389 GYYVMNCIHEVKKDI-TVVFDFGG--FHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVI 445
           G Y + C  E +  +  + F  GG  F ++++    ++     S +  + F     P  I
Sbjct: 335 GQYTVEC--EARSSLPNMTFTLGGHNFELTAYDYILEVSGQCISAIFPMDFPEPVGPLAI 392

Query: 446 LGDNFLVSTYIVYDLDNMEISMANA 470
           +GD+FL   Y +YDL N  + +A+A
Sbjct: 393 IGDSFLRKYYSIYDLGNNAVGLADA 417

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 96.7 bits (239), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 112/439 (25%), Positives = 179/439 (40%), Gaps = 86/439 (19%)

Query: 38  IMNFEKKYGDSFENASNDRN-AGAHLVRREDDYELVKLTNE-NSFYSVELDIGTPPQKIT 95
           I +   KY + FE A+ + + +  H    E D   V LTN  N+ Y  ++ +GTPPQ   
Sbjct: 47  IASLGHKYMNHFERANPEVSFSRDHPFFAEGDGHNVPLTNYLNAQYFADISVGTPPQNFK 106

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           V++DT        GS+N +                    P+S   S              
Sbjct: 107 VILDT--------GSSNLWV-------------------PSSECNS-------------- 125

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                          + C  +  +D   SS++++N TKF+I YG  +   G    D LN+
Sbjct: 126 ---------------LACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNI 169

Query: 216 NNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNS 273
            +L +    FA A          G   G+ GL   Y  +S+  V   + YN     L + 
Sbjct: 170 GDLTIPKQDFAEATSEPGLTFAFGKFDGILGL--AYDTISVDKVVPPF-YNAIEQGLLDE 226

Query: 274 GAIKSSAYSLFSNKSNSEHG-TILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVT 332
              K  A+ L   K + ++G  I  G +D  K+ GD+  +P+    +   Y     + V 
Sbjct: 227 ---KKFAFYLGDTKKDEKNGGEITIGGIDESKFKGDIEWLPV----RRKAY-----WEVK 274

Query: 333 LQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYV 392
            +GIA+      D    L      A +D+GT++  LP  L E++  ++GA      G Y 
Sbjct: 275 FEGIALG-----DQYAALENHG--AAIDTGTSLITLPSGLAEIINTEIGAK-KGWTGQYT 326

Query: 393 MNC-IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFL 451
           ++C   +   D+T  F+   F IS +    ++     S +  + F     P  I+GD FL
Sbjct: 327 LDCDTRDGLPDLTFNFNGKNFTISPFDYTLEVSGSCISAIMPMDFPEPMGPMAIVGDAFL 386

Query: 452 VSTYIVYDLDNMEISMANA 470
              Y +YDLDN  + +A A
Sbjct: 387 RKYYSIYDLDNHAVGLAEA 405

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 100/175 (57%), Gaps = 9/175 (5%)

Query: 331 VTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGY 390
           +T+QG+         + T +TT K P LLDSGT++   P  + + +A  V ASYS++ G 
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTT-KYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGI 59

Query: 391 YVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNF 450
           Y+++C  E   D+   FDFG   I+  L++  L  ++    C     P +D +++LGD F
Sbjct: 60  YILDC-PESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTND-SMVLGDVF 117

Query: 451 LVSTYIVYDLDNMEISMANADF---SDNDEYIDV-IESAVPSALKAPNYSNTWST 501
           L S Y+V+DLDN +IS+A A++   +D+ + +++  + ++PS   A   +  WST
Sbjct: 118 LSSAYVVFDLDNYKISLAQANWNASNDSKQLVNIPTDGSIPSGKSA--TAQPWST 170

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 91.3 bits (225), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 103/189 (54%), Gaps = 33/189 (17%)

Query: 81  YSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVE 140
           Y VE+ IGTPPQ   + +DTGSSD+ V  +++ +C +   D +                 
Sbjct: 94  YVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKSLADDNN----------------- 136

Query: 141 SVITEISYDTTISVIEATATLDNTPLAS--QKINCGTYGTFDSSKSSTFESNKTKFSITY 198
             I   +Y+ T +   AT TL +TPL S     +C  +GTF+ + SSTF+ N+T F +TY
Sbjct: 137 --IWTSNYELTAT---ATETL-STPLPSVHHITSCSYWGTFNPNISSTFKYNETIFDLTY 190

Query: 199 GDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGV-SLSSV 257
           G       T+G D ++L N+ ++  +F V+N+T  + G+LGI LP  E T  G  +LSS 
Sbjct: 191 G-------TYGTDVVSLGNITLSNYTFGVSNDTTMSYGILGISLPSEEITDRGQDALSSN 243

Query: 258 QKSYTYNNF 266
           +  + Y+NF
Sbjct: 244 KTPFAYDNF 252

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 164/400 (41%), Gaps = 89/400 (22%)

Query: 78  NSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPAS 137
           N+ Y  ++ +GTP Q   V++DTGSS+LWV                              
Sbjct: 101 NAQYYTDISLGTPKQNFKVILDTGSSNLWV------------------------------ 130

Query: 138 VVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSIT 197
                                 + D T LA     C  +  +D  +S+T+E N TKF+I 
Sbjct: 131 ---------------------PSKDCTSLA-----CYLHSKYDHDESTTYEKNGTKFTIQ 164

Query: 198 YGDSTFASGTWGHDQLNL-NNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSL 254
           YG  +   G    D L + ++L +    FA A          G   G+ GL   Y  +++
Sbjct: 165 YGSGSM-DGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGL--AYDTIAV 221

Query: 255 SSVQKSYTYNNFPMVLKNSGAIKSSAYSLF---SNKSNSEHGTILFGAVDHGKYTGDLYT 311
           + V   + YN         G +  + ++ +   +NK N   G   FG  D  K+TGD+  
Sbjct: 222 NKVVPPF-YNAI-----KQGILDENKFAFYLGDTNKDNKSGGEATFGGYDKSKFTGDITW 275

Query: 312 IPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVK 371
           +P+    +   Y + ++F     G  VA+ DG             A +D+GT++  LP  
Sbjct: 276 LPV----RRKAYWE-VKFDSIALGDEVASLDGYG-----------AAIDTGTSLITLPSG 319

Query: 372 LVELLADKVGASYSSEYGYYVMNC-IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSD 430
           L E++  ++GA  S   G Y ++C   +   D+T  F+   F +S +    ++     S 
Sbjct: 320 LAEVINTQIGAKKSWS-GQYTIDCDTRDALPDMTFNFNGYNFTVSPYDYTLEMSGSCISA 378

Query: 431 VCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANA 470
           +  + F     P  I+GD FL   Y +YDLDN  + +A +
Sbjct: 379 ITPMDFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLAKS 418

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 101/180 (56%), Gaps = 9/180 (5%)

Query: 326 PIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYS 385
           P    +T+QG+         + T +TT K P LLDSGT++   P  + + +A  V ASYS
Sbjct: 206 PATLAMTIQGLGAQNKSSCQHETFMTT-KYPVLLDSGTSLLNAPKSIADKMASFVNASYS 264

Query: 386 SEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVI 445
           ++ G Y+++C  E   D+   FDFG   I+  L++  L  ++    C     P +D +++
Sbjct: 265 ADEGIYILDC-PESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTND-SMV 322

Query: 446 LGDNFLVSTYIVYDLDNMEISMANADF---SDNDEYIDV-IESAVPSALKAPNYSNTWST 501
           LGD FL S Y+V+DLDN +IS+A A++   +D+ + +++  + ++PS   A   +  WST
Sbjct: 323 LGDVFLSSAYVVFDLDNYKISLAQANWNASNDSKQLVNIPTDGSIPSGKSA--TAQPWST 380

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 108/446 (24%), Positives = 182/446 (40%), Gaps = 92/446 (20%)

Query: 38  IMNFEKKYGDSFENASNDRNAGAHLV----RREDDYELVK-----LTNE-NSFYSVELDI 87
           + +  +KY + +E A  + +   H        +D +E+ K     L+N  N+ Y  ++ +
Sbjct: 48  VQHLGQKYLNQYEKAFPEVSFSKHHPFFKGSAQDSFEVAKGHEVPLSNYLNAQYYTDITL 107

Query: 88  GTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEIS 147
           GTPPQ+  V++DT        GS+N +                    P+S   S      
Sbjct: 108 GTPPQQFKVILDT--------GSSNLWV-------------------PSSECGS------ 134

Query: 148 YDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGT 207
                                  + C  +  +D S SS++++N T FSI YG  +   G 
Sbjct: 135 -----------------------LACFLHEKYDHSASSSYKANGTDFSIQYGSGSL-EGY 170

Query: 208 WGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNN 265
              D L++ +L +    FA A          G   G+ GL   Y  +S+  V   + YN 
Sbjct: 171 ISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGL--AYDTISVDKVVPPF-YNA 227

Query: 266 FPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKD 325
               L +    K + Y   +NK   + G  +FG VD  KYTGD+  +P+    +   Y  
Sbjct: 228 LEQDLLDEA--KFAFYLGDTNKDAEDGGEAIFGGVDKSKYTGDVTWLPV----RRKAY-- 279

Query: 326 PIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYS 385
              + V L+G+ +      D    L +    A +D+GT++  LP  L E++  ++GA   
Sbjct: 280 ---WEVKLEGLGLG-----DEYAELESHG--AAIDTGTSLITLPSGLAEIINSEIGAK-K 328

Query: 386 SEYGYYVMNC-IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTV 444
              G Y + C   +   D+T  F+   F I  +    ++     S +  + F     P  
Sbjct: 329 GWTGQYTLECNTRDQLPDLTFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLA 388

Query: 445 ILGDNFLVSTYIVYDLDNMEISMANA 470
           I+GD FL   Y +YDL++  + +A A
Sbjct: 389 IVGDAFLRKYYSIYDLEHNAVGLAKA 414

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 114/464 (24%), Positives = 180/464 (38%), Gaps = 125/464 (26%)

Query: 38  IMNFEKKYGDSFENASNDRNAGAH------LVRREDDY------ELVKLTNE-NSFYSVE 84
           + N  +KY   F  A  + +  +H      L   E D         V L+N  N+ Y  E
Sbjct: 47  VANLHQKYLSQFSKAYPEVDFASHAGSGIGLGAVEQDVLSAMGGHDVPLSNYLNAQYFTE 106

Query: 85  LDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVIT 144
           + +GTPPQ   V++DTGSS+LWV                         D   S+   + +
Sbjct: 107 ITLGTPPQSFKVILDTGSSNLWVP-----------------------SDECGSLACFLHS 143

Query: 145 EISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFA 204
           + S+D + S                                 +++N T F+I YG  +  
Sbjct: 144 KYSHDASSS---------------------------------YKANGTNFAIQYGSGSL- 169

Query: 205 SGTWGHDQLNLNNLNVTGLSFAVANETNSTV-------GVLGIGLPGLESTYSGVSLSSV 257
            G    D L++ +L +    FA A              G+LG+G       Y  +++  V
Sbjct: 170 EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLG-------YDTIAVDKV 222

Query: 258 QKSYTYNNFPMVLK--NSGAIKSSAYSLF-SNKSNSEH--GTILFGAVDHGKYTGDLYTI 312
                    P V K  N G +    ++ + +N  +SE   G + FG +D  KY G++  +
Sbjct: 223 --------VPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKYKGNITWL 274

Query: 313 PIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
           P+         +    + V   GI +      D    L  T   A +D+GT++  LP  L
Sbjct: 275 PV---------RRKAYWEVKFDGIGLG-----DEYAELEGTG--AAIDTGTSLIALPSGL 318

Query: 373 VELLADKVGASYSSEYGYYVMNC-IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDV 431
            E+L  ++GA      G Y ++C   +   D+T  F+   F IS++    ++     S  
Sbjct: 319 AEVLNAEIGAK-KGWSGQYTVDCESRDQLPDLTFTFNGKNFTISAYDYTLEV-----SGS 372

Query: 432 CILGFAPQS-----DPTVILGDNFLVSTYIVYDLDNMEISMANA 470
           CI  F P        P  I+GD FL   Y VYDL N  + +A A
Sbjct: 373 CISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQA 416

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 131/303 (43%), Gaps = 26/303 (8%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANE 230
           + C  +  +D  KSS+++ N T F+I YG  +   G    D LN+ +LN+    FA A  
Sbjct: 128 LACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSL-EGYISQDTLNIGDLNIPKQDFAEATS 186

Query: 231 TNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKS 288
                   G   G+ GL   Y  +S++ V   + YN     L +    K + Y   +NK 
Sbjct: 187 EPGLTFAFGKFDGILGL--AYDSISVNKVVPPF-YNAIEQELLDEK--KFAFYLGDANKK 241

Query: 289 NSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNAT 348
           + + G I  G +D  K+ GD+  +P+         +    + V  +GI +      D   
Sbjct: 242 SEDGGEITIGGIDKTKFKGDIDWLPV---------RRKAYWEVKFEGIGLG-----DQFA 287

Query: 349 TLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVK-KDITVVF 407
            L      A +D+GT++  LP  L E++  ++GA      G Y + C       D+T  F
Sbjct: 288 ELENHG--AAIDTGTSLIALPSGLAEIINTEIGAK-KGWTGQYTVECDARPNLPDLTFNF 344

Query: 408 DFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISM 467
           +   F I  +    ++     S +  + F     P  I+GD FL   Y +YDL+N  + +
Sbjct: 345 NGKNFTIGPYDYTLEVSGSCISAIMPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAVGL 404

Query: 468 ANA 470
           A A
Sbjct: 405 AEA 407

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (76%)

Query: 78  NSFYSVELDIGTPPQKITVLVDTGSSDLWV 107
           N+ Y  ++ +GTPPQ   V++DTGSS+LWV
Sbjct: 91  NAQYFADITLGTPPQSFKVILDTGSSNLWV 120

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 147/351 (41%), Gaps = 61/351 (17%)

Query: 143 ITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSK-----SSTFESNKTKFSIT 197
            TEIS  T     +      ++ L      CG+   F  SK     SS++++N T F+I 
Sbjct: 99  FTEISLGTPPQSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTSFAIQ 158

Query: 198 YGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV-------GVLGIGLPGLESTYS 250
           YG  +   G    D L++ +L +    FA A              G+LG+G       Y 
Sbjct: 159 YGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLG-------YD 210

Query: 251 GVSLSSVQKSYTYNNFPMVLK--NSGAIKSSAYSLF-SNKSNSEH--GTILFGAVDHGKY 305
            +S+  V         P V K  N G +    ++ + +N  +SE   G + FG +D  KY
Sbjct: 211 TISVDKV--------VPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKY 262

Query: 306 TGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTI 365
            GD+  +P+    +   Y     + V   GI +      D    L  T   A +D+GT++
Sbjct: 263 KGDITWLPV----RRKAY-----WEVKFDGIGLG-----DEYAELQGTG--AAIDTGTSL 306

Query: 366 SYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKKDITVVFDFGGFHISSWLSNFQLF 424
             LP  L E+L  ++GA      G Y ++C   +   D+T  F+   F I+++    ++ 
Sbjct: 307 IALPSGLAEVLNSEIGAK-KGWTGQYTVDCESRDQLPDLTFTFNGKNFTITAYDYTLEV- 364

Query: 425 TDSSSDVCILGFAPQS-----DPTVILGDNFLVSTYIVYDLDNMEISMANA 470
               S  CI  F P        P  I+GD FL   Y +YDL N  + +A A
Sbjct: 365 ----SGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLGNNAVGLAQA 411

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 166/418 (39%), Gaps = 90/418 (21%)

Query: 60  AHLVRREDDYELVKLTN-ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTK 118
           + +V +   +E V L+N  N+ Y  ++ IGTPPQ   V++DT        GS+N +  +K
Sbjct: 78  SEIVSKNGGHE-VPLSNYMNAQYFADIKIGTPPQSFKVVLDT--------GSSNLWVPSK 128

Query: 119 GKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGT 178
                                                               + C  +  
Sbjct: 129 ------------------------------------------------ECGSLACYLHSK 140

Query: 179 FDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVL 238
           ++  +SST+++N + F+I YG  +   G    D + + +L +T   FA A          
Sbjct: 141 YNHDESSTYKANGSAFAIQYGSGSL-EGYISQDVMEIGDLKITKQDFAEATSEPGISFAF 199

Query: 239 GI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLF---SNKSNSEHG 293
           G   G+ GL   Y  ++++ V     YN       N G +    ++ +   ++KS    G
Sbjct: 200 GKFDGILGL--AYDTIAVNRVVPP-VYNAI-----NQGLLDEPKFAFYLGDASKSKDNGG 251

Query: 294 TILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTT 353
             +FG +D  K+ GD+  +P+         +    + V L+G+ +      +  T L   
Sbjct: 252 EAVFGGIDETKFEGDITWLPV---------RRKAYWEVKLEGLGLG-----EEYTELENH 297

Query: 354 KIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVK-KDITVVFDFGGF 412
              A +D+GT++  LP  L E++  ++GA      G Y + C       D+T  FD   F
Sbjct: 298 G--AAIDTGTSLITLPSGLAEIINSEIGAK-KGWTGQYTIECDKRASLPDMTFTFDGYNF 354

Query: 413 HISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANA 470
            IS +    ++     S +  + F     P  I+GD FL   Y VYDL N  + +A A
Sbjct: 355 TISPYDYTLEVSGSCISAITPMDFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLAPA 412

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 75.9 bits (185), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 173 CGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETN 232
           C  +GTF +  SSTF+ N T+F  TYGD T+  GT+G D ++L N+ +   SF VAN T 
Sbjct: 30  CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTE 89

Query: 233 STVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFP 267
           +  G+LGI LP  E+T+S +  +     + Y NFP
Sbjct: 90  NQGGILGISLPAGENTHS-LGGAYNTTPFEYENFP 123

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 136/305 (44%), Gaps = 31/305 (10%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANE 230
           + C  +  +D S SST++ N T FSI YG  +   G    D L + +L + G  FA A  
Sbjct: 123 LACYLHAKYDHSDSSTYKKNGTTFSIQYGSGSM-EGYISQDVLQIGDLVIPGQDFAEATS 181

Query: 231 TNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLF--SN 286
                   G   G+ GL   Y  ++++ V   + YN       N   +    +S +   +
Sbjct: 182 EPGLAFAFGKFDGILGL--AYDTIAVNRVVPPF-YNAI-----NKKLVDEPIFSFYLGDD 233

Query: 287 KSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDN 346
             + + G + FG  D   +TGD+  +P+    +   Y + ++F     G  VA  D +++
Sbjct: 234 TKSEDGGQVTFGGYDSSLFTGDITWLPV----RRKAYWE-VKFDAIALGNEVA--DLVNH 286

Query: 347 ATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKKDITV 405
                     A +D+GT++  LP  L E++  ++GA  S   G ++++C   +   D+T 
Sbjct: 287 G---------AAIDTGTSLITLPSGLAEVINSQIGAKKSWS-GQWIVDCKTRDTLPDMTF 336

Query: 406 VFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEI 465
            FD   F I+ +    ++     S +  + F     P  I+GD FL   Y +YD+ N  +
Sbjct: 337 TFDGYNFTITPYDYTLEVSGSCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAV 396

Query: 466 SMANA 470
            +A A
Sbjct: 397 GLAAA 401

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 78  NSFYSVELDIGTPPQKITVLVDTGSSDLWV 107
           N+ Y  ++ +GTP Q   V++DTGSS+LWV
Sbjct: 86  NAQYYTDITLGTPAQSFKVILDTGSSNLWV 115

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 141/311 (45%), Gaps = 42/311 (13%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVA-N 229
           + C  +  +D   SS++++N T+F+I YG  +   G    D L++ +L +    FA A +
Sbjct: 125 LACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATS 183

Query: 230 ETNSTV------GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSL 283
           E   T       G+LG+G       Y  +S+  V   + YN     L +    K  A+ L
Sbjct: 184 EPGLTFAFGKFDGILGLG-------YDTISVDKVVPPF-YNAIQQDLLDE---KRFAFYL 232

Query: 284 FSNKSNSEHG-TILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGD 342
                ++E+G    FG +D  K+ GD+  +P+         +    + V  +GI +    
Sbjct: 233 GDTSKDTENGGEATFGGIDESKFKGDITWLPV---------RRKAYWEVKFEGIGLG--- 280

Query: 343 GMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKD 402
             D    L +    A +D+GT++  LP  L E++  ++GA      G Y ++C    + +
Sbjct: 281 --DEYAELESHG--AAIDTGTSLITLPSGLAEMINAEIGAK-KGWTGQYTLDC--NTRDN 333

Query: 403 IT-VVFDFGGFHISSWLSNFQLFTDSS--SDVCILGFAPQSDPTVILGDNFLVSTYIVYD 459
           +  ++F+F G++ +    ++ L    S  S +  + F     P  I+GD FL   Y +YD
Sbjct: 334 LPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYD 393

Query: 460 LDNMEISMANA 470
           L N  + +A A
Sbjct: 394 LGNNAVGLAKA 404

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 140/311 (45%), Gaps = 42/311 (13%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVA-N 229
           + C  +  +D   SS++++N T+F+I YG  +   G    D L++ +L +    FA A +
Sbjct: 125 LACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATS 183

Query: 230 ETNSTV------GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSL 283
           E   T       G+LG+G       Y  +S+  V   + YN     L +    K  A+ L
Sbjct: 184 EPGLTFAFGKFDGILGLG-------YDTISVDKVVPPF-YNAIQQDLLDE---KKFAFYL 232

Query: 284 FSNKSNSEHG-TILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGD 342
                +SE+G    FG +D  K+ GD+  +P+         +    + V  +GI +    
Sbjct: 233 GDTSKDSENGGEATFGGIDESKFKGDITWLPV---------RRKAYWEVKFEGIGLG--- 280

Query: 343 GMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKK 401
             D    L +    A +D+GT++  LP  L E++  ++GA      G Y ++C   +   
Sbjct: 281 --DEYAELESHG--AAIDTGTSLITLPSGLAEMINAELGAK-KGWTGQYTLDCNTRDSLP 335

Query: 402 DITVVFDFGGFHISSWLSNFQLFTDSS--SDVCILGFAPQSDPTVILGDNFLVSTYIVYD 459
           D+  +F+F G++ +    ++ L    S  S +  + F     P  I+GD FL   Y +YD
Sbjct: 336 DL--IFNFNGYNYTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYD 393

Query: 460 LDNMEISMANA 470
           L N  + +A A
Sbjct: 394 LGNNAVGLAKA 404

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 139/311 (44%), Gaps = 42/311 (13%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVA-N 229
           + C  +  +D   SS++++N T+F+I YG  +   G    D L++ +L +    FA A +
Sbjct: 125 LACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATS 183

Query: 230 ETNSTV------GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSL 283
           E   T       G+LG+G       Y  +S+  V   + YN     L +    K  A+ L
Sbjct: 184 EPGLTFAFGKFDGILGLG-------YDTISVDKVVPPF-YNAIQQDLLDE---KKFAFYL 232

Query: 284 FSNKSNSEHG-TILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGD 342
                +SE+G    FG +D  K+ GD+  +P+         +    + V  +GI +    
Sbjct: 233 GDTSKDSENGGEATFGGIDESKFKGDITWLPV---------RRKAYWEVKFEGIGLG--- 280

Query: 343 GMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKK 401
             D    L      A +D+GT++  LP  L E++  ++GA      G Y ++C   +   
Sbjct: 281 --DEYAELEGHG--AAIDTGTSLITLPSGLAEMINAELGAK-KGWTGQYTLDCNTRDSLP 335

Query: 402 DITVVFDFGGFHISSWLSNFQLFTDSS--SDVCILGFAPQSDPTVILGDNFLVSTYIVYD 459
           D+  +F+F G++ +    ++ L    S  S +  + F     P  I+GD FL   Y +YD
Sbjct: 336 DL--IFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYD 393

Query: 460 LDNMEISMANA 470
           L N  + +A A
Sbjct: 394 LGNDAVGLAKA 404

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 80/309 (25%), Positives = 135/309 (43%), Gaps = 38/309 (12%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVA-N 229
           + C  +  +D   SS+++ N T+F+I YG  +   G    D L++ +L +    FA A +
Sbjct: 126 LACFLHSKYDHEASSSYKPNGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATS 184

Query: 230 ETNSTV------GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSL 283
           E   T       G+LG+G       Y  +S+  V   + YN     L +    K  A+ L
Sbjct: 185 EPGLTFAFGKFDGILGLG-------YDTISVDKVVPPF-YNAIQQDLLDE---KKFAFYL 233

Query: 284 FSNKSNSEHG-TILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGD 342
                +SE+G    FG +D  K+ GD+  +P+         +    + V  +GI +    
Sbjct: 234 GDTSKDSENGGEATFGGIDKSKFKGDVTWLPV---------RRKAYWEVKFEGIGL---- 280

Query: 343 GMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKK 401
           G + A         A +D+GT++  LP  L E++  ++GA      G Y ++C   +   
Sbjct: 281 GHEFAELEGHG---AAIDTGTSLITLPSGLAEMINAEIGAKKGWS-GQYALDCNTRDGLP 336

Query: 402 DITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLD 461
           D+T  F+   F I  +    ++     S +  + F     P  I+GD FL   Y +YDL 
Sbjct: 337 DLTFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLG 396

Query: 462 NMEISMANA 470
           N  + +A A
Sbjct: 397 NDAVGLAEA 405

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 114/444 (25%), Positives = 191/444 (43%), Gaps = 76/444 (17%)

Query: 62  LVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLW-VTGSNNPYCSTKGK 120
           L    D   +V  ++ +  Y V    GTP Q+  + +D     +W V+G   P C+  G 
Sbjct: 18  LAADADTPSVVVGSDYSGLYYVNSTFGTPGQEQRLRIDLSQPYIWLVSGEIYPQCNKLGS 77

Query: 121 DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD 180
              + S     +   +++V+     + +   IS I  T   DN                 
Sbjct: 78  GCLNGSLYYPLQSTTSNLVDDDYIRLQFLDLIS-INGTKYRDNM---------------- 120

Query: 181 SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNN-----LNVTGLSFAVANETNSTV 235
                    N T+       ST  +GT  +D   L N     L +   SF +ANET S V
Sbjct: 121 ---------NFTQL------STLKNGTSLNDSNVLWNETQGWLTINSTSFILANETGSLV 165

Query: 236 -GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEH-- 292
            G LG+  P        VS  +   SY    F   LKN+G I++S+YSL+ N +++    
Sbjct: 166 HGALGLSGPISVPASDSVSSLNFDDSYY---FLTHLKNAGVIETSSYSLWVNNASNHSVD 222

Query: 293 --------GTILFGAVDHGKYTGDLY---TIPIINILQNNGYKDPIQFHVTLQGIAVATG 341
                   GT+L G+VD   Y GDL    +IP  +  +++GY       V +  +++A  
Sbjct: 223 GQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKD--ESSGYLSTGYPIVPMSRVSIANS 280

Query: 342 DGMDNATTLTTTKI--PALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHE 398
           +    A  LT +    P  + S    SYLP+ L+  ++ +  A Y      +++ C I +
Sbjct: 281 E--QEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSIQTNAVYVESLDRWLVACDIGD 338

Query: 399 VKKDITVVFDFGGFHISSWLSNF-----QLFTDSS------SDVCILGFAPQSDPTV-IL 446
           +  ++  +F+FG  +IS    +F      ++++SS       + C L   P    +  +L
Sbjct: 339 MGSNL--IFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEACYLKMYPNYATSFSVL 396

Query: 447 GDNFLVSTYIVYDLDNMEISMANA 470
           G +F+ + YIV+D+DN  I++A A
Sbjct: 397 GQSFIKNAYIVHDVDNSNIALAQA 420

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 106/445 (23%), Positives = 177/445 (39%), Gaps = 100/445 (22%)

Query: 38  IMNFEKKYGDSFENASNDRN-AGAHLVRREDDYELVKLTNE-NSFYSVELDIGTPPQKIT 95
           I +  +KY  +++ A  +   A  H    E  ++ V LTN  N+ Y  E+ +GTPPQ   
Sbjct: 47  ITSLGQKYLSAYQKAYPEAEFAKEHQFYAEAGHD-VPLTNYLNAQYYTEISLGTPPQNFK 105

Query: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTISVI 155
           V++D        TGS+N +                    P++   S              
Sbjct: 106 VILD--------TGSSNLWV-------------------PSAECGS-------------- 124

Query: 156 EATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNL 215
                          + C  +  +D   SS++++N + F+I YG  +   G    D L++
Sbjct: 125 ---------------LACFLHAKYDHDSSSSYKANGSSFAIQYGSGSL-EGYISQDTLSI 168

Query: 216 NNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNS 273
            +L +    FA A          G   G+ GL   Y  +S+  V     YN       ++
Sbjct: 169 GDLTIPKQDFAEATSEPGLAFAFGKFDGILGL--AYDSISVDKVVPP-VYNAI-----HN 220

Query: 274 GAIKSSAYSLFSNKSN--SEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHV 331
           G +    +S +   ++  ++ G   FG +D  KY G++  +P+         +    + V
Sbjct: 221 GLLDEPKFSFYLGNADKSTDGGEATFGGIDSSKYEGNITWLPV---------RRKAYWEV 271

Query: 332 TLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYY 391
              GI +      D    L      A +D+GT++  LP  L E+L  ++GA      G Y
Sbjct: 272 KFDGIGLG-----DEYAILDGHG--AAIDTGTSLIALPSGLAEILNAEIGAKKGWS-GQY 323

Query: 392 VMNC-IHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQS-----DPTVI 445
            + C   +   D+T+  +FGG++ +    ++ L    S   CI  F P        P  I
Sbjct: 324 SVECDTRDSLPDLTL--NFGGYNFTITPYDYTLEVSGS---CISAFTPMDFPEPVGPLAI 378

Query: 446 LGDNFLVSTYIVYDLDNMEISMANA 470
           +GD FL   Y VYDL N  + +A A
Sbjct: 379 IGDAFLRKHYSVYDLGNDAVGLAKA 403

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 130/306 (42%), Gaps = 49/306 (16%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANE 230
           + C  +  +D   SST+  N T+F+I YG      G   +D + + +L +    FA A  
Sbjct: 133 LACFLHNKYDHRVSSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEATS 191

Query: 231 TNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLF--SN 286
                   G   G+ GL   +  +S++     + YN       N G + +  ++ +    
Sbjct: 192 EPGLAFAFGKFDGIFGL--AFDTISVNRAVPPF-YNAV-----NRGLLDAPQFAFYLGDK 243

Query: 287 KSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDN 346
           +   E G + FG  D  ++TG++  +P+         +    + V   GI+  +      
Sbjct: 244 RLRKEGGEVTFGGYDETRFTGNITWLPV---------RREAYWEVDFNGISFGS-----Q 289

Query: 347 ATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHE-VKKDITV 405
              LT T   A +D+GT++  LP  L E+L  ++GA  +   G YV++C       DIT 
Sbjct: 290 YAPLTATG--AAIDTGTSLITLPSGLAEILNAQIGARKNWS-GQYVLDCSRRSTLPDIT- 345

Query: 406 VFDFGGFHISSWLSNFQL----FTDSSSDVCILGFAPQS-----DPTVILGDNFLVSTYI 456
            F+ GG       SNF +    +T  +S  CI    P        P  I+GD FL   Y 
Sbjct: 346 -FNLGG-------SNFSIGPYDYTLEASGTCISAIVPMDFPEPVGPLAIIGDAFLRRWYS 397

Query: 457 VYDLDN 462
           VYDL N
Sbjct: 398 VYDLGN 403

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 78  NSFYSVELDIGTPPQKITVLVDTGSSDLWV 107
           N+ Y  ++ IG+P Q   V++DTGSS+LWV
Sbjct: 96  NAQYFADISIGSPGQTFRVIMDTGSSNLWV 125

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 136/308 (44%), Gaps = 37/308 (12%)

Query: 171 INCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANE 230
           + C  +  +D   SST+++N ++F+I YG  +   G    D L + +L +    FA A  
Sbjct: 130 LACFLHTKYDHEASSTYKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEATS 188

Query: 231 TNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKS 288
                   G   G+ GL   Y  +S++ +     YN     L +       A+ L  +  
Sbjct: 189 EPGLAFAFGKFDGILGL--AYDSISVNRIVPP-VYNAIKNKLLDDPVF---AFYLGDSDK 242

Query: 289 NSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNAT 348
           + + G   FG +D  KYTG++  +P+    +   Y     + V  +GI    G G + AT
Sbjct: 243 SEDGGEASFGGIDEEKYTGEITWLPV----RRKAY-----WEVKFEGI----GLGEEYAT 289

Query: 349 TLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKKDITVVF 407
                   A +D+GT++  LP  L E+L  ++GA      G Y ++C   +   D+T+ F
Sbjct: 290 LEGHG---AAIDTGTSLIALPSGLAEILNAEIGAKKGWS-GQYSVDCESRDSLPDLTLNF 345

Query: 408 DFGGFHISSWLSNFQLFTDSSSDVCILGFAPQS-----DPTVILGDNFLVSTYIVYDLDN 462
           +   F I+++    ++     S  CI  F P        P  I+GD FL   Y +YD+ +
Sbjct: 346 NGYNFTITAYDYTLEV-----SGSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGH 400

Query: 463 MEISMANA 470
             + +A A
Sbjct: 401 DAVGLAKA 408

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 102/441 (23%), Positives = 171/441 (38%), Gaps = 93/441 (21%)

Query: 38  IMNFEKKYGDSFENASNDRNAGAHLVRREDDYEL----VKLTNE-NSFYSVELDIGTPPQ 92
           I +  +KY + FE A  + +     + ++D + +    V L N  N+ Y  ++ IGTPPQ
Sbjct: 43  ISHLGRKYLNQFEKAFPEVH-----ISKKDQFTIESHDVPLDNYLNAQYYTDVSIGTPPQ 97

Query: 93  KITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTI 152
           K  V++DT        GS+N +  + G                                 
Sbjct: 98  KFKVILDT--------GSSNLWVPSVG--------------------------------- 116

Query: 153 SVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQ 212
                             + C  +  +D S SST+ SN + F I YG  +   G    D 
Sbjct: 117 ---------------CSSLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGSL-KGYISQDT 160

Query: 213 LNLNNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSVQKSYTYNNFPMVL 270
           L + +L +    FA A          G   G+ GL   Y  +S++       YN     L
Sbjct: 161 LTIGDLIIPQQDFAEATAEPGLAFAFGKFDGILGL--AYDSISVNKAVPP-LYNAIHRGL 217

Query: 271 KNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFH 330
            +       A+ L   KS+   G   FG  D  ++ G++  +P+    +   Y     + 
Sbjct: 218 LDKPMF---AFYLGDEKSSKNGGEATFGGYDPSRFEGEIKWLPV----RRKAY-----WE 265

Query: 331 VTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGY 390
           V   GI +  GD       +      A +D+GT++  LP ++ + L +++GA  S   G 
Sbjct: 266 VQFDGIKL--GDKF-----MKLEGHGAAIDTGTSLITLPSQIADFLNNEIGAKKSWN-GQ 317

Query: 391 YVMNCI-HEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPTVILGDN 449
           Y ++C   E    +T+ F    F I  +    ++     S +  + F     P  I+GD 
Sbjct: 318 YTIDCKKRESLPKLTLNFYNHNFTIDPFDYTLEISGSCISAITPMDFPQPVGPLSIIGDA 377

Query: 450 FLVSTYIVYDLDNMEISMANA 470
           FL   Y +YDL+N  + +A +
Sbjct: 378 FLRRFYSIYDLENNAVGLAKS 398

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 106/425 (24%), Positives = 177/425 (41%), Gaps = 67/425 (15%)

Query: 79  SFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASV 138
           + Y V + IG P Q+  V VD     +W+   N+  C T     +  SF     ++   +
Sbjct: 50  ALYYVNISIGIPSQEENVRVDIAQPYIWLPAKNST-CETSSCVVTS-SFNNQTSNSSVLL 107

Query: 139 VESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITY 198
            +  I  + +  +IS+                   GT+   D + S+  +  K   S+  
Sbjct: 108 QDGQIFSLDFIDSISL------------------NGTFYKDDLTCSNLVQPLKLNESLKS 149

Query: 199 GDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNS-TVGVLGIGLPGLESTYSGVSLSSV 257
            D  + + T        +++ +  LSF  A +    T+G LG+      S  SG SL  V
Sbjct: 150 PDGLYTTNTTD------DSITLVALSFINAIDYQGLTIGSLGLA-SSTTSDLSGASLDFV 202

Query: 258 QKSYTYNNFPMVLKNSGAIKSSAYSL--------FSNKSNSEHGTI------LFGAVDHG 303
             S+++  +   L NS  I + +YSL        ++N ++    TI      + GAVD  
Sbjct: 203 DDSFSFLTY---LSNSEVIDTPSYSLWLGGDTLPYTNMTSINSTTIDYCGNLVLGAVDQR 259

Query: 304 KYTGDLYTIPIINILQNN-----GYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPAL 358
            Y G L    ++  L NN      Y  PI   + +  I +    G     T T    P L
Sbjct: 260 YYEGRLVQFDMLPALLNNVTEAVTYGLPI---IPMGPIYIENSSGTQLNLTTTNFLEPVL 316

Query: 359 LDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWL 418
           LDS  T + LP+  V  +A ++ A+Y  E+G +++ C    + ++ + F+F G  I   L
Sbjct: 317 LDSRYTNARLPLNTVIQIATQLNAAYVEEFGSWIVEC-SLAEMNVNLNFNFQGLTIPVSL 375

Query: 419 SNFQ------------LFTDSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEI 465
           ++F              F++SS D C L   P +D    ILG  FL + Y+  D +   +
Sbjct: 376 NDFLSRVINSTTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFLKNIYLAIDNEGRSV 435

Query: 466 SMANA 470
           ++A A
Sbjct: 436 AIAKA 440

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 91/402 (22%), Positives = 157/402 (39%), Gaps = 95/402 (23%)

Query: 78  NSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPAS 137
           N +YS E+ +GTPPQ   V++DT        GS+N +   K                   
Sbjct: 99  NQYYS-EIGLGTPPQSFKVVMDT--------GSSNLWVPNKN------------------ 131

Query: 138 VVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSIT 197
                           V EA               C  +  FD  +SS++  N ++FS++
Sbjct: 132 ---------------CVSEA---------------CLNHARFDHDRSSSYAKNDSRFSVS 161

Query: 198 YGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLS 255
           YG  +   G   +D L + +L +    FA A     +  V G   G+ GL   Y G++++
Sbjct: 162 YGKGSM-EGFVSYDTLKIGDLTIKNQGFAEATVEPGSAFVYGQFDGILGL--AYDGLAVN 218

Query: 256 SVQKSYTYNNFPMVLKNSGAIKSSAYSLF---SNKSNSEHGTILFGAVDHGKYTGDLYTI 312
            +   +    +  V  + G +    ++ +     K +S  G ++FG  D  K+TG++  +
Sbjct: 219 HIVPPF----YEAV--HQGLLDEPVFAFYLSDEKKGDSLAGEVVFGGYDETKFTGEISWL 272

Query: 313 PIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
           P+I             + V L  I + +                  LD+GT+    P +L
Sbjct: 273 PVIR---------KAYWEVELNSITLGS-------QKFQLQNYGGALDTGTSFITFPSEL 316

Query: 373 VELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVC 432
            +    K GA+   + G+ +  C      D+T       F ISS  S++ +  D ++  C
Sbjct: 317 YQEFVSKTGATVDPDDGHIIAPCSGSGFPDLTFELAGRSFTISS--SDYVVQWDDTT--C 372

Query: 433 ILGFAP----QSDPTVILGDNFLVSTYIVYDLDNMEISMANA 470
            +   P     +   VI+GD FL   Y +YDL    + +A +
Sbjct: 373 AVAITPLDLGGAGKMVIIGDVFLRRWYSIYDLSKNAVGLAKS 414

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 127/302 (42%), Gaps = 43/302 (14%)

Query: 197 TYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSS 256
           T GD T     W       + L++   SF  A  +N   G LG+G        SG +  S
Sbjct: 140 TEGDPTNTQVQW----FGKHTLSIPEFSFFRAEHSNIVDGSLGLG----ARILSGTAEDS 191

Query: 257 VQKSYTYNNFPMVLKNSGAIKSSAYSLF----------SNKSNSEHGTILFGAVDHGKYT 306
                ++    M LKN+  IKS++YS++          S  ++S+ GT+L GAVD   + 
Sbjct: 192 SGFDSSFFFLDM-LKNANFIKSTSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFI 250

Query: 307 GDLYTIPIINILQNNGYKDPIQFH----VTLQGIAVATGDGMDNATTLTTTKIPALLDSG 362
           G+ Y   ++    +   K    F+    V L  + +    G     T      P LLD  
Sbjct: 251 GNFYRFKMLPFRDS---KTETTFNSLPIVPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPR 307

Query: 363 TTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNF- 421
            TISYLP++L+  +A +  A Y      ++++C      D  + F FG   I   LS+F 
Sbjct: 308 YTISYLPIELILQIAMQTNAVYVKSLDLWLVDC-DVANFDAKIRFQFGDLKIDVPLSHFV 366

Query: 422 ------------QLFTDSSSDVCILGFAPQ-SDPTVILGDNFLVSTYIVYDLDNMEISMA 468
                       QL   +S+  C L   P  S    ILG  FL S Y+  DL+   ++MA
Sbjct: 367 SSGYVGSPIASTQL--GASNMTCQLNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAMA 424

Query: 469 NA 470
            A
Sbjct: 425 QA 426

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/341 (25%), Positives = 143/341 (41%), Gaps = 40/341 (11%)

Query: 144 TEISYDTTISVIEATATLDNTPLASQKINCGTYGTF-----DSSKSSTFESNKTKFSITY 198
           T+IS  T     +      ++ L    ++CG+   F     D S SS+++ N T F+I Y
Sbjct: 93  TDISLGTPAQNFKVILDTGSSNLWVPSVDCGSLACFLHSKYDHSASSSYKPNGTDFAIQY 152

Query: 199 GDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSS 256
           G  +   G    D L++ +L +    FA A          G   G+ GL   Y+ +S+  
Sbjct: 153 GSGSL-EGYISQDTLSVGDLVIPKQDFAEATSEPGLAFAFGKFDGILGL--AYNTISVDK 209

Query: 257 VQKSYTYNNFPMVLKNSGAIKSSAYSL----FSNKSNSEHGTILFGAVDHGKYTGDLYTI 312
           V   + YN     L +       A+ L     S  S+   G   FG +D  K+ G++  +
Sbjct: 210 VVPPF-YNAIDQDLLDEPRF---AFYLGDSSDSEDSSVSGGVATFGGIDKSKFKGEISWL 265

Query: 313 PIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
           P+    +   Y     + V  +GI +      D    L      A +D+GT++  LP  L
Sbjct: 266 PV----RRKAY-----WEVKFEGIGLG-----DEFAILDGHG--AAIDTGTSLITLPSGL 309

Query: 373 VELLADKVGASYSSEYGYYVMNCIHEVKKDIT-VVFDFGG--FHISSWLSNFQLFTDSSS 429
            E++  ++GA      G Y ++C  E +  +  + F+F G  + I  +    ++     S
Sbjct: 310 AEIINSEIGAKKGWS-GQYTVDC--ETRSSLPDLTFNFSGKNYTIGPYDYTLEVSGSCIS 366

Query: 430 DVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANA 470
            +  + F     P  I+GD FL   Y VYDL N  + +A A
Sbjct: 367 AITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAKA 407

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 43  KKYGDSFENASNDRN-AGAHLVRREDDYELVKLTNE-NSFYSVELDIGTPPQKITVLVDT 100
           +KY   +E A  + + +  H    ED+++ V LTN  N+ Y  ++ +GTP Q   V++DT
Sbjct: 52  QKYLTQYEKAYPEISFSRKHPFFAEDNHD-VPLTNYLNAQYYTDISLGTPAQNFKVILDT 110

Query: 101 GSSDLWV 107
           GSS+LWV
Sbjct: 111 GSSNLWV 117

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 108/448 (24%), Positives = 171/448 (38%), Gaps = 98/448 (21%)

Query: 38  IMNFEKKYGDSFENASNDRNAGAHLVRRE----DDYELVKLTN-ENSFYSVELDIGTPPQ 92
           +     KY   +E A    N G  L R      D    V L+N  ++ Y  ++ +GTPPQ
Sbjct: 47  VQQLGHKYVSQYEKA----NPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQ 102

Query: 93  KITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEISYDTTI 152
           K  V++D        TGS+N +                                      
Sbjct: 103 KFKVILD--------TGSSNLW-------------------------------------- 116

Query: 153 SVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQ 212
                  ++D   LA     C  +  +D S+SST+  +    SI+YG  +   G    D 
Sbjct: 117 -----VPSVDCGSLA-----CFLHNKYDHSQSSTYIKDGRPLSISYGSGSI-EGYISEDN 165

Query: 213 LNLNNLNVTGLSFAVANETNSTVGVLGI-----GLPGLESTYSGVSLSSVQKSYTYNNFP 267
           L + +L +    F    ET S  G+        G+ GL   Y  ++   +   + Y+   
Sbjct: 166 LQIGDLTIQNQKFG---ETTSEPGLAFAFGKFDGILGL--AYDTIAQDDITPPF-YSAIQ 219

Query: 268 MVL----KNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGY 323
             L    K S  +KS         S S+ G    G VD  K+ GDL  IP+ ++ +   +
Sbjct: 220 QHLLDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDL--IPL-HVRRQAYW 276

Query: 324 KDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGAS 383
           + P+         A+  GD     +T       A +D+GT++  LP  + E++  ++GA 
Sbjct: 277 EVPLN--------AIKLGD----QSTGKLENTGAAIDTGTSLITLPSDMAEIINAQIGAK 324

Query: 384 YSSEYGYYVMNCIHEVK-KDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDP 442
                G Y + C    K  D+T   D   F +S +    ++     S +  + F      
Sbjct: 325 -KGWTGQYTLECSTRAKLPDLTFTLDGHDFVLSPFEYTLEVSGSCISVITPMDFPEPIGR 383

Query: 443 TVILGDNFLVSTYIVYDLDNMEISMANA 470
             ILGD FL   Y V+DLD   +S+A A
Sbjct: 384 MAILGDAFLRRYYSVFDLDANVVSLAEA 411

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 141/294 (47%), Gaps = 39/294 (13%)

Query: 212 QLNLNNLNVTGLSFAVANETN-STVGVLGIGLPGLESTYSGVSLSSVQKSYTYNN-FPMV 269
           Q N  +L+++ +SF     +N  T G+LG  L G + T  G ++ S Q  YT  + F  +
Sbjct: 165 QFNSGSLSISNVSFFDIQSSNFKTSGLLG--LSG-KVTNPGNAIDSSQ--YTEQSYFLSL 219

Query: 270 LKNSGAIKSSAYSLFSNKSNSEH----------GTILFGAVDHGKYTGDLYT---IPIIN 316
           LK++  I+SS+YSL+     S +          G +L G VD   +TG L     IP ++
Sbjct: 220 LKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIPYVD 279

Query: 317 ILQNN---GYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLV 373
            + N    GY  PI   V L  I + +  G     T      PALLDS +++SYLP   +
Sbjct: 280 PVSNAVSVGY--PI---VPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTI 334

Query: 374 ELLADKVGASYSSEYGYYVMNC-IHEVK-------KDITVVFDFGGFHISSW--LSNFQL 423
             +A ++ A+Y      +++ C I ++        +++T+         S++   +N  +
Sbjct: 335 IQIAVQIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSSM 394

Query: 424 FTDSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANADFSDND 476
           F  S  + C L     ++  V ILG+ F+ + Y+  DL++  I++A A   ++D
Sbjct: 395 FFSSGQEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQAKKVEDD 448

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 132/300 (44%), Gaps = 43/300 (14%)

Query: 212 QLNLNNLNVTGLSFAVANETN-STVGVLGIGLPGLESTYSGVSLSSVQKSYT-YNNFPMV 269
           Q    +L+++ +SF     +N  + G+LG  L G + T  G  + S Q  YT Y+ F  +
Sbjct: 155 QFESGSLSISNVSFFNIESSNFKSSGLLG--LSG-KVTNPGTDIDSSQ--YTEYSYFLSL 209

Query: 270 LKNSGAIKSSAYSLFSNKSNSEH----------GTILFGAVDHGKYTGDLYTIPIINILQ 319
           LK++  I+S +YSL+     S +          G +L G VD   +TG L    +I    
Sbjct: 210 LKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTGTLGQFDLI---- 265

Query: 320 NNGYKDPIQFHVT-------LQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKL 372
              Y DP+   +T       L  I + +  G     T      PALLDS +++SYLP   
Sbjct: 266 --PYADPVTNAITIGYPIVPLGPIYIVSNSGESLNMTSKDFLSPALLDSTSSVSYLPTST 323

Query: 373 VELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWL-----------SNF 421
           +  +A ++ A+Y      +++ C       +T+ F      I   L           +N 
Sbjct: 324 IIQIAVQIAATYVESLDRWLVQC-SMADMGVTLAFRLRDLFIEIPLRDLLSSTYDTSTNS 382

Query: 422 QLFTDSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYID 480
            +   S  + C L     ++  + ILG+ F+ + Y+  DL++  I++A A   ++D  ID
Sbjct: 383 SMLFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQAKKVEDDAVID 442

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 99/214 (46%), Gaps = 25/214 (11%)

Query: 276 IKSSAYSLFSNKSNSEH-GTILFGAVDHGKYTGDLY---TIPIINI---LQNNGYKDPIQ 328
           I+S AYS   +    E+ G ++FG VD   YTGDL    T+P  N+   + + GY  PI 
Sbjct: 223 IESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGY--PI- 279

Query: 329 FHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEY 388
             V L  + V +  G     T      P LLD+    +YLP+ L+  +A +  A Y    
Sbjct: 280 --VPLVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESL 337

Query: 389 GYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQ-----------LFTDSSSDVCILGFA 437
             +++ C    K   +++FDFG   I   LS+             L+  ++   C L F 
Sbjct: 338 NRWLLAC-DVGKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFL 396

Query: 438 PQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANA 470
           P SD    ILG  F+ + Y+  +L + ++++A A
Sbjct: 397 PNSDLGFSILGGPFIKNVYLAAELQSNQVALAQA 430

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 86/424 (20%), Positives = 154/424 (36%), Gaps = 102/424 (24%)

Query: 61  HLVRREDDYELVKLTN-ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKG 119
           +L  + +D  + +L N  N+ Y+ ++ IGTPPQ   V+VD        TGS+  +   K 
Sbjct: 72  NLFAKNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVD--------TGSSTLWVPGK- 122

Query: 120 KDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTF 179
                                                            + + C  +  +
Sbjct: 123 -----------------------------------------------ECRAMACRLHKRY 135

Query: 180 DSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTV---- 235
           D  +SST++ N T   +TYG  +   G    D   +++L + G  F    +   +V    
Sbjct: 136 DHDRSSTYKENGTLTGVTYGSGSIM-GYVSEDTFRISDLEIPGQQFTETTDEPGSVFVFA 194

Query: 236 ---GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSN--KSNS 290
              G+LG+  P L     GV+    Q           L     +K   + ++ +  K+  
Sbjct: 195 AFDGILGLAYPSLG---YGVTPPFQQ-----------LMEKKLVKEPVFGMYLDDMKTGE 240

Query: 291 EHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTL 350
            +G ++ G  D  K+ G++  +P+    +   Y     + V    + V    G DN   +
Sbjct: 241 GNGQLVLGGYDETKFKGEIAWLPV----RRQAY-----WEVVFDSVTV----GDDN---I 284

Query: 351 TTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFG 410
                 A +DSGT++   P +L      K+        G   ++C ++ +    + F FG
Sbjct: 285 PLENYGAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYVDCANK-QTAPPLTFGFG 343

Query: 411 GFHISSWLSNFQLFTDSSSDVCILGFAP----QSDPTVILGDNFLVSTYIVYDLDNMEIS 466
           G   S    ++ +     S  C+          +    I+GD FL   Y +YD  N  + 
Sbjct: 344 GHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIGDVFLRRYYSIYDFGNNAVG 403

Query: 467 MANA 470
           +A A
Sbjct: 404 LATA 407

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 133/305 (43%), Gaps = 43/305 (14%)

Query: 207 TWGHDQLNLNNLNVTGLSFAVANETN-STVGVLGIGLPGLESTYSGVSLSSVQKSYTYNN 265
           T G+ Q N  +L+++ +SF     +N  T G+LG+         +  S    ++SY    
Sbjct: 160 TRGNVQFNSGSLSISNVSFFSVESSNFKTSGLLGLSGKITNPGSAADSSHYTEQSY---- 215

Query: 266 FPMVLKNSGAIKSSAYSLFSNKSNSEH----------GTILFGAVDHGKYTGDLYTIPII 315
           F  +LK+   I+S +YSL+     S +          G +L G VD   +TG L    +I
Sbjct: 216 FLSLLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSLFTGTLGKFDLI 275

Query: 316 NILQNNGYKDPIQFHVT-------LQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYL 368
                  Y DP+   V+       L  I + +  G     T      PALLDS +++SYL
Sbjct: 276 ------PYVDPVSSAVSTGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYL 329

Query: 369 PVKLVELLADKVGASYSSEYGYYVMNC------------IHEVKKDITVVFDFGGFHISS 416
           P   +  +A ++ A+Y      +++ C            + E+  +I +       + +S
Sbjct: 330 PTNTIIQIAVQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLRDLLSSTYDTS 389

Query: 417 WLSNFQLFTDSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANADFSDN 475
             +N  +F  S  + C L     ++  + ILG+ F+ + Y+  DL++  I++A A   ++
Sbjct: 390 --TNSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQAKKIED 447

Query: 476 DEYID 480
           D   D
Sbjct: 448 DAVND 452

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 107/232 (46%), Gaps = 37/232 (15%)

Query: 270 LKNSGAIKSSAYSLF-------------SNKSNSEHGTILFGAVDHGKYTGDLYT---IP 313
           L N G IK+ +YSL+             ++ + ++ G ++ GAVD   YTG L +   IP
Sbjct: 199 LMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSLYTGILRSFKMIP 258

Query: 314 IINIL---QNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPV 370
            I+ +   Q+N Y  PI   + L  I + + +G     T      P LLDS  + +YLP+
Sbjct: 259 FIDPVSQAQSNNY--PI---LPLGTIYINSANGKSLNMTSEEFVEPVLLDSRYSTTYLPI 313

Query: 371 KLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFT----- 425
             +  +A ++GA++      +++ C    K D+++ F FG   I   L +F + T     
Sbjct: 314 DAIVQIAVQIGATFVESLDKWLVAC-SVAKLDVSLDFTFGNIEIRVPLEDFLVTTYDPKS 372

Query: 426 ------DSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANA 470
                  +  + C L    +      +LG  FL + Y+  D+++  I++A A
Sbjct: 373 NTSLHFSTGEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIAQA 424

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 132/289 (45%), Gaps = 41/289 (14%)

Query: 212 QLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPM-VL 270
           Q N  +L+++ +SF   N  +S  G  G+   G + T SG    S Q  +T N+F + +L
Sbjct: 166 QFNSGSLSISNVSFF--NIESSNFGTSGLLGLGGKITDSGTDYDSSQ--FTENSFFLSLL 221

Query: 271 KNSGAIKSSAYSLF----------SNKSNSEHGTILFGAVDHGKYTGDL-------YTIP 313
            ++  I+  +YSL+            +S  + G +L G VD   +TG L       Y  P
Sbjct: 222 TDASFIECPSYSLWLAGDTSTYQSYKESIPDCGKLLLGGVDPSLFTGTLGKFDLIPYVDP 281

Query: 314 IINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLV 373
           + N++ + GY  PI   V L  I + +  G     T      PALLDS +++SYLP   +
Sbjct: 282 VSNVV-STGY--PI---VPLGPIYIISNSGQSMNMTSKDFLSPALLDSTSSVSYLPTSTI 335

Query: 374 ELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLS-----------NFQ 422
             +A ++ A+Y      +++ C       +T+ F F    I   LS           N  
Sbjct: 336 IQIAVQIAATYVESLDRWLVEC-SMADMGVTLGFMFRSLTIKIPLSDLLSSTYDTTTNSS 394

Query: 423 LFTDSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANA 470
           +F  S  + C L     ++  V ILG+ F+ + Y+  DL++  I++A A
Sbjct: 395 MFFSSGQEACFLTLYANTNTGVNILGEAFMKNIYMAVDLEDNSIAIAQA 443

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 95/207 (45%), Gaps = 27/207 (13%)

Query: 270 LKNSGAIKSSAYSLF--SNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPI 327
           +   G +K   + +F   N ++   G I+FG  D  K+ G L  +PI       G+ + +
Sbjct: 82  MMERGQLKDPMFGIFLPKNLAHINEGEIIFGGYDSTKFAGSLEWLPIT----KKGFWE-V 136

Query: 328 QFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSE 387
           +F+    G +   G+G+            A+LD+G++++ LP ++ +     + A+  S+
Sbjct: 137 EFNSISTGESTVQGEGLG-----------AILDTGSSLTLLPTEIFDKFNGALEAALGSK 185

Query: 388 YGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPT---- 443
            G  V     E   +I  VF+ GG   +  ++  +    + S+ C++   PQ+       
Sbjct: 186 TGGRVSCSARETAPEI--VFELGGKKFA--ITGNEYIMPAGSE-CMVTIRPQASGAQSNV 240

Query: 444 VILGDNFLVSTYIVYDLDNMEISMANA 470
           VILG  FL   Y VYDL +  + +A A
Sbjct: 241 VILGTPFLRKFYSVYDLGSDRVGLAEA 267

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 95/437 (21%), Positives = 167/437 (38%), Gaps = 99/437 (22%)

Query: 76  NENSFYSVELDIGTPPQKITVLVDTGSSDLW-VTGSNNPYCSTKGKDTSDFSFKQIHKDN 134
           +E+    VEL +GTP Q+  + +D     +W V+G   P C  K                
Sbjct: 39  DESLLPVVELRVGTPGQRERLRLDITQPYMWLVSGRLYPECDRK---------------- 82

Query: 135 PASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTK- 193
                                              K NC T   +    S T+ +   + 
Sbjct: 83  -----------------------------------KGNCLTGNLYFPKASETYHAGDGET 107

Query: 194 FSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLEST----- 248
           +++T  D    SG  G++++N N  +V      V       V V  +G   LE+T     
Sbjct: 108 YNLTMADGIQISGLLGYEEVNFNRSDVRVRDGNVHLAPREGVKVERMGF--LEATTMTDI 165

Query: 249 YSGVSLSS-------VQKSYTYNNFPMV--LKNSGAIKSSAYSLFSNKSNS--------- 290
           ++G+ LS        +  +   + F  +  ++++G I S +YSL+    N+         
Sbjct: 166 HAGLGLSGRVNNPDPLGDAARGSEFFFLDKMRDAGLISSRSYSLWFGNDNTSAVDLPTVL 225

Query: 291 -EHGTILFGAVDHGKYTGDLYT---IPIINILQNNGYKD--PIQFHVTLQGIAVATGDGM 344
            + GT++ GAVD   Y G+ Y    +P ++I      +   PI   V L  + +   +G 
Sbjct: 226 EDIGTLMLGAVDPRLYYGNFYQYDGVPSVDIASGQHTRGGYPI---VPLTRVQLLGTEGR 282

Query: 345 DNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDIT 404
               T  T   P LL+S    S+LP  +V+ +A +  A ++      ++ C   +K++ +
Sbjct: 283 QLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQIARQTNAVFTKSSNRLIVEC-SLLKEEAS 341

Query: 405 VVFDFGGFHISSWLSNF----------QLFTDSSSDVCILGFAPQSDPTV-ILGDNFLVS 453
             F FG   +   LS+F           +    +++ C L   P +     +LG   L  
Sbjct: 342 FRFHFGELVVEVPLSDFIGPTNLRAGTSILAPDTNETCYLKLMPSTGMGFSMLGMPILRK 401

Query: 454 TYIVYDLDNMEISMANA 470
            YI  D ++  + MA A
Sbjct: 402 LYIAADTESGAVGMALA 418

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 102/424 (24%), Positives = 172/424 (40%), Gaps = 56/424 (13%)

Query: 75  TNENSFYSVELDIGTPPQKITVLVDTGSSDLWV-TGSNNPYCSTKGKDTSDFSFKQIHKD 133
           T  +  Y + + +GTP Q+  +++DT     W+ +GS +  C+         S   + + 
Sbjct: 39  TTGSGIYYINITMGTPEQQQELMIDTSQPYTWLLSGSQDLQCNRLNSGCLSGSLYYVKES 98

Query: 134 NPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTK 193
             A  +    T        S I  T  +D     +  +N        +   ST+ +   K
Sbjct: 99  TSAICINPNRTYHMAFIDQSEINGTHVIDMMNFTNVDVNT-------AYAHSTYNTKNNK 151

Query: 194 FSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPG-LESTYSGV 252
                          G   L  N L V+ +SF  A++T     +  +GL G +  T + +
Sbjct: 152 ---------------GLINLGTNYLGVSNVSFINADDT-VPYAMGSLGLSGKITGTGTDI 195

Query: 253 SLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLF------------SNKSNSEHGTILFGAV 300
             S+   SY   +F   L  +  I S +YSL+             N   S  G ++ GAV
Sbjct: 196 DSSNFDNSY---DFLDRLYQTNLIDSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAV 252

Query: 301 DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQG-IAVATGDG-MDNATTLTTTKIPAL 358
           D   +TG      ++  L+++   + I + +   G I V +  G M N T+    + P  
Sbjct: 253 DPTLFTGSFLQFEMLPALESDSATETIGYPIIPMGPIYVVSKSGEMANVTSKDFLE-PVF 311

Query: 359 LDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWL 418
           LDS  T +YLP+ ++  +A ++GA Y      +++ C +   +  T+ F F    I   L
Sbjct: 312 LDSTYTSTYLPLNMIIQVAIQIGAMYVESLERWLVPC-NIANQHATLDFTFQDVSIRVPL 370

Query: 419 SNFQLFT-DSSS----------DVCILG-FAPQSDPTVILGDNFLVSTYIVYDLDNMEIS 466
           ++    T DSS+          + C L  F+ Q     ILG  FL   Y+  DLD   I+
Sbjct: 371 TDLLGTTYDSSTNTSMHFSTGDEACYLKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIA 430

Query: 467 MANA 470
           +A A
Sbjct: 431 IAQA 434

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 90/198 (45%), Gaps = 26/198 (13%)

Query: 293 GTILFGAVDHGKYTGDLY---TIPIINILQ---NNGYKDPIQFHVTLQGIAVATGDGMDN 346
           G ++FGAVD   YTGD     TIP  N      + GY  PI   + L  + V +  G   
Sbjct: 241 GKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGY--PI---IPLTKVNVQSKSGETK 295

Query: 347 ATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKK-DITV 405
             T  +   P L+DS    +YLP++++  +A +  A Y      +++ C  +V +   ++
Sbjct: 296 NMTSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLAC--DVGRLGASI 353

Query: 406 VFDFGGFHISSWLSNFQ-----------LFTDSSSDVCILGFAPQSDPTV-ILGDNFLVS 453
           +F+FG   I+  L+N             L   +    C L   P +     +LG  F+ +
Sbjct: 354 IFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGGAFIKN 413

Query: 454 TYIVYDLDNMEISMANAD 471
            Y+  +L++ ++++A A 
Sbjct: 414 VYMAAELESNQVALAQAQ 431

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 99/426 (23%), Positives = 171/426 (40%), Gaps = 69/426 (16%)

Query: 81  YSVELDIGTPPQKITVLVDTGSSDLWV-TGSNNPYCSTKGKDTSDFSFKQIHKDNPA--- 136
           Y V + IG+PPQ+  + +DT    +WV +G+++  C+    D+   S  + + +      
Sbjct: 51  YYVNVTIGSPPQQEMLRIDTSQPFVWVLSGADDKQCNR--LDSGCLSGNRFYPEESTTGE 108

Query: 137 SVVESVITEISYDTTISVIEATATLDNTPLASQKINCGT-YGTFDSSKSSTFESNKTKFS 195
           S   S I  +++  T  V   +  +DN    +  I     Y TF+SSK+++         
Sbjct: 109 SATNSTIYSLNFLDTFRV-NGSIVVDNLNFTNTDITAALDYTTFNSSKNNSI-------- 159

Query: 196 ITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS 255
           I  GD          D L + N       F  A ++  T     +G  GL ST++     
Sbjct: 160 IDIGD----------DFLVIKN-----FGFINAEDSYPT----DMGSLGLSSTFNETLNY 200

Query: 256 SVQKSYTYNNFPMV--LKNSGAIKSSAYSLFSNKSNSE---------------HGTILFG 298
           S   ++   +F M+  L  SG I S +YSL+                      +G +L G
Sbjct: 201 SPSGNFN-TSFSMLAMLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLG 259

Query: 299 AVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVT-LQGIAVATGDGMDNATTLTTTKIPA 357
           +VD   +    Y   ++  +  N   +   F V  +  I + +  G     T      P 
Sbjct: 260 SVDPSLFKEPFYQFDVLPYVDPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLEPV 319

Query: 358 LLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSW 417
           LL+S    +YLP+  +  +A +VGA+Y      +++ C     +++   F F   +I + 
Sbjct: 320 LLNSNFRSNYLPLNSIIQIAIQVGATYVESLDRWLLPC-SIANENVHFEFTFDKLNIKAP 378

Query: 418 LSNF------------QLFTDSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNME 464
           L +F              F+D +S+ C L   P +      LG  FL S Y+  + +   
Sbjct: 379 LIDFLESTFDSTTNTSMHFSD-NSEACFLKLYPNTYVGFNALGRPFLKSVYLAVEQEGRI 437

Query: 465 ISMANA 470
           + MA A
Sbjct: 438 VGMAQA 443

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 128/291 (43%), Gaps = 47/291 (16%)

Query: 214 NLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPM-VLKN 272
           N ++L ++  SF   N+T S+ GVLG+G    +    G  + S Q   ++  F +  L++
Sbjct: 285 NSHSLTLSNSSFFEINDTTSSKGVLGLGG---KINDKGTDIDSSQFDSSF--FLLESLRD 339

Query: 273 SGAIKSSAYSLFSNKSNSEH-------------GTILFGAVDHGKYTGDLYTIPIINILQ 319
           +G I+S +YSL+       +             G ++ G VD   Y+G L     +  L 
Sbjct: 340 NGIIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPLKKFNNLIFLD 399

Query: 320 NN------GYKDPIQFHVTLQGIAVATGDGMD--NATTLTTTKIPALLDSGTTISYLPVK 371
           +       GY  P+    T+  +  ATG+ ++  N   LT    P LLDS  + S+LP +
Sbjct: 400 SRTDMLSRGY--PVLPMRTIN-VVSATGNSINVTNENFLT----PVLLDSRYSFSHLPAE 452

Query: 372 LVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSS-- 429
            +  +A +V A Y  E   +V++C       + + F+FG   I     +F + T +    
Sbjct: 453 TIVQIAVQVNAIYMKEVDMFVVSC-KIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPETN 511

Query: 430 ---------DVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANA 470
                    + C +      +    ILG +FL + Y+  D D+  I++A A
Sbjct: 512 STMKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQA 562

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%)

Query: 63  VRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYC 115
           V + DD     L N    Y V+++IGTPPQ   + +DTGSSD++V  +++PYC
Sbjct: 49  VFKRDDVLNSTLINAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSPYC 101

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 98/237 (41%), Gaps = 24/237 (10%)

Query: 269 VLKNSGAIKSSAYSLF--SNKSN--------SEHGTILFGAVDHGKYTGDLYTIPIINIL 318
            LK +  I SS+YSL+  S K N        +E G ++FGAVD     G+     +I  +
Sbjct: 203 ALKEARLINSSSYSLWLGSQKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYI 262

Query: 319 QNNGYKDPIQFHVTLQG-IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLA 377
                K    + V   G I + +  G     T      P LLD    +SYLP K +  +A
Sbjct: 263 HPQTGKVAYGYPVVPMGPIYITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIA 322

Query: 378 DKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLS-----------NFQLFTD 426
            ++ A Y      ++++C        TV F FG   I   LS           N  L  +
Sbjct: 323 IQIAAVYVESLDLWLVSC-DVASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFN 381

Query: 427 SSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVI 482
           +  + C+L   P +     +LG  F+ + Y+  DL+   ++M  A    + E  ++I
Sbjct: 382 TGQEACVLQLYPNTFTGYNVLGQAFMKNAYLAVDLEGKGVAMGQAANFKSGERKEII 438

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 102/420 (24%), Positives = 166/420 (39%), Gaps = 76/420 (18%)

Query: 80  FYSVELDIGTPPQKITVLVDTGSSDLWV-TGSNNPYCSTKGKDTSDFSFKQIHKDNPA-S 137
            Y V   +GTP Q+  + VD     LWV +GS    C+         S   + +   A +
Sbjct: 45  LYYVNTTLGTPGQEQMLRVDISQPYLWVLSGSEYAQCNRLDSGCLTGSLYYVRQSTTAMN 104

Query: 138 VVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSIT 197
           +    + ++ +   IS I  TA +D   L S           D+S       N T  ++ 
Sbjct: 105 LTRDRVYDMQFMDYIS-INGTAVMDTLNLTS---------VIDNSLGKNILENLTNSTV- 153

Query: 198 YGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNS-TVGVLGIG----LPGLESTYSGV 252
                       H  L+ + L++T +SF   + + S T G LG+G     PG +    G 
Sbjct: 154 ------------HWDLDSDTLSMTNVSFINVDYSGSITQGALGLGGRITAPGEDINSDGF 201

Query: 253 SLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEH------------GTILFGAV 300
             S          F   L  +  I SS+YSL+  +   +             G ++ GAV
Sbjct: 202 DGSFF--------FLEQLVANNVIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAV 253

Query: 301 DHGKYTGDLY---TIPIINI---LQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTK 354
           D   YTGD     TIP  ++     + GY  PI   V L  ++V    G     T     
Sbjct: 254 DPSLYTGDFVRFDTIPFHDVDTGATSFGY--PI---VPLTKVSVKASSGQTLNVTSPDFA 308

Query: 355 IPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNC-IHEVKKDITVVFDFGGFH 413
            P LLD+    S+LP+KL+  +A +  A Y      ++++C + ++    +++F+F G  
Sbjct: 309 EPVLLDTRYLYSFLPLKLIIQIAIQTNAYYVESLDRWLVSCSVGDLNA--SMIFEFNGLS 366

Query: 414 ISSWLSNF-----------QLFTDSSSDVCILGFAPQ-SDPTVILGDNFLVSTYIVYDLD 461
           I   + +F            L   + +  C L   P  +    +LG  F+ + YI  DL+
Sbjct: 367 IDVPIKDFLSNSYDSVSNSTLHFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 98/215 (45%), Gaps = 24/215 (11%)

Query: 293 GTILFGAVDHGKYTGDLYTIPII------NILQNNGYKDPIQFHVTLQGIAVATGDGMDN 346
           G +L G +D   Y G LY   +I      +++ + GY  PI   + +  I V +  G   
Sbjct: 274 GKLLLGVIDPALYRGSLYQFDMIPYVDPESLVSSQGY--PI---LPMGVIYVKSESGARL 328

Query: 347 ATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVV 406
             T      P LLDS    +YLP   +  +A ++GA+Y      ++++C        +V+
Sbjct: 329 NVTSKDFLEPVLLDSSQQGNYLPENAIIQIAIQIGATYIESMDRWLVSC-DMASYGASVL 387

Query: 407 FDFGGFHISSWLSN-----FQLFTDSS---SD---VCILGFAPQSDPTV-ILGDNFLVST 454
           F F G  I   L N     F+  ++SS   SD    C L     ++    +LG  F  +T
Sbjct: 388 FTFDGLEIDVPLENLLTNTFETGSNSSIYYSDGETACALTIYDNANMGYNLLGSAFFRNT 447

Query: 455 YIVYDLDNMEISMANADFSDNDEYIDVIESAVPSA 489
           YI  DL+   +++A A  SD D+  ++  + +P+A
Sbjct: 448 YIAVDLEGNTVAIAQAKPSDEDDSSNLSATTLPAA 482

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 116/314 (36%), Gaps = 56/314 (17%)

Query: 173 CGTYGTFDSSKSSTFESNKTKFSITY--GDSTFASGTWGHDQLNLNNLNVTGLSFAVANE 230
           C T   + S  SSTF++      + Y  GD   A     +D L      +    F  A  
Sbjct: 119 CRTRNRYRSGASSTFKATDKTLRLQYVKGD---AKARVSYDTLYFAGAKIENQGFGEAEA 175

Query: 231 TNSTV------GVLGIGLPGLESTYSGVSLSSVQKSYTYNNFPMV--LKNSGAIKSSAYS 282
                      G++GIG P                S  Y   P +  L +SG +K   + 
Sbjct: 176 IGDDFSGARFDGIIGIGYP----------------SIGYGIKPPINTLIDSGGLKDPMFG 219

Query: 283 LF---SNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVA 339
           ++   +   NS  G I+ G  +  K+ GD+  +P++             +   L    V 
Sbjct: 220 IYISNAQNRNSPVGEIVLGGYNTQKFKGDIKWLPVLR---------KAFWETDLSAFKVG 270

Query: 340 TGDGMDNATTLTTTKIPALLDSGTTISYLPVK-LVELLADKVGASYSSEYGYYVMNCIHE 398
                     L    + A+ D+G++   +P     + ++   GAS+     Y  ++C   
Sbjct: 271 N-------FALDVQGLTAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY--VDC-ST 320

Query: 399 VKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDPT--VILGDNFLVSTYI 456
           V     +  DFGG  +   LS          + CIL  +  S  T  VILGD FL   Y 
Sbjct: 321 VNSGPDLTLDFGGVALK--LSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYT 378

Query: 457 VYDLDNMEISMANA 470
           +Y+  +  I +A+A
Sbjct: 379 IYNFGDNTIGVASA 392

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 77  ENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSN--NPYCSTKGKDTSDFS--FKQIHK 132
           EN  YSV++ +GTP Q   V +DTGSS LW+      +  C T+ +  S  S  FK   K
Sbjct: 79  ENFQYSVDITLGTPAQNFRVALDTGSSLLWIPSDRCTSQICRTRNRYRSGASSTFKATDK 138

Query: 133 DNPASVVES-VITEISYDT 150
                 V+      +SYDT
Sbjct: 139 TLRLQYVKGDAKARVSYDT 157

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 268 MVLKNSGAI-KSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPI---INILQNNGY 323
           M  +  G I K  +YSLF N  N   G+ILFGAVD  KY  +L T P+    N L +N  
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAYNTLDSNS- 59

Query: 324 KDPIQFHVTLQGIAVATG 341
               +  +T+Q +A+  G
Sbjct: 60  ----RIIITVQSVAILDG 73

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 106/429 (24%), Positives = 171/429 (39%), Gaps = 85/429 (19%)

Query: 85  LDIGTPPQKITVLVDTGSSDLWV-TGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVI 143
           + +GTP Q   + +D     +WV +G N+  C   G    ++S    +  N + V+ +  
Sbjct: 69  VSLGTPSQLQRLSIDIAQPYVWVRSGRNSTECDKPGSFCVNYSEYYANASNTSRVLNN-- 126

Query: 144 TEISYDTTISVIEATATLDNTPLASQKINCGTYGTFDSSKSSTFESNKTKF-SITYGDST 202
              +Y   I  ++  A           I+  TY            S++  F ++TYG+  
Sbjct: 127 ---NYIQNIFFVDGNA-----------ISGATY------------SDRILFPNMTYGNDD 160

Query: 203 FASGTWGHDQLNLN------NLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSS 256
                       LN      NL+V+ +SF  A   +S          GL ST  GV+  S
Sbjct: 161 INIHRNSTRNFTLNATIDTHNLSVSNISFFDAYNYSSLRYGALGLGGGLVSTNLGVTGPS 220

Query: 257 VQKSYTYNNFPMV--LKNSGAIKSSAYSL-FSNKSN-------------SEHGTILFGAV 300
                  + F ++  L NSG I++++YS+ F+N S+             S++G I+FG V
Sbjct: 221 -------DPFSLLNALLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGV 273

Query: 301 DHGKYTGDLYTIPII------NILQNNGYKDPIQFHVTLQGIAVATGDGMD-NATTLTTT 353
           D     G   +  +I      + L  +GY  PI   + +  I +    G   N TTL   
Sbjct: 274 DSSLIDGTFQSFTMIPYEDTSDGLTTSGY--PI---LPMGPIYIIANSGRTLNLTTLDFL 328

Query: 354 KIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFH 413
           + P LLDS  T S LP   +  +A ++ A Y      +V+ C      ++   F FG   
Sbjct: 329 E-PVLLDSRITNSRLPASFIIQVAIQLEAMYLESLDRWVVPC-SLADYNVNFDFSFGSVR 386

Query: 414 ISSWLSNF-----------QLFTDSSSDVCILGFAPQSDPTV-ILGDNFLVSTYIVYDLD 461
           I   L +F            +    + D C L   P +D    ILG  FL +  I  D  
Sbjct: 387 IRVPLEDFLVPSGLTGDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHS 446

Query: 462 NMEISMANA 470
           + +I++  A
Sbjct: 447 SSQIAIGKA 455

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 32/46 (69%), Gaps = 1/46 (2%)

Query: 81  YSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGKDTSDFS 126
           Y V+++IGTPPQ + + +DTGSSD+ V  ++  YC +   D SD++
Sbjct: 67  YVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIAYCKSM-SDGSDYA 111

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 125/295 (42%), Gaps = 43/295 (14%)

Query: 209 GHDQLNLNNLNVTGLSF-AVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYTYNNFP 267
           G  +++  +LN++ +SF +  N    ++G LG+G   +ES  S +       S+      
Sbjct: 153 GLVEVDHGHLNISSMSFFSTYNSGGLSIGSLGLG-GNVESRNSDLDSGQYDGSFF---LL 208

Query: 268 MVLKNSGAIKSSAYSLFSNKSNSE--------------HGTILFGAVDHGKYTGDLYT-- 311
             LK +G I+   YSL+    N+                G ++ GAV+     G   +  
Sbjct: 209 EELKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGAVNPNLIDGKFVSFN 268

Query: 312 -IPIIN---ILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISY 367
            +P  N   +  +NGY  PI   + +  I + +  G     T      P LLDS  T S 
Sbjct: 269 MLPYQNPDTLEMSNGY--PI---LPMGPINIISKSGASLNMTSNNYLQPVLLDSRYTNSR 323

Query: 368 LPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNF------ 421
           LP++ +  +A ++ ASY  +   +V++C   +K+ + + F FG   I   L  F      
Sbjct: 324 LPIEAIIQIAIQIDASYVEQLNSWVVSC-SILKESVVLEFSFGPLRIKVPLKQFLKKAID 382

Query: 422 ----QLFTDSSSD-VCILGFAPQSDPTV-ILGDNFLVSTYIVYDLDNMEISMANA 470
                  T S+ D  CIL   P  D    ILG  F+ S Y+  D +   I++  +
Sbjct: 383 PDTGNARTLSNGDQACILSLYPNHDIGYNILGAPFMKSIYLAVDNEGGTIALGQS 437

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 95/234 (40%), Gaps = 29/234 (12%)

Query: 270 LKNSGAIKSSAYSLFSNKSN-------------SEHGTILFGAVDHGKYTGDLYTIPIIN 316
           + N   IKS +YSL+                  S  G ++ GAVD   Y G+ +    I+
Sbjct: 208 MANLNLIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTIS 267

Query: 317 ILQNNGYKDPIQFHVTLQG-IAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVEL 375
            ++ +       + +   G I + +  G     T      PALLDS    S+LP   +  
Sbjct: 268 YIEPSHNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANTIIQ 327

Query: 376 LADKVGASYSSEYGYYVMNC-IHEVKKDITVVFDFGGFHISSWLSNF------------Q 422
           +A ++GA Y      +V+ C +  +   I   FD  G  I   LS+              
Sbjct: 328 IAIQIGAIYIESLNRWVVPCSVASMGAHIDFTFD--GLDIKVPLSDLLTSSKDPATNSTM 385

Query: 423 LFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDND 476
            F +  S   ++ ++  +    +LG +F+ + YI  DLD  ++++A A  +  D
Sbjct: 386 HFAEGESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAKNTTGD 439

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 116/313 (37%), Gaps = 66/313 (21%)

Query: 194 FSITYGDSTFASGTWGHDQLNLNNLNVT-GLSFAVANETNSTVGVLGIGLPGLESTY--S 250
           FS+ Y  S  A G   HD++ +N L  T   +F VA+E           +P +   Y  S
Sbjct: 150 FSLAY-TSGVAVGDVYHDRIIVNELATTDNFTFGVASE-----------VPDIFENYPAS 197

Query: 251 GVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSE---------------HGTI 295
           G+       S +  N    L++S AI    +S+     N+E                G  
Sbjct: 198 GIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIF 257

Query: 296 LFGAVDHGKYTGDLY---TIP--------IINILQNNGYKDPIQFHVTLQGIAVATGDGM 344
             G    G Y G++Y    IP         IN L  N YK      V        TG   
Sbjct: 258 AIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYK------VNFTNYENFTGSKS 311

Query: 345 DNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDIT 404
            N  +       +++DSGTT+  LP +    +    G S +    + +M C     + +T
Sbjct: 312 HNTRS-------SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C--NSTQTLT 361

Query: 405 VVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQS------DPTVILGDNFLVSTYIVY 458
           + FD   + I S      L    S D    G+   +      D   ILGD FL   Y V+
Sbjct: 362 LEFDNKNWTIPS---EKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVF 418

Query: 459 DLDNMEISMANAD 471
           D++N  +  A  +
Sbjct: 419 DVENQRLGFAEGN 431

>NDAI0D01110 Chr4 (252528..253709) [1182 bp, 393 aa] {ON} Anc_2.260
           YNL051W
          Length = 393

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 93/240 (38%), Gaps = 38/240 (15%)

Query: 64  RREDDYELVKLTNENSFYSVELDIGTPPQKITV---LVDTGSSDLWVTGSNNPYCST-KG 119
           +R+   +L+K TN+ S  + ELDI TP +K+      VD    DL    S N      KG
Sbjct: 17  KRQFANDLLKATNDESSTTTELDIETPIKKLKYDLDEVDARIDDLLRNNSTNIINQLYKG 76

Query: 120 KDTSD--------------FSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTP 165
           K + +               S+K++ ++    V+E         + +S +  T+ L    
Sbjct: 77  KSSQNIINNELNDSFGYLSMSYKRLQEE----VLEPYEKAQKLQSVLSKVHQTSILLRDS 132

Query: 166 LASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSF 225
           L    I         + KS+T   N +   +T   +   +  +   QLNLN  NV   S 
Sbjct: 133 LIYIHI-INEIENLSAEKSTT---NTSSNKLTTAKAIKLATLYSQLQLNLNQ-NVNLKSL 187

Query: 226 AVANETNSTVGVLGIGLPGLES-TYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLF 284
            V      T+ V    L G  S  +S   L+S +          + KN   I   AYSL+
Sbjct: 188 QVIKHLEGTILVKKKELLGFISLEFSKECLNSFK----------IKKNKDIISQLAYSLY 237

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,826,221
Number of extensions: 2671014
Number of successful extensions: 7501
Number of sequences better than 10.0: 233
Number of HSP's gapped: 7254
Number of HSP's successfully gapped: 312
Length of query: 590
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 475
Effective length of database: 40,294,809
Effective search space: 19140034275
Effective search space used: 19140034275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)