Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3818.274ON55455429300.0
Suva_2.2818.274ON55455427480.0
Smik_4.3658.274ON57055427180.0
YDR120C (TRM1)8.274ON57055427050.0
TDEL0F040108.274ON54655522200.0
NDAI0J013008.274ON59057622160.0
Kpol_543.458.274ON55956121950.0
NCAS0B037608.274ON54656121600.0
TPHA0A017308.274ON55155021100.0
KAFR0B054308.274ON56656921010.0
KNAG0H031608.274ON53953520280.0
ZYRO0D06886g8.274ON54053720220.0
SAKL0H16764g8.274ON54255820190.0
Kwal_56.237478.274ON54155520130.0
KLTH0G13420g8.274ON54255619900.0
TBLA0H014408.274ON59659919950.0
CAGL0B01881g8.274ON55356819470.0
Ecym_42968.274ON56156619310.0
AGR075W8.274ON56056719280.0
KLLA0F19404g8.274ON55756319080.0
KLLA0E21539g1.325ON400104910.018
Suva_4.5321.325ON41694830.16
Smik_2.4141.325ON41771820.18
Kpol_1066.171.325ON435100810.24
TDEL0E028105.346ON49338820.24
YBR271W (EFM2)1.325ON41971810.26
KAFR0K022705.346ON49638800.37
Ecym_55131.325ON39678780.55
AER240W1.325ON390117780.64
Kpol_1005.165.346ON50138751.4
Suva_15.2595.346ON50038751.6
SAKL0D06798g1.325ON42188741.7
NCAS0H016605.346ON50538742.2
Skud_2.4031.325ON41764732.2
NDAI0C019905.346ON49933732.5
KLLA0E12761g5.346ON50233732.5
KLLA0D11506g3.574ON26557704.3
KAFR0L006807.205ON83033714.8
TBLA0D056501.224ON97575714.8
AAL033W5.346ON48942715.2
CAGL0H07183g5.346ON49847705.3
KAFR0C051007.37ON70543706.0
CAGL0E02717g6.19ON32530696.3
TPHA0D020405.346ON52947706.6
SAKL0G09130g5.346ON50129697.9
KNAG0B019705.346ON49735698.3
CAGL0I09438g1.325ON406118698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.381
         (554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.381 Chr4 complement(663158..664822) [1665 bp, 554 aa] {ON...  1133   0.0  
Suva_2.281 Chr2 complement(486262..487926) [1665 bp, 554 aa] {ON...  1063   0.0  
Smik_4.365 Chr4 complement(652743..654455) [1713 bp, 570 aa] {ON...  1051   0.0  
YDR120C Chr4 complement(691549..693261) [1713 bp, 570 aa] {ON}  ...  1046   0.0  
TDEL0F04010 Chr6 complement(742997..744637) [1641 bp, 546 aa] {O...   859   0.0  
NDAI0J01300 Chr10 complement(303191..304963) [1773 bp, 590 aa] {...   858   0.0  
Kpol_543.45 s543 complement(102294..103973) [1680 bp, 559 aa] {O...   850   0.0  
NCAS0B03760 Chr2 (672696..674336) [1641 bp, 546 aa] {ON} Anc_8.2...   836   0.0  
TPHA0A01730 Chr1 (350348..352003) [1656 bp, 551 aa] {ON} Anc_8.2...   817   0.0  
KAFR0B05430 Chr2 (1113972..1115672) [1701 bp, 566 aa] {ON} Anc_8...   813   0.0  
KNAG0H03160 Chr8 (593242..594861) [1620 bp, 539 aa] {ON} Anc_8.2...   785   0.0  
ZYRO0D06886g Chr4 (592600..594222) [1623 bp, 540 aa] {ON} simila...   783   0.0  
SAKL0H16764g Chr8 (1474162..1475790) [1629 bp, 542 aa] {ON} high...   782   0.0  
Kwal_56.23747 s56 (687620..689245) [1626 bp, 541 aa] {ON} YDR120...   780   0.0  
KLTH0G13420g Chr7 (1151037..1152665) [1629 bp, 542 aa] {ON} simi...   771   0.0  
TBLA0H01440 Chr8 (319130..320920) [1791 bp, 596 aa] {ON} Anc_8.2...   773   0.0  
CAGL0B01881g Chr2 complement(172860..174521) [1662 bp, 553 aa] {...   754   0.0  
Ecym_4296 Chr4 (633567..635252) [1686 bp, 561 aa] {ON} similar t...   748   0.0  
AGR075W Chr7 (869459..871141) [1683 bp, 560 aa] {ON} Syntenic ho...   747   0.0  
KLLA0F19404g Chr6 complement(1796569..1798242) [1674 bp, 557 aa]...   739   0.0  
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    40   0.018
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    37   0.16 
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    36   0.18 
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    36   0.24 
TDEL0E02810 Chr5 complement(540282..541763) [1482 bp, 493 aa] {O...    36   0.24 
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    36   0.26 
KAFR0K02270 Chr11 (462616..464106) [1491 bp, 496 aa] {ON} Anc_5....    35   0.37 
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    35   0.55 
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    35   0.64 
Kpol_1005.16 s1005 (26203..27708) [1506 bp, 501 aa] {ON} (26203....    33   1.4  
Suva_15.259 Chr15 (436542..438044) [1503 bp, 500 aa] {ON} YHR070...    33   1.6  
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    33   1.7  
NCAS0H01660 Chr8 complement(317482..318999) [1518 bp, 505 aa] {O...    33   2.2  
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    33   2.2  
NDAI0C01990 Chr3 complement(446632..448131) [1500 bp, 499 aa] {O...    33   2.5  
KLLA0E12761g Chr5 (1131727..1133235) [1509 bp, 502 aa] {ON} simi...    33   2.5  
KLLA0D11506g Chr4 (987844..988641) [798 bp, 265 aa] {ON} highly ...    32   4.3  
KAFR0L00680 Chr12 (129379..131871) [2493 bp, 830 aa] {ON} Anc_7....    32   4.8  
TBLA0D05650 Chr4 (1384163..1387090) [2928 bp, 975 aa] {ON} Anc_1...    32   4.8  
AAL033W Chr1 (280861..282330) [1470 bp, 489 aa] {ON} Syntenic ho...    32   5.2  
CAGL0H07183g Chr8 complement(706436..707932) [1497 bp, 498 aa] {...    32   5.3  
KAFR0C05100 Chr3 (1011347..1013464) [2118 bp, 705 aa] {ON} Anc_7...    32   6.0  
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...    31   6.3  
TPHA0D02040 Chr4 (419427..421016) [1590 bp, 529 aa] {ON} Anc_5.3...    32   6.6  
SAKL0G09130g Chr7 complement(784892..786397) [1506 bp, 501 aa] {...    31   7.9  
KNAG0B01970 Chr2 complement(377618..379111) [1494 bp, 497 aa] {O...    31   8.3  
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    31   8.5  

>Skud_4.381 Chr4 complement(663158..664822) [1665 bp, 554 aa] {ON}
           YDR120C (REAL)
          Length = 554

 Score = 1133 bits (2930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/554 (98%), Positives = 543/554 (98%)

Query: 1   MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC 60
           MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC
Sbjct: 1   MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC 60

Query: 61  IKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINI 120
           IKAWDNLYGEDCGQ           PAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINI
Sbjct: 61  IKAWDNLYGEDCGQKRKNKKSKKKRPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINI 120

Query: 121 LEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVL 180
           LEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVL
Sbjct: 121 LEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVL 180

Query: 181 MYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFA 240
           MYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFA
Sbjct: 181 MYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFA 240

Query: 241 LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIE 300
           LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIE
Sbjct: 241 LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIE 300

Query: 301 VKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGT 360
           VKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGT
Sbjct: 301 VKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGT 360

Query: 361 YHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYF 420
           YHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYF
Sbjct: 361 YHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYF 420

Query: 421 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK 480
           SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK
Sbjct: 421 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK 480

Query: 481 KDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQEN 540
           KDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQEN
Sbjct: 481 KDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQEN 540

Query: 541 PTKNWGPKARPNAS 554
           PTKNWGPKARPNAS
Sbjct: 541 PTKNWGPKARPNAS 554

>Suva_2.281 Chr2 complement(486262..487926) [1665 bp, 554 aa] {ON}
           YDR120C (REAL)
          Length = 554

 Score = 1063 bits (2748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/554 (90%), Positives = 529/554 (95%)

Query: 1   MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC 60
           M RAAISKIKANLTAYGA +INIEDFNIVKEGKAEILFPKKETVFYNP+QQFNRDLSVTC
Sbjct: 1   MFRAAISKIKANLTAYGARKINIEDFNIVKEGKAEILFPKKETVFYNPIQQFNRDLSVTC 60

Query: 61  IKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINI 120
           IKAWDNLYG++CGQ            AQNSDDSSKRQKM++GSS+EI E++  KTPYINI
Sbjct: 61  IKAWDNLYGDECGQKRRNKKGKKKRTAQNSDDSSKRQKMEDGSSREIAEDSRTKTPYINI 120

Query: 121 LEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVL 180
           LEALSATGLRAIRYAHEIPHVK+VIANDLLP+AVESI+RNVEYNNV +IVKPNLDDANVL
Sbjct: 121 LEALSATGLRAIRYAHEIPHVKQVIANDLLPDAVESIKRNVEYNNVESIVKPNLDDANVL 180

Query: 181 MYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFA 240
           MYRNKA NNKFHVIDLDPYGTVTPFVDAAIQ+IEEDGLMLVTCTDLSVLAGNGYPEKCFA
Sbjct: 181 MYRNKATNNKFHVIDLDPYGTVTPFVDAAIQNIEEDGLMLVTCTDLSVLAGNGYPEKCFA 240

Query: 241 LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIE 300
           LYGG NMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKV+TSPIE
Sbjct: 241 LYGGVNMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIE 300

Query: 301 VKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGT 360
           VKN+MSNTMTTYHCSRCGSYHNQPLGR+SQREGKK+KTFTKYSVAQGPPVD RC+FC GT
Sbjct: 301 VKNVMSNTMTTYHCSRCGSYHNQPLGRISQREGKKNKTFTKYSVAQGPPVDTRCKFCGGT 360

Query: 361 YHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYF 420
           YHLAGPMYAGPLHNKEFIEEVLRIN EEHH +DDTYGTRKRIEGMLSLAKNELSDSPFYF
Sbjct: 361 YHLAGPMYAGPLHNKEFIEEVLRINNEEHHGRDDTYGTRKRIEGMLSLAKNELSDSPFYF 420

Query: 421 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK 480
           SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK
Sbjct: 421 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK 480

Query: 481 KDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQEN 540
           KDLSKMNPNTTGYKILSAMPKWLS+D+KSEYD +LSFTPNE+SG+IEKLRKLKIVRYQEN
Sbjct: 481 KDLSKMNPNTTGYKILSAMPKWLSEDVKSEYDSKLSFTPNEESGSIEKLRKLKIVRYQEN 540

Query: 541 PTKNWGPKARPNAS 554
           PTKNWGPKARPNAS
Sbjct: 541 PTKNWGPKARPNAS 554

>Smik_4.365 Chr4 complement(652743..654455) [1713 bp, 570 aa] {ON}
           YDR120C (REAL)
          Length = 570

 Score = 1051 bits (2718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/554 (89%), Positives = 523/554 (94%)

Query: 1   MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC 60
           ML+AAISKIKAN TAYGAPRINI+DFNIVKEGKAEILFP+KETVFYNP+QQFNRDLSVTC
Sbjct: 17  MLKAAISKIKANFTAYGAPRINIDDFNIVKEGKAEILFPRKETVFYNPIQQFNRDLSVTC 76

Query: 61  IKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINI 120
           IKAWDNLYGEDCGQ            A+N+DDSSKRQK +NGS KE  E  NKK PYINI
Sbjct: 77  IKAWDNLYGEDCGQKRKSKKGKKKRCAENNDDSSKRQKTENGSPKETVENFNKKEPYINI 136

Query: 121 LEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVL 180
           LEALSATGLRAIRYAHEIPHV+EVIANDLLP+AVESI+RNVEYNNV NIVKPNLDDANVL
Sbjct: 137 LEALSATGLRAIRYAHEIPHVREVIANDLLPDAVESIKRNVEYNNVENIVKPNLDDANVL 196

Query: 181 MYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFA 240
           MYRNKA NNKFHVIDLDPYGTVTPFVDAAIQ+IEE GLMLVTCTDLSVLAGNGYPEKCFA
Sbjct: 197 MYRNKATNNKFHVIDLDPYGTVTPFVDAAIQNIEEGGLMLVTCTDLSVLAGNGYPEKCFA 256

Query: 241 LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIE 300
           LYGG NMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVF+KVRTSPIE
Sbjct: 257 LYGGVNMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFIKVRTSPIE 316

Query: 301 VKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGT 360
           VKNLMSNTMTTYHCSRCGSYHNQPLGR+SQREGKK+KTFTKYSVAQGPPVD +C+FC+GT
Sbjct: 317 VKNLMSNTMTTYHCSRCGSYHNQPLGRISQREGKKNKTFTKYSVAQGPPVDTKCKFCEGT 376

Query: 361 YHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYF 420
           YHLAGPMYAGPLHNKEFIEEVLRINKEEH D+DDTYGTRKRIEGMLSLAKNELSD+PFYF
Sbjct: 377 YHLAGPMYAGPLHNKEFIEEVLRINKEEHRDKDDTYGTRKRIEGMLSLAKNELSDAPFYF 436

Query: 421 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK 480
           SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVM+KCDDEK
Sbjct: 437 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMEKCDDEK 496

Query: 481 KDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQEN 540
           KDLSKMNPNTTGYKILS MPKWL+DD+KSEY+ +LSF  NEQSG+IEKLRKLKIVRYQEN
Sbjct: 497 KDLSKMNPNTTGYKILSTMPKWLNDDVKSEYESKLSFASNEQSGSIEKLRKLKIVRYQEN 556

Query: 541 PTKNWGPKARPNAS 554
           PTKNWGPKARPN S
Sbjct: 557 PTKNWGPKARPNTS 570

>YDR120C Chr4 complement(691549..693261) [1713 bp, 570 aa] {ON}
           TRM1tRNA methyltransferase; two forms of the protein are
           made by alternative translation starts; localizes to
           both the nucleus and mitochondrion to produce the
           modified base N2,N2-dimethylguanosine in tRNAs in both
           compartments
          Length = 570

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/554 (89%), Positives = 520/554 (93%)

Query: 1   MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC 60
           ML+AAISKIKAN TAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNP+QQFNRDLSVTC
Sbjct: 17  MLKAAISKIKANFTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPIQQFNRDLSVTC 76

Query: 61  IKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINI 120
           IKAWDNLYGE+CGQ            A+ +DDSSKRQKM NGS KE    +N+  PYINI
Sbjct: 77  IKAWDNLYGEECGQKRNNKKSKKKRCAETNDDSSKRQKMGNGSPKEAVGNSNRNEPYINI 136

Query: 121 LEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVL 180
           LEALSATGLRAIRYAHEIPHV+EVIANDLLPEAVESI+RNVEYN+V NIVKPNLDDANVL
Sbjct: 137 LEALSATGLRAIRYAHEIPHVREVIANDLLPEAVESIKRNVEYNSVENIVKPNLDDANVL 196

Query: 181 MYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFA 240
           MYRNKA NNKFHVIDLDPYGTVTPFVDAAIQSIEE GLMLVTCTDLSVLAGNGYPEKCFA
Sbjct: 197 MYRNKATNNKFHVIDLDPYGTVTPFVDAAIQSIEEGGLMLVTCTDLSVLAGNGYPEKCFA 256

Query: 241 LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIE 300
           LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKV+TSPIE
Sbjct: 257 LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIE 316

Query: 301 VKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGT 360
           VKN+MS+TMTTYHCSRCGSYHNQPLGR+SQREG+ +KTFTKYSVAQGPPVD +C+FC+GT
Sbjct: 317 VKNVMSSTMTTYHCSRCGSYHNQPLGRISQREGRNNKTFTKYSVAQGPPVDTKCKFCEGT 376

Query: 361 YHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYF 420
           YHLAGPMYAGPLHNKEFIEEVLRINKEEH DQDDTYGTRKRIEGMLSLAKNELSDSPFYF
Sbjct: 377 YHLAGPMYAGPLHNKEFIEEVLRINKEEHRDQDDTYGTRKRIEGMLSLAKNELSDSPFYF 436

Query: 421 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK 480
           SPNHIASVIKLQVPPLKKVVAGLGSLG+ECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK
Sbjct: 437 SPNHIASVIKLQVPPLKKVVAGLGSLGFECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEK 496

Query: 481 KDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQEN 540
           KDLSKMNPNTTGYKILSAMP WLS  +KSEYD +LSF PNEQSGNIEKLRKLKIVRYQEN
Sbjct: 497 KDLSKMNPNTTGYKILSAMPGWLSGTVKSEYDSKLSFAPNEQSGNIEKLRKLKIVRYQEN 556

Query: 541 PTKNWGPKARPNAS 554
           PTKNWGPKARPN S
Sbjct: 557 PTKNWGPKARPNTS 570

>TDEL0F04010 Chr6 complement(742997..744637) [1641 bp, 546 aa] {ON}
           Anc_8.274 YDR120C
          Length = 546

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/555 (74%), Positives = 471/555 (84%), Gaps = 14/555 (2%)

Query: 1   MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC 60
           MLRAA++KIK+   + G+  IN ED+N+VKEGKAEILFPK ETVF NPVQ+FNRDLSV C
Sbjct: 1   MLRAALTKIKSRFASAGSSWINPEDYNVVKEGKAEILFPKAETVFCNPVQEFNRDLSVCC 60

Query: 61  IKAWDNLYG--EDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTP-Y 117
           IKAWDNLYG     G+             ++     KR+K+D+ S       A +  P Y
Sbjct: 61  IKAWDNLYGGQTKIGRKSKSNSRKRSNTGEDDGTCEKRRKLDDKS-------AERNVPSY 113

Query: 118 INILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDA 177
           + ILEALSATGLRAIRYAHEIPHVKE++ANDLLPEA+ESI+RNV++N V NIVKPNLDDA
Sbjct: 114 MRILEALSATGLRAIRYAHEIPHVKEIVANDLLPEAIESIKRNVQFNGVENIVKPNLDDA 173

Query: 178 NVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEK 237
           NVLMYRNK+ N K+HVIDLDPYGTVTPFVDAA+QSIEE+GLMLVTCTDLSVLAGNGYPEK
Sbjct: 174 NVLMYRNKSENVKYHVIDLDPYGTVTPFVDAALQSIEENGLMLVTCTDLSVLAGNGYPEK 233

Query: 238 CFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTS 297
           CFALYGG NMVSHESTHESALRLVLNLL Q+AAKYKKTVEPLL LSIDFYVRVFVKV+TS
Sbjct: 234 CFALYGGVNMVSHESTHESALRLVLNLLSQSAAKYKKTVEPLLCLSIDFYVRVFVKVKTS 293

Query: 298 PIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFC 357
           PIEVKNL S TMTTYHCS+CGSYHNQPLGR ++R   K K   KYSVAQGPPVD +C+FC
Sbjct: 294 PIEVKNLQSKTMTTYHCSQCGSYHNQPLGRATERLNNKQKKSIKYSVAQGPPVDSKCKFC 353

Query: 358 DGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSP 417
            GTYHLAGPMY  PLHN+EFI+EVLRIN+EEH   DDTYGTRKRIEGML+LAK+E+ D+P
Sbjct: 354 GGTYHLAGPMYGAPLHNQEFIDEVLRINREEH--TDDTYGTRKRIEGMLTLAKSEIPDAP 411

Query: 418 FYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCD 477
           FYFSPNHI+S++KLQVPPLK+VVAGLGSLGY+CSLTHAQPSSLKTNAPW+AIWYVM++C 
Sbjct: 412 FYFSPNHISSILKLQVPPLKRVVAGLGSLGYDCSLTHAQPSSLKTNAPWEAIWYVMKQC- 470

Query: 478 DEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRY 537
           +E+KDL KMN N+TGYKILS   +WLSD+ +  +  +LSF PNEQSG +EKLRKLKIVRY
Sbjct: 471 EEQKDLQKMNQNSTGYKILSTEDRWLSDENREAFK-KLSFEPNEQSGQVEKLRKLKIVRY 529

Query: 538 QENPTKNWGPKARPN 552
           QENP+KNWGPKARPN
Sbjct: 530 QENPSKNWGPKARPN 544

>NDAI0J01300 Chr10 complement(303191..304963) [1773 bp, 590 aa] {ON}
           Anc_8.274 YDR120C
          Length = 590

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/576 (72%), Positives = 471/576 (81%), Gaps = 26/576 (4%)

Query: 1   MLRAAISKIKANLTAYGAP--------------RINIEDFNIVKEGKAEILFPKKETVFY 46
           M+RAA++KIK+ +  Y  P               I++ED+NI+KEG AEILFPK ETVFY
Sbjct: 19  MIRAALTKIKSKINTYIPPIQSQTQAQSHVEHKPIHVEDYNIIKEGSAEILFPKTETVFY 78

Query: 47  NPVQQFNRDLSVTCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNS--------DDSSKRQK 98
           NPVQQFNRDLSVTCIKAW NLYG   G              + S        DD  KR+K
Sbjct: 79  NPVQQFNRDLSVTCIKAWSNLYGSSSGSKNRKGRRDNNKKKRTSSEKDQEQKDDDLKRRK 138

Query: 99  MDNGSSKEIFEEANKKTPYINILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIR 158
           + NG+  EI        PYI ILEALSATGLRAIRYA+EIPHVKE+IANDLLP AVESI 
Sbjct: 139 LSNGNV-EITTTGIPTKPYIKILEALSATGLRAIRYANEIPHVKEIIANDLLPAAVESIS 197

Query: 159 RNVEYNNVGNIVKPNLDDANVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGL 218
           RN ++NNV +IVKPNLDDANVLMYRNKA NNK+H+IDLDPYGTVTPFVD+A+Q+IEEDG+
Sbjct: 198 RNAQFNNVSHIVKPNLDDANVLMYRNKAENNKYHIIDLDPYGTVTPFVDSALQTIEEDGM 257

Query: 219 MLVTCTDLSVLAGNGYPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEP 278
           MLVTCTDLSVLAGNGYPEKCFALYGG NMVSHESTHESALRLVLNLL Q+AAKYKK VEP
Sbjct: 258 MLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHESTHESALRLVLNLLNQSAAKYKKVVEP 317

Query: 279 LLSLSIDFYVRVFVKVRTSPIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKT 338
           LL LSIDFYVRVFVKVRTSPIEVK L S TM TYHCS+CGSYHNQPLGR+ +REGK  KT
Sbjct: 318 LLCLSIDFYVRVFVKVRTSPIEVKELQSKTMITYHCSQCGSYHNQPLGRMIEREGKNGKT 377

Query: 339 FTKYSVAQGPPVDIRCRFCDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGT 398
           FTKY VAQGPPVD +C+FC GTYH+AGPMYAG LHN+EFI+EVLRIN+EEH  +DDTYGT
Sbjct: 378 FTKYLVAQGPPVDSKCKFCRGTYHVAGPMYAGKLHNQEFIDEVLRINREEH--KDDTYGT 435

Query: 399 RKRIEGMLSLAKNELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPS 458
           RKRIEGM++LAKNELS++PFYFSPN IAS+IKLQVPPLK VVAGLGSLGY CSLTHAQPS
Sbjct: 436 RKRIEGMVTLAKNELSNAPFYFSPNKIASIIKLQVPPLKTVVAGLGSLGYNCSLTHAQPS 495

Query: 459 SLKTNAPWDAIWYVMQKCDDEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFT 518
           SLKTNAPW+ IWYVM++ DD KKD+SKMN NTTGYKILS++  W   +   +   +LSF 
Sbjct: 496 SLKTNAPWEVIWYVMKQFDDSKKDISKMNHNTTGYKILSSIDAWEPKENICDIS-KLSFE 554

Query: 519 PNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNAS 554
           PNE+S ++EKLRKLKIVRYQENPTKNWGPKARPN+S
Sbjct: 555 PNEESKHLEKLRKLKIVRYQENPTKNWGPKARPNSS 590

>Kpol_543.45 s543 complement(102294..103973) [1680 bp, 559 aa] {ON}
           complement(102294..103973) [1680 nt, 560 aa]
          Length = 559

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/561 (72%), Positives = 469/561 (83%), Gaps = 9/561 (1%)

Query: 1   MLRAAISKIKANLTAYGAPRINI--EDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSV 58
           ML+A  SKIK+ +      RI I  +D+NIVKEGKAEILFPKKETVFYNPVQQFNRDLSV
Sbjct: 1   MLQAVASKIKSKIFDSEPKRIEINPDDYNIVKEGKAEILFPKKETVFYNPVQQFNRDLSV 60

Query: 59  TCIKAWDNLYG-EDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPY 117
           TCIKAWDNLYG +  G              +  +D +K +++ +GS +EI    +K  PY
Sbjct: 61  TCIKAWDNLYGPKSSGNGKKSKKAQNKRSIEEDEDIAKIRRLADGSKQEI--STSKHAPY 118

Query: 118 INILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDA 177
           + ILEALSATGLRAIRYAHEIP+VKE++ANDLLPEAV+SIRRN EYN V NIVKPN+DDA
Sbjct: 119 LKILEALSATGLRAIRYAHEIPNVKEIVANDLLPEAVDSIRRNAEYNKVENIVKPNIDDA 178

Query: 178 NVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEK 237
           NVLMYRNK+ N ++HVIDLDPYGTVTPFVDAA+Q+IE+DGLMLVTCTDLSVLAGNGYPEK
Sbjct: 179 NVLMYRNKSTNTRYHVIDLDPYGTVTPFVDAALQTIEDDGLMLVTCTDLSVLAGNGYPEK 238

Query: 238 CFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTS 297
           CFALYGG NMVSHE+THESALRLVLNLL Q+AAKYKKT+EPLLSLSIDFYVRVF+KV+TS
Sbjct: 239 CFALYGGVNMVSHEATHESALRLVLNLLSQSAAKYKKTIEPLLSLSIDFYVRVFIKVKTS 298

Query: 298 PIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFC 357
           PI VKNL SNTM TYHCS+CGSYHNQ LGR+ +R GK  K F KY VAQGPPVD +C+FC
Sbjct: 299 PINVKNLQSNTMITYHCSQCGSYHNQHLGRIQERSGKNGKPFKKYLVAQGPPVDSKCKFC 358

Query: 358 DGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSP 417
            GTYHLAGPMYAG LHNKEF++EVLRINK EH +  D YGTRKRIEGM++LA  EL+D+P
Sbjct: 359 KGTYHLAGPMYAGALHNKEFLDEVLRINKVEHANMGDVYGTRKRIEGMVTLASKELADAP 418

Query: 418 FYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCD 477
           FYFSPN+I+S++KLQVPPLKKVVAGLGSLGY CSL+HAQPSSLKT+APW+AIWYVM++CD
Sbjct: 419 FYFSPNNISSILKLQVPPLKKVVAGLGSLGYNCSLSHAQPSSLKTDAPWEAIWYVMKECD 478

Query: 478 DEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDL----RLSFTPNEQSGNIEKLRKLK 533
           D++ +L KMNPNT GYKILS   +W+ ++      +     LSF  NEQSG +EKLRKLK
Sbjct: 479 DKEVNLEKMNPNTAGYKILSTFDQWMPEEEDGREPMFKKSDLSFKENEQSGAVEKLRKLK 538

Query: 534 IVRYQENPTKNWGPKARPNAS 554
           IVRYQENPTKNWGPKARPN+S
Sbjct: 539 IVRYQENPTKNWGPKARPNSS 559

>NCAS0B03760 Chr2 (672696..674336) [1641 bp, 546 aa] {ON} Anc_8.274
           YDR120C
          Length = 546

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/561 (72%), Positives = 466/561 (83%), Gaps = 22/561 (3%)

Query: 1   MLRAAISKIKANLTAYGAPR---INIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLS 57
           M+RAA +KIK+ +  Y  P+   IN+ED+NIVKEG AEILF KKETVFYNPVQQFNRDLS
Sbjct: 1   MIRAAFTKIKSKINTYIPPQQAQINVEDYNIVKEGSAEILFSKKETVFYNPVQQFNRDLS 60

Query: 58  VTCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPY 117
           VTCIKAWDNLYG                  Q+ D   KR+K++N S+K    + +    Y
Sbjct: 61  VTCIKAWDNLYGPRSNNKTQKK-------IQHMD---KRRKLNNSSAKNARSDNDS---Y 107

Query: 118 INILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDA 177
           +NILEALSATGLRAIRYA+EIPH+KE++ANDLLP AVESI RN +YNNV + V  NLDDA
Sbjct: 108 LNILEALSATGLRAIRYANEIPHIKEIVANDLLPAAVESINRNAQYNNVEDKVTGNLDDA 167

Query: 178 NVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEK 237
           NVLMYRNKA   K+HVIDLDPYGTVTPFVDAA+QSIEEDGLMLVTCTDLSVLAGNGYPEK
Sbjct: 168 NVLMYRNKAQGTKYHVIDLDPYGTVTPFVDAALQSIEEDGLMLVTCTDLSVLAGNGYPEK 227

Query: 238 CFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTS 297
           CFALYGG N+VSHE+THESALRLV+NLL Q+AAKYKK VEPLL LSIDFYVRVFVKVRTS
Sbjct: 228 CFALYGGVNLVSHEATHESALRLVINLLNQSAAKYKKVVEPLLCLSIDFYVRVFVKVRTS 287

Query: 298 PIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFC 357
           PIEVK L SNTM TYHCS+CGS  NQ LGR+ +REGK  K + KY+VAQGPPVD +C+FC
Sbjct: 288 PIEVKQLQSNTMVTYHCSQCGSLENQHLGRMLEREGKNGKKYIKYAVAQGPPVDTKCKFC 347

Query: 358 DGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSP 417
            GTYH+AGPMYAGPLHNK+FIEEVLRIN +EH   D+ YGTRKRIEGML+LA+NEL D+P
Sbjct: 348 QGTYHVAGPMYAGPLHNKKFIEEVLRINNDEH--IDEIYGTRKRIEGMLTLAQNELDDAP 405

Query: 418 FYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCD 477
           FYFSPN I+S+IKLQVPPLKKVVAGLGSLGY+CSLTHA+PSSLKTNAPW+A+WYV+ KCD
Sbjct: 406 FYFSPNKISSIIKLQVPPLKKVVAGLGSLGYDCSLTHAKPSSLKTNAPWEAVWYVLSKCD 465

Query: 478 DEKKDLSKMNPNTTGYKILSAMPKWL---SDDIKSEYDL-RLSFTPNEQSGNIEKLRKLK 533
           D  KD+SKMNPNT GYKILS + +WL    ++  S  D+ +L+F PNEQS ++EKLRKLK
Sbjct: 466 DTNKDISKMNPNTAGYKILSTIDEWLPKTPNEKNSNLDITKLTFEPNEQSEHLEKLRKLK 525

Query: 534 IVRYQENPTKNWGPKARPNAS 554
           IVRYQENPTKNWGPKARPN S
Sbjct: 526 IVRYQENPTKNWGPKARPNLS 546

>TPHA0A01730 Chr1 (350348..352003) [1656 bp, 551 aa] {ON} Anc_8.274
           YDR120C
          Length = 551

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/550 (70%), Positives = 457/550 (83%), Gaps = 18/550 (3%)

Query: 21  INIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTCIKAWDNLYGEDCGQX----- 75
           IN ED+N++ EGKA ILFPK ETVFYNP+QQFNRDLSVTCIKAWDNLYG           
Sbjct: 4   INPEDYNVITEGKANILFPKTETVFYNPIQQFNRDLSVTCIKAWDNLYGSKLPPSININN 63

Query: 76  ----XXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEE---ANKK--TPYINILEALSA 126
                         P  N + ++K +K+++GS  ++ +E    NKK   PYI ILEALSA
Sbjct: 64  KRVKNQNTEKENDEPVANEEITAKSRKLEDGSRGDVKDEIKRENKKETIPYIKILEALSA 123

Query: 127 TGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVLMYRNKA 186
           TGLRAIRYAHEIP+VKE+IANDLLP AV+SI+RNVEYN V  IVKPN+DDAN+LMYRN A
Sbjct: 124 TGLRAIRYAHEIPNVKEIIANDLLPAAVDSIKRNVEYNKVEAIVKPNIDDANILMYRNMA 183

Query: 187 INNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGAN 246
            N K+HVIDLDPYGT TPFVDAA+ SIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGG N
Sbjct: 184 SNTKYHVIDLDPYGTATPFVDAALHSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVN 243

Query: 247 MVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIEVKNLMS 306
           MVSHE+THESALRLVLNLL Q+AAKYKKT+ P+LSLSIDFYVRVFVKV+TSPI VKNLMS
Sbjct: 244 MVSHEATHESALRLVLNLLSQSAAKYKKTITPVLSLSIDFYVRVFVKVKTSPINVKNLMS 303

Query: 307 NTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGTYHLAGP 366
           NTM TYHC++CGSYHNQ LGRV +R  KK K F KY VA+GPPVD +C+FC GTYH+AGP
Sbjct: 304 NTMITYHCTQCGSYHNQSLGRVEERTTKKEKVFKKYLVAKGPPVDSKCKFCGGTYHIAGP 363

Query: 367 MYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYFSPNHIA 426
           MYAGPLH++ FI E+LRIN+E+H   DDTYGTRKRIEGM++LAKNEL +SPFYFSPN+++
Sbjct: 364 MYAGPLHDENFINEILRINEEDH--TDDTYGTRKRIEGMVTLAKNELKNSPFYFSPNNLS 421

Query: 427 SVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEKK--DLS 484
           S++KLQVPPLK++VAGLGSLGY CSLTHAQPSSLK++APW+AIWYVM++ D+E+K  D+ 
Sbjct: 422 SILKLQVPPLKRIVAGLGSLGYNCSLTHAQPSSLKSDAPWEAIWYVMKESDEERKNRDVD 481

Query: 485 KMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQENPTKN 544
            MN NT GY+IL+ + KW+S + +   + +L+F PNEQSG IEKLRKLKIVRYQENPTKN
Sbjct: 482 AMNHNTVGYRILNNIDKWISKEEQDTINEKLNFEPNEQSGKIEKLRKLKIVRYQENPTKN 541

Query: 545 WGPKARPNAS 554
           WGPKARPN+S
Sbjct: 542 WGPKARPNSS 551

>KAFR0B05430 Chr2 (1113972..1115672) [1701 bp, 566 aa] {ON}
           Anc_8.274 YDR120C
          Length = 566

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/569 (69%), Positives = 473/569 (83%), Gaps = 25/569 (4%)

Query: 1   MLRAAISKIKA-----NLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRD 55
           MLR+AI+KIK+     N+ A     I IEDF IVKEG AEILFPKKE VFYNP+QQFNRD
Sbjct: 1   MLRSAINKIKSSFLQKNIKAAAKNNIKIEDFKIVKEGSAEILFPKKEDVFYNPIQQFNRD 60

Query: 56  LSVTCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKT 115
           LSV CIKAWD +Y ++               +++S  +SK++K+++GS+  I EE  ++ 
Sbjct: 61  LSVMCIKAWDKMYRQEAQTKGNKR-------SKSSRFTSKKRKLEDGST--ITEEIKEQD 111

Query: 116 P--YINILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPN 173
           P  Y+ ILEALSATGLRAIRYA EIP+VKE++ANDL+P AV+SI+RN+ +N V ++VK N
Sbjct: 112 PEKYMRILEALSATGLRAIRYAKEIPNVKELVANDLIPAAVDSIQRNISFNEVDHLVKAN 171

Query: 174 LDDANVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNG 233
           LDDAN L+YR K  NN+FHVIDLDPYGTVTPF+DAA+Q+IEE+GL+LVTCTDLSVLAGNG
Sbjct: 172 LDDANALLYREKGQNNRFHVIDLDPYGTVTPFIDAALQNIEENGLLLVTCTDLSVLAGNG 231

Query: 234 YPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVK 293
           YPEKCFALYGG NMV+HE+THESALRLVLNL+ QTAAKYKKTV PLLSLSIDFYVRVFV+
Sbjct: 232 YPEKCFALYGGVNMVNHEATHESALRLVLNLINQTAAKYKKTVTPLLSLSIDFYVRVFVQ 291

Query: 294 VRTSPIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFT--KYSVAQGPPVD 351
           V+TSPIEVK+L S TM TYHC++CGSYHNQPLGR S+ E KK K  T  KYSVAQGPPVD
Sbjct: 292 VKTSPIEVKSLQSKTMITYHCTQCGSYHNQPLGRKSEVESKKKKNITQFKYSVAQGPPVD 351

Query: 352 IRCRFCDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKN 411
            +CR+C GTYHLAGPMYAGPLHN+EF++EVL+INKE+   Q+D YGT KRIEGML+LA N
Sbjct: 352 RKCRYCQGTYHLAGPMYAGPLHNEEFVKEVLKINKEDEKKQEDIYGTHKRIEGMLTLALN 411

Query: 412 ELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWY 471
           E++DSPFYFSPNH++S++KLQVP +KKV+AGLGSLG++CSLTHAQPSS+KTNAPW+AIWY
Sbjct: 412 EVADSPFYFSPNHVSSILKLQVPQMKKVIAGLGSLGFQCSLTHAQPSSIKTNAPWEAIWY 471

Query: 472 VMQKCDDEKKDLSKMNPNTTGYKILSAMPKWL---SDDIKSEYDL---RLSFTPNEQSGN 525
           VM++CD E KD+S+MNPNT GYKILS M  WL   SD+IKS       +LSF  NEQSGN
Sbjct: 472 VMRQCDSE-KDVSRMNPNTAGYKILSTMSSWLPSPSDEIKSSVFFDSSKLSFEENEQSGN 530

Query: 526 IEKLRKLKIVRYQENPTKNWGPKARPNAS 554
           +EKLRKLKIVRYQENPTKNWGPKARPN S
Sbjct: 531 VEKLRKLKIVRYQENPTKNWGPKARPNPS 559

>KNAG0H03160 Chr8 (593242..594861) [1620 bp, 539 aa] {ON} Anc_8.274
           YDR120C
          Length = 539

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/535 (70%), Positives = 428/535 (80%), Gaps = 24/535 (4%)

Query: 21  INIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTCIKAWDNLYGEDCGQXXXXXX 80
           +N+EDFN+V+EGKA+ILFPK+ETVFYNPVQQFNRDLSVTCIKAWDNLYG           
Sbjct: 28  LNVEDFNVVEEGKAQILFPKRETVFYNPVQQFNRDLSVTCIKAWDNLYG----------- 76

Query: 81  XXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINILEALSATGLRAIRYAHEIPH 140
                P      S KR+K  +GS++   E       Y+ ILEALSATGLRAIRYA+E+PH
Sbjct: 77  ----FPQHRQGPSRKRRKTADGSTRATGER------YMRILEALSATGLRAIRYANELPH 126

Query: 141 VKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVLMYRNKAINNKFHVIDLDPYG 200
           +++V+ANDLLP AVESI RN  YN    +V+ N DDANVLM+R  A   KFHV+DLDPYG
Sbjct: 127 IQKVVANDLLPAAVESIARNARYNGTQQLVQANEDDANVLMHRETAQGRKFHVVDLDPYG 186

Query: 201 TVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHESTHESALRL 260
           TVTPFVDAA+QS+E+ GLMLVTCTDLSVLAGNGYPEKCFALYGG NMVSHE+THESALRL
Sbjct: 187 TVTPFVDAAVQSVEDGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHEATHESALRL 246

Query: 261 VLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIEVKNLMSNTMTTYHCSRCGSY 320
           V+ LL  TAAKYKK VEPLL LSIDFYVRVFV+V TSP+ VKNL SNTM TYHCS+CGS 
Sbjct: 247 VVQLLAATAAKYKKNVEPLLCLSIDFYVRVFVRVTTSPLAVKNLQSNTMVTYHCSQCGSV 306

Query: 321 HNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGTYHLAGPMYAGPLHNKEFIEE 380
           HNQ LGR+S+REGKK KT  KYSVAQGPPVD RC+FC G +HLAGPMY GPLHN+EFIEE
Sbjct: 307 HNQFLGRISEREGKKGKTIVKYSVAQGPPVDRRCQFCGGAFHLAGPMYGGPLHNREFIEE 366

Query: 381 VLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYFSPNHIASVIKLQVPPLKKVV 440
           VLRIN EEH   D TY TRKRIEGM +LA NEL  +PFYFSPN ++SV+KLQVPPLK V 
Sbjct: 367 VLRINSEEH--TDSTYKTRKRIEGMATLALNELPQAPFYFSPNMVSSVLKLQVPPLKTVA 424

Query: 441 AGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEKKDLSKMNPNTTGYKILSAMP 500
           AGLGSLGY CSLTHAQPSSLKT+APW+AIWY + KC  E +D +K+N  T GYKILS + 
Sbjct: 425 AGLGSLGYNCSLTHAQPSSLKTDAPWEAIWYTLSKCAPEGRDFTKLNERTPGYKILSRID 484

Query: 501 KWLSDDIKSEYD-LRLSFTPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNAS 554
           +W++   +  +D  +LSF PNEQSG IE LRKLKIVRYQENPTKNWGPKARP +S
Sbjct: 485 QWMAARPEDSFDPEQLSFEPNEQSGKIESLRKLKIVRYQENPTKNWGPKARPQSS 539

>ZYRO0D06886g Chr4 (592600..594222) [1623 bp, 540 aa] {ON} similar
           to uniprot|P15565 Saccharomyces cerevisiae YDR120C TRM1
           tRNA methyltransferase localizes to both the nucleus and
           mitochondrion to produce the modified base N2
           N2-dimethylguanosine in tRNAs in both compartments
          Length = 540

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/537 (70%), Positives = 446/537 (83%), Gaps = 30/537 (5%)

Query: 21  INIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTCIKAWDNLYGEDCGQXXXXXX 80
            N+EDFN+VKEGKAEILFPKK+TVFYNP+QQFNRDLSV CIKAWD LY E+         
Sbjct: 31  FNLEDFNVVKEGKAEILFPKKDTVFYNPIQQFNRDLSVCCIKAWDQLYREN--------- 81

Query: 81  XXXXXPAQNSDDS--SKRQKMDNGSSKEIFEEANKKTPYINILEALSATGLRAIRYAHEI 138
                  ++S+D    KR+K++           N    Y+ ILEALSATGLRAIRYAHEI
Sbjct: 82  KHKKGSKRSSEDEPLEKRRKINTD---------NDDRRYMRILEALSATGLRAIRYAHEI 132

Query: 139 PHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVLMYRNKAINNKFHVIDLDP 198
           P VK+++ANDLLPEAVESIRRN EYN+V  +V+PN DDANVLMYRNKA+N K+HVIDLDP
Sbjct: 133 PRVKKIVANDLLPEAVESIRRNAEYNHVEELVEPNTDDANVLMYRNKALNQKYHVIDLDP 192

Query: 199 YGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHESTHESAL 258
           YGTVTPF+D+++Q+IEEDGLMLVTCTDLSVLAGNGYPEKCFALYGG NMVSHE+THESAL
Sbjct: 193 YGTVTPFIDSSLQAIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHEATHESAL 252

Query: 259 RLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIEVKNLMSNTMTTYHCSRCG 318
           RLVL+ L Q+AAKYKKTVEPLLSLSIDFYVRVFV++RTSPIEVKNL +NTMT YHCS+CG
Sbjct: 253 RLVLHQLGQSAAKYKKTVEPLLSLSIDFYVRVFVRIRTSPIEVKNLQANTMTVYHCSQCG 312

Query: 319 SYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGTYHLAGPMYAGPLHNKEFI 378
           S+H QPLGR S++  KK++   KYSVAQGPPVD +C+FCDGTYHLAGPMY GPLHNKEFI
Sbjct: 313 SFHEQPLGRTSEKVTKKNQPIKKYSVAQGPPVDSKCKFCDGTYHLAGPMYGGPLHNKEFI 372

Query: 379 EEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYFSPNHIASVIKLQVPPLKK 438
           E+VL++N   +HD DDTYGTR+RIEGML+LA+NE+ ++PFYFSPNH++S++KLQVPPLKK
Sbjct: 373 EKVLQVN--ANHD-DDTYGTRRRIEGMLALAQNEIPNAPFYFSPNHLSSILKLQVPPLKK 429

Query: 439 VVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCDDEKKDLSKMNPNTTGYKILSA 498
           +VAGLGSLGYECSLTHAQPSS+KT+APW+AIWYV+   DD+  +  K+  N+ G++IL+ 
Sbjct: 430 IVAGLGSLGYECSLTHAQPSSIKTDAPWEAIWYVVAHSDDQLHN-KKLKENSIGHRILNN 488

Query: 499 MPKWLSD-DIKSEYDLRLSFTPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNAS 554
           M  W  D D K+     LS+ PN+QSG +E LRKLKIVRYQENPTKNWGPKARP +S
Sbjct: 489 MKSWSKDQDFKT-----LSYEPNDQSGKVESLRKLKIVRYQENPTKNWGPKARPTSS 540

>SAKL0H16764g Chr8 (1474162..1475790) [1629 bp, 542 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19404g Kluyveromyces lactis
           KLLA0F19404g and similar to YDR120C uniprot|P15565
           Saccharomyces cerevisiae YDR120C TRM1 tRNA
           methyltransferase localizes to both the nucleus and
           mitochondrion to produce the modified base N2 N2-
           dimethylguanosine in tRNAs in both compartments
          Length = 542

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/558 (68%), Positives = 452/558 (81%), Gaps = 24/558 (4%)

Query: 1   MLRAAISKIKANL----TAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDL 56
           M+RAA++KI              +IN +D+NI+ EGKA ILFP+KETVFYNP+QQFNRDL
Sbjct: 1   MIRAALNKITKRFCRPSVTPSTTKINPDDYNIITEGKAHILFPEKETVFYNPIQQFNRDL 60

Query: 57  SVTCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTP 116
           SVTCIKAWDNLYG +  Q           P +   +SSK++K+++GS+    E      P
Sbjct: 61  SVTCIKAWDNLYG-NLKQTRKGRKRSLQSPGE---ESSKKRKLEDGSA----ETQTSSRP 112

Query: 117 YINILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDD 176
           YI ILEALSATGLRAIRYAHEI +VKE++ANDLLP AVESI++NVEYN V  IVKPNLDD
Sbjct: 113 YIKILEALSATGLRAIRYAHEISNVKEIVANDLLPAAVESIKKNVEYNKVEKIVKPNLDD 172

Query: 177 ANVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPE 236
           ANVLMYRNK+ N ++HVIDLDPYGT TPF+DAA+Q+I+++GLMLVTCTDLSVLAGNGYPE
Sbjct: 173 ANVLMYRNKSTNTRYHVIDLDPYGTATPFIDAAMQTIDDEGLMLVTCTDLSVLAGNGYPE 232

Query: 237 KCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRT 296
           KCFALYGG N+  H++THESALRLVLNLL Q+AAKYKK++EPLLSLSIDFYVRVF+KVRT
Sbjct: 233 KCFALYGGTNLAGHDATHESALRLVLNLLGQSAAKYKKSIEPLLSLSIDFYVRVFIKVRT 292

Query: 297 SPIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRF 356
           +P EVKNL  NTM TY CS CGSYHNQ LGR ++RE KK K + KYS+AQGPPV++RC F
Sbjct: 293 NPTEVKNLQHNTMVTYMCSGCGSYHNQRLGRQTKRESKKGKEYLKYSLAQGPPVNVRCNF 352

Query: 357 CDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDS 416
           C G +H+ GPMYAG LHNKEFI EVLRINKEEH   D+ YGTRKRIEGML+LA+NEL ++
Sbjct: 353 CGGAHHIVGPMYAGSLHNKEFINEVLRINKEEH--GDEVYGTRKRIEGMLTLARNEL-ET 409

Query: 417 PFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQK- 475
           PFYF+PN ++SV+K QVP LK VVAGLGSLGYECSLTHAQPSSLKTNAPW+ IWYVM+K 
Sbjct: 410 PFYFTPNRVSSVLKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTNAPWETIWYVMKKY 469

Query: 476 CDDEKK-DLSKMNPNTTGYKILSAMPKWLSDDIKS-EYDLRLSFTPNEQSGNIEKLRKLK 533
           C D K  +L KMN N+ GYKIL+      +D+I S + + +LSF PN+QSG +EKLRKLK
Sbjct: 470 CTDNKLCNLEKMNKNSFGYKILT------NDEIGSKDSESKLSFEPNDQSGRVEKLRKLK 523

Query: 534 IVRYQENPTKNWGPKARP 551
           IVRYQENPTKNWGPKARP
Sbjct: 524 IVRYQENPTKNWGPKARP 541

>Kwal_56.23747 s56 (687620..689245) [1626 bp, 541 aa] {ON} YDR120C
           (TRM1) - N2,N2-dimethylguanosine-specific tRNA
           methyltransferase [contig 173] FULL
          Length = 541

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/555 (69%), Positives = 458/555 (82%), Gaps = 19/555 (3%)

Query: 1   MLRAAISKIKANLTAYGAPRI--NIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSV 58
           M+RAA++K++     +  P I  + + F IV EGKA ILFP+KETVFYNP+QQFNRDLSV
Sbjct: 1   MIRAALTKVR---NRFLKPVIKPDADKFTIVTEGKAHILFPEKETVFYNPIQQFNRDLSV 57

Query: 59  TCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYI 118
           +CIKAWDNLYG+   +               S++SSK++K+D+GS+  + + AN+  PYI
Sbjct: 58  SCIKAWDNLYGQP--KQERSKSKGKKRGMDESEESSKKRKLDDGSASHV-KAANR--PYI 112

Query: 119 NILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDAN 178
            ILEALSATGLRAIRYAHEIP+VKEVIANDLLPEAVE+I+RNV+YN+VG+IVKPN+DDAN
Sbjct: 113 KILEALSATGLRAIRYAHEIPNVKEVIANDLLPEAVEAIQRNVDYNDVGHIVKPNIDDAN 172

Query: 179 VLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKC 238
           VLMYRNKA + K+HVIDLDPYGT TPF+DAA+Q+IEEDGLMLVTCTDLSVLAGNGYPEKC
Sbjct: 173 VLMYRNKANHKKYHVIDLDPYGTATPFIDAALQNIEEDGLMLVTCTDLSVLAGNGYPEKC 232

Query: 239 FALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSP 298
           FALYGG NM  H++THESALRLVLNLL Q+AAKYKKTVEPLLSLSIDFYVRVFVKV+T+P
Sbjct: 233 FALYGGVNMAGHDATHESALRLVLNLLSQSAAKYKKTVEPLLSLSIDFYVRVFVKVKTNP 292

Query: 299 IEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCD 358
             VKNL  NTM TY CS C SYHNQ LG+ SQRE KK K + KYS+AQGPPVD +C+FC 
Sbjct: 293 TLVKNLQHNTMVTYVCSGCRSYHNQRLGKQSQRESKKGKPYLKYSLAQGPPVDKKCQFCG 352

Query: 359 GTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPF 418
           G++H+ GPMYAGPLHN+EFI+EVLRIN E H   DD Y TRKRIEGML+LAKNE+ D+PF
Sbjct: 353 GSHHITGPMYAGPLHNREFIDEVLRINSEVH--DDDVYKTRKRIEGMLTLAKNEV-DAPF 409

Query: 419 YFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQK--C 476
           YF+PN ++S++K QVP LK VVAGLGSLGYECSLTHAQPSSLKT+APWDAIWYVM++   
Sbjct: 410 YFTPNRVSSILKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTDAPWDAIWYVMKRYCL 469

Query: 477 DDEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKLKIVR 536
           D++  ++ KMN N+ GYKIL+     +SD  + +Y   LSF PNEQSG +EKLRKLKIVR
Sbjct: 470 DNDLCNVEKMNQNSWGYKILTN--DAVSD--QDKYKEMLSFEPNEQSGKVEKLRKLKIVR 525

Query: 537 YQENPTKNWGPKARP 551
           YQENPTKNWGPK+RP
Sbjct: 526 YQENPTKNWGPKSRP 540

>KLTH0G13420g Chr7 (1151037..1152665) [1629 bp, 542 aa] {ON} similar
           to uniprot|P15565 Saccharomyces cerevisiae YDR120C TRM1
           tRNA methyltransferase localizes to both the nucleus and
           mitochondrion to produce the modified base N2
           N2-dimethylguanosine in tRNAs in both compartments
          Length = 542

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/556 (66%), Positives = 457/556 (82%), Gaps = 20/556 (3%)

Query: 1   MLRAAISKIKANLTAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSVTC 60
           M+RAA++K+++      AP+ +   F +V EGKA ILFP+KETVFYNP+QQFNRDLSV+C
Sbjct: 1   MIRAALAKVRSRFVK-PAPKPDASKFTVVTEGKAHILFPEKETVFYNPIQQFNRDLSVSC 59

Query: 61  IKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYINI 120
           IKAWDNLYG+   +             ++ +++SK++K+++GSS E+  +A+   PYI I
Sbjct: 60  IKAWDNLYGQ--AKQEKSRGKGKKRGLEHGEEASKKRKLEDGSSAEV--KASSSRPYIKI 115

Query: 121 LEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVL 180
           LEALSATGLRAIRYAHEIP+VKEV+ANDLLPEAV++I+RNV+YN VG+IVKPN+DDANVL
Sbjct: 116 LEALSATGLRAIRYAHEIPNVKEVVANDLLPEAVDAIQRNVDYNKVGHIVKPNIDDANVL 175

Query: 181 MYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFA 240
           MYRNKA + ++HVIDLDPYGT TPF+DAA+Q+IE+DGLMLVTCTDLSVLAGNGYPEKCFA
Sbjct: 176 MYRNKAAHKRYHVIDLDPYGTATPFIDAALQNIEDDGLMLVTCTDLSVLAGNGYPEKCFA 235

Query: 241 LYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIE 300
           LYGG NM  H++THESALRLVLNLL Q+AAKYKK++EPLLSLSIDFYVRVFVKV+T+P +
Sbjct: 236 LYGGVNMAGHDATHESALRLVLNLLGQSAAKYKKSIEPLLSLSIDFYVRVFVKVKTNPTK 295

Query: 301 VKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPVDIRCRFCDGT 360
           VK+L  NTM TY CS C SYH+Q LG+ ++RE KK K + KYS+AQGPPVD +C +C G 
Sbjct: 296 VKDLQHNTMITYVCSGCRSYHSQRLGKQTERESKKGKPYLKYSLAQGPPVDKKCHYCGGA 355

Query: 361 YHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYF 420
           +HL GPMYAGPLHN+EFI+EVLRIN++ H   DD Y TRKRIEGML+LAKNE+ D+PFYF
Sbjct: 356 HHLTGPMYAGPLHNREFIDEVLRINRDVH--GDDVYKTRKRIEGMLTLAKNEV-DAPFYF 412

Query: 421 SPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQK--CDD 478
           +PN ++S++K QVP LK VVAGLGSLGYECSLTHAQPSSLKT+APW AIWYVM++   D+
Sbjct: 413 TPNRVSSILKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTDAPWGAIWYVMKRYCLDN 472

Query: 479 EKKDLSKMNPNTTGYKILSAMPKWLSDDIKSE---YDLRLSFTPNEQSGNIEKLRKLKIV 535
              ++ KMN N+ GYKI       LS+D+ +E   Y  +LSF PN+QSG +EKLRKLKIV
Sbjct: 473 GLCNVEKMNQNSWGYKI-------LSNDLVAEAAQYGDQLSFEPNDQSGRVEKLRKLKIV 525

Query: 536 RYQENPTKNWGPKARP 551
           RYQENPTKNWGPKARP
Sbjct: 526 RYQENPTKNWGPKARP 541

>TBLA0H01440 Chr8 (319130..320920) [1791 bp, 596 aa] {ON} Anc_8.274
           YDR120C
          Length = 596

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/599 (65%), Positives = 461/599 (76%), Gaps = 48/599 (8%)

Query: 1   MLRAAISKIKANLTAYGA--PRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSV 58
           ML+A ++ IK  L +      +I+ +D+NI+KEG+AEILFPK+ETVFYNP+QQFNRDLSV
Sbjct: 1   MLKA-VTSIKNKLISLKNLNSKISPDDYNIIKEGRAEILFPKEETVFYNPIQQFNRDLSV 59

Query: 59  TCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSS-----KRQKMDNGSSKEIFEEANK 113
           TCIKAW+NLYG                 A    DS      K +K+++GS +   E    
Sbjct: 60  TCIKAWNNLYGPKAKNNRKTVIKPSHKRANEDSDSDDQTSIKHRKLEDGSVQ--VETFVH 117

Query: 114 KTPYINILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPN 173
           + PY+ ILEALSATGLRAIRYA EIP+VKE++ANDLLPEAVESIRRN +YNNV +IVKPN
Sbjct: 118 RKPYLKILEALSATGLRAIRYAKEIPNVKEIVANDLLPEAVESIRRNAQYNNVLDIVKPN 177

Query: 174 LDDANVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNG 233
            DDANVLMYRNKA N K+H+IDLDPYGTVTPFVDAA Q+IE+DGLMLVTCTDLSVLAGNG
Sbjct: 178 QDDANVLMYRNKAQNKKYHIIDLDPYGTVTPFVDAAFQNIEDDGLMLVTCTDLSVLAGNG 237

Query: 234 YPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVK 293
           YPEKCFALYGG NM+SHE+THESALRLVLNLL QTAAKYKK++EPLLSLSIDFYVRVF+K
Sbjct: 238 YPEKCFALYGGVNMISHEATHESALRLVLNLLGQTAAKYKKSIEPLLSLSIDFYVRVFIK 297

Query: 294 VRTSPIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKK-SKTFTKYSVAQGPPVDI 352
           V+TSPI+VK+L SNTM TYHCS CGS+ NQPLGR S++ GKK SK + K++ A GPPV+ 
Sbjct: 298 VKTSPIKVKDLQSNTMITYHCSNCGSFANQPLGRKSEKVGKKSSKPYVKFAPASGPPVNE 357

Query: 353 RCRFCDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDD---TYGTRKRIEGMLSLA 409
           +C+FCDGT+HLAGPMYAG LHN EF++EVLRINKEEH  + +    YGT KRIEGM++LA
Sbjct: 358 KCQFCDGTFHLAGPMYAGSLHNDEFVKEVLRINKEEHSKKKEFEGVYGTTKRIEGMVTLA 417

Query: 410 KNELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAI 469
             EL D+PFYFSPN+++S+IKLQVPPLK++VAGLGSLGY+ SL+HA+ S LKTNAPW+AI
Sbjct: 418 AQELKDAPFYFSPNNVSSIIKLQVPPLKRIVAGLGSLGYQSSLSHAKHSCLKTNAPWEAI 477

Query: 470 WYVM---QKCD----DEKKDLSKMNPNTTGYKILSAMPKWL---SDDIKSE--------- 510
           WYVM   QK D    D  K LSKMN NT GYKILS M +WL    D I  E         
Sbjct: 478 WYVMRESQKIDFPDIDMNKKLSKMNKNTAGYKILSKMNEWLPKEEDSIAKENKNADEKPK 537

Query: 511 --------------YDL-RLSFTPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNAS 554
                         +D+ +LSF PNEQS  +E LR LK+VRYQENPTKNWGPKARPN+S
Sbjct: 538 KDYGEIDYSRKNNSFDITKLSFEPNEQSNKVEGLRHLKMVRYQENPTKNWGPKARPNSS 596

>CAGL0B01881g Chr2 complement(172860..174521) [1662 bp, 553 aa] {ON}
           highly similar to uniprot|Q9URQ8 Saccharomyces
           cerevisiae YDR120c TRM1
          Length = 553

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/568 (66%), Positives = 445/568 (78%), Gaps = 36/568 (6%)

Query: 1   MLRAAISKIKANLTAYGAPRINIE--DFNIVKEGKAEILFPKKETVFYNPVQQFNRDLSV 58
           ML+AA SK++ NL     P + ++  DF IV EGKA+ILFPK+E VFYNP+QQFNRDLSV
Sbjct: 4   MLKAAFSKVRNNLFKGQLPAVAVDPSDFTIVTEGKADILFPKQEEVFYNPIQQFNRDLSV 63

Query: 59  TCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEEANKKTPYI 118
           TCI+AWD+LYG                   +S+  +KR+K+D           +++  YI
Sbjct: 64  TCIQAWDHLYGSKLKSHRQRKRT-------SSEPEAKRRKLD---------PKDEEHRYI 107

Query: 119 NILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDAN 178
            ILEALSATGLRAIRYA EIPHVKE+IANDLLP AV+SI+RN++YN V +IV  N DDAN
Sbjct: 108 TILEALSATGLRAIRYAKEIPHVKEIIANDLLPAAVKSIQRNIDYNGVQDIVTANQDDAN 167

Query: 179 VLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKC 238
           VLMYRNK+ N K+HVIDLDPYGTVTPF+DAA+QSIEEDGLMLVTCTDLSVLAGNGYPEKC
Sbjct: 168 VLMYRNKSDNKKYHVIDLDPYGTVTPFIDAALQSIEEDGLMLVTCTDLSVLAGNGYPEKC 227

Query: 239 FALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSP 298
           FALYGG NMVSH++THESALRLVLNLL Q+AAKYKK VEPLLSLSIDFYVRVFVKV+TSP
Sbjct: 228 FALYGGVNMVSHDATHESALRLVLNLLNQSAAKYKKHVEPLLSLSIDFYVRVFVKVKTSP 287

Query: 299 IEVKNLMSNTMTTYHCSRCGSYHNQPLGRV--SQREGKKSKTFTKYSVAQGPPVDIRCRF 356
           I+VK L SNTM TYHCS+CGS+ NQ LGR    Q   KK +T TK+SVAQGPP+D +C+F
Sbjct: 288 IKVKELQSNTMITYHCSQCGSFANQKLGRKVDKQSRKKKQQTITKFSVAQGPPIDSKCQF 347

Query: 357 CDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELS-- 414
           C GT  LAGPMYAGPLHN EFIEEVL+IN++   ++D  YGT++RI+GML+LAKNEL+  
Sbjct: 348 CGGTSLLAGPMYAGPLHNHEFIEEVLKINEKRFKEKDTVYGTKERIKGMLTLAKNELNHD 407

Query: 415 DSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQ 474
            S FYFSPN ++S+IKLQVP LK + AGLGSLG+ECSLTHAQPS++KTNAPWDAIWYVM+
Sbjct: 408 GSQFYFSPNTLSSLIKLQVPALKTIAAGLGSLGFECSLTHAQPSTIKTNAPWDAIWYVMK 467

Query: 475 KCDDEKKD-----LSKMNPNTTGYKILSAMPKWLSDDIKSEYDL----RLSFTPNEQSGN 525
           KC + K+D     L  M     GY+IL    K+L D+ K  YD     +LSF PNE SG+
Sbjct: 468 KCHENKEDYQGRNLEDMPEKGIGYRIL----KYLEDN-KEHYDQLYGEKLSFAPNETSGS 522

Query: 526 IEKLRKLKIVRYQENPTKNWGPKARPNA 553
           IEKLRKLKIVRYQENPTKNWGPKARP+ 
Sbjct: 523 IEKLRKLKIVRYQENPTKNWGPKARPSG 550

>Ecym_4296 Chr4 (633567..635252) [1686 bp, 561 aa] {ON} similar to
           Ashbya gossypii AGR075W
          Length = 561

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/566 (64%), Positives = 444/566 (78%), Gaps = 21/566 (3%)

Query: 1   MLRAAISKIKANLTAYGA---------PRINIEDFNIVKEGKAEILFPKKETVFYNPVQQ 51
           MLRAA+ K+KANL    +         P IN+ DFN+V EGKA+ILFP+KETVFYNPVQQ
Sbjct: 1   MLRAALHKLKANLGTGSSSRNANTPSKPAINLSDFNVVTEGKAQILFPEKETVFYNPVQQ 60

Query: 52  FNRDLSVTCIKAWDNLYG--EDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFE 109
           FNRDLS+TCIKAWDNLYG   D                     S+K++++ +G+  +   
Sbjct: 61  FNRDLSITCIKAWDNLYGTTNDGNSTKASYTNNKRSFDGIESGSTKKRRITDGAGNDGAI 120

Query: 110 EANK--KTPYINILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVG 167
           ++N     PY+ ILEALSATGLRAIRYAHEIP+ K+++ANDLL +AVESI+RNV++N+V 
Sbjct: 121 KSNSPPGLPYMRILEALSATGLRAIRYAHEIPNAKQIVANDLLADAVESIKRNVQFNDVS 180

Query: 168 NIVKPNLDDANVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLS 227
           NIV PN DDANVLMYR K+   KFHVIDLDPYGT TPF+D+++Q IE+ GLMLVTCTDLS
Sbjct: 181 NIVTPNKDDANVLMYRTKSEGGKFHVIDLDPYGTATPFIDSSMQCIEDGGLMLVTCTDLS 240

Query: 228 VLAGNGYPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFY 287
           VLAGNGYPEKCFALYGG NM  H++THESA+RLVLNLL  +AAKYKK++EPLLSLSIDFY
Sbjct: 241 VLAGNGYPEKCFALYGGVNMAGHDATHESAIRLVLNLLGSSAAKYKKSIEPLLSLSIDFY 300

Query: 288 VRVFVKVRTSPIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQG 347
           +RVF++VRTSP EVKNL +NTMT Y CS CGSYH Q LG+ S+R  KK K F KYS+AQG
Sbjct: 301 IRVFIRVRTSPTEVKNLQNNTMTGYMCSGCGSYHTQRLGKQSERVSKKGKAFIKYSLAQG 360

Query: 348 PPVDIRCRFCDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLS 407
           PPVD  C++C   +H+ GPMYAG LHN++F++EVLRIN+EEH+D+   YGTRKRIEGML+
Sbjct: 361 PPVDRNCKYCRAVHHVVGPMYAGTLHNQQFLDEVLRINREEHNDE--VYGTRKRIEGMLT 418

Query: 408 LAKNELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWD 467
           LAKNEL + PFYFSPN ++S++K QVPPLK +VAGLGSLGY  SLTHA+ SSLKT+APWD
Sbjct: 419 LAKNEL-NVPFYFSPNSLSSILKFQVPPLKTIVAGLGSLGYTSSLTHAKASSLKTDAPWD 477

Query: 468 AIWYVMQK--CDDEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGN 525
           A+WYVM+K   D++  D++KMN N  GYKIL+      S+ +   +D +LSF PNEQSG 
Sbjct: 478 AVWYVMKKYCLDNDLVDINKMNTNGRGYKILTNDQICGSEHM---WDEKLSFDPNEQSGK 534

Query: 526 IEKLRKLKIVRYQENPTKNWGPKARP 551
           +EKLRKLK+VRYQENPTKNWGPKA+P
Sbjct: 535 VEKLRKLKMVRYQENPTKNWGPKAKP 560

>AGR075W Chr7 (869459..871141) [1683 bp, 560 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR120C (TRM1)
          Length = 560

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/567 (64%), Positives = 436/567 (76%), Gaps = 24/567 (4%)

Query: 1   MLRAAISKIKANLTAYGAP----------RINIEDFNIVKEGKAEILFPKKETVFYNPVQ 50
           M RAAI K+KAN      P          +IN+ ++N+V EGKA+ILFP+KETVFYNP+Q
Sbjct: 1   MFRAAIQKLKANFVGSPTPLASSAPASKAQINLAEYNVVSEGKAQILFPEKETVFYNPIQ 60

Query: 51  QFNRDLSVTCIKAWDNLYGEDCGQXXXXXXXXXXXPAQNSDDSSKRQKMDNGSSKEIFEE 110
           QFNRDLSVTCIKAWDNLYG    +                 +++K++K+   +SKE  + 
Sbjct: 61  QFNRDLSVTCIKAWDNLYGSKAIRGKRVGSNGKRSFDGTDQEATKKRKL--AASKEAVDP 118

Query: 111 ANKKTP----YINILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNV 166
               +     YI +LEALSATGLRAIRYAHEIPHVK ++ANDLLPEAV+SIRRN++YN++
Sbjct: 119 TGSGSDDPGRYIKVLEALSATGLRAIRYAHEIPHVKNIVANDLLPEAVDSIRRNIDYNHL 178

Query: 167 GNIVKPNLDDANVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDL 226
            +++  N DDANVLMYR+KA   KFHVIDLDPYGT TPF+DA++QSIEE GLMLVTCTDL
Sbjct: 179 SHLITANQDDANVLMYRSKAEGKKFHVIDLDPYGTATPFIDASLQSIEEGGLMLVTCTDL 238

Query: 227 SVLAGNGYPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDF 286
           SVLAGNGYPEKCFALYGG NM  H++THESALRLVLNLL Q+AAK KK +EPLLSLSIDF
Sbjct: 239 SVLAGNGYPEKCFALYGGVNMAGHDATHESALRLVLNLLSQSAAKQKKYIEPLLSLSIDF 298

Query: 287 YVRVFVKVRTSPIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQ 346
           YVRVFV+VRTSP EVKNL  NTM  Y CS C ++H Q LG+ SQR  KK K +TKYS+AQ
Sbjct: 299 YVRVFVRVRTSPSEVKNLQHNTMIGYMCSGCSAWHTQRLGKQSQRASKKGKPYTKYSLAQ 358

Query: 347 GPPVDIRCRFCDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGML 406
           GPP D RC +C   +H+ GPMYAGPLHN EFI+EVLRIN+EEH  QDD YGTRKRI+GML
Sbjct: 359 GPPADKRCHYCGSPHHVFGPMYAGPLHNHEFIDEVLRINEEEH--QDDIYGTRKRIKGML 416

Query: 407 SLAKNELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPW 466
           +LA+NEL + PFYF P  I+S++K QVPPLK VVAGLGSLGY CSLTHA+ SSLKTNAPW
Sbjct: 417 TLARNELPE-PFYFVPTSISSILKFQVPPLKTVVAGLGSLGYACSLTHAKASSLKTNAPW 475

Query: 467 DAIWYVMQK--CDDEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSG 524
           DAIWYVM++   D+E  D+ KMN N  GYKIL+       D    E+  +LSF+PN+QS 
Sbjct: 476 DAIWYVMKRYCLDNELADIKKMNQNGFGYKILTNES---IDGSTDEWAEKLSFSPNQQSI 532

Query: 525 NIEKLRKLKIVRYQENPTKNWGPKARP 551
           ++E+LRKLKIVRYQENPTKNWGPKARP
Sbjct: 533 DLERLRKLKIVRYQENPTKNWGPKARP 559

>KLLA0F19404g Chr6 complement(1796569..1798242) [1674 bp, 557 aa]
           {ON} similar to uniprot|P15565 Saccharomyces cerevisiae
           YDR120C TRM1 tRNA methyltransferase localizes to both
           the nucleus and mitochondrion to produce the modified
           base N2 N2-dimethylguanosine in tRNAs in both
           compartments
          Length = 557

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/563 (64%), Positives = 436/563 (77%), Gaps = 19/563 (3%)

Query: 1   MLRAAISKIKANL---TAYGAPRINIEDFNIVKEGKAEILFPKKETVFYNPVQQFNRDLS 57
           MLRAA   +K+         +  I++  F +V+EG A+ILFP KETVFYNP+QQFNRDLS
Sbjct: 1   MLRAAFQSLKSKFGRKVTLDSSTIDVSQFKVVQEGDAKILFPNKETVFYNPIQQFNRDLS 60

Query: 58  VTCIKAWDNLYGEDCGQXXX-XXXXXXXXPAQNSDDSS-----KRQKM-DNGSSKEIFEE 110
           VTCIKAWD LY E+  +            P ++++D S     KR+K+ ++  S  +  +
Sbjct: 61  VTCIKAWDELYQEEQRESRELKSKNKKRKPIESNEDGSDYDTIKRRKLNEDQDSVAVSSK 120

Query: 111 ANKKTPYINILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIV 170
            +   PYI ILEALSATGLRAIRY+ E+P+VK ++ANDLLPEAVESI+RNV YN V + V
Sbjct: 121 DHSTRPYIKILEALSATGLRAIRYSKEVPNVKTIVANDLLPEAVESIKRNVIYNEVSDKV 180

Query: 171 KPNLDDANVLMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLA 230
            PNLDDANVLMYRNK+ N K+HVIDLDPYGTVTPFVDA++QSIE+ GLMLVTCTDLSVLA
Sbjct: 181 VPNLDDANVLMYRNKSKNEKYHVIDLDPYGTVTPFVDASMQSIEDGGLMLVTCTDLSVLA 240

Query: 231 GNGYPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRV 290
           GNGYPEKCFALY G NM  H++THESALRLVLNLL Q+AAKYKKT+EPLLSLSIDFYVRV
Sbjct: 241 GNGYPEKCFALYSGVNMAGHDATHESALRLVLNLLGQSAAKYKKTIEPLLSLSIDFYVRV 300

Query: 291 FVKVRTSPIEVKNLMSNTMTTYHCSRCGSYHNQPLGRVSQREGKKSKTFTKYSVAQGPPV 350
           F++V+TSPIEVKNL SNTM  Y CS C +YH QPLGR  +R  KK   FTK+S+AQGPPV
Sbjct: 301 FIRVKTSPIEVKNLQSNTMVGYMCSGCNAYHTQPLGRQQERTTKKGVKFTKFSLAQGPPV 360

Query: 351 DIRCRFCDGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAK 410
           D  C +C   +H+ GPMY GPLHNK+FI+ VLRINKEEH  +DD YGTRKRIEGML+LAK
Sbjct: 361 DRNCSYCGSVHHIVGPMYGGPLHNKKFIDRVLRINKEEH--KDDIYGTRKRIEGMLTLAK 418

Query: 411 NELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIW 470
           NE++ +PFYF+PN ++SV+K QVP LK VVAGLGSLG+ECSLTHA+ SSLKT+A WDAIW
Sbjct: 419 NEIA-APFYFTPNSVSSVLKFQVPTLKAVVAGLGSLGFECSLTHAKASSLKTDASWDAIW 477

Query: 471 YVMQK--CDDEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEK 528
           YVM+K   D+   ++ KMN N  GYKIL+      ++D    +D ++SF PNE SG  EK
Sbjct: 478 YVMKKYCIDNNLVNIEKMNKNGNGYKILTNDTIGQTED----WDKKISFEPNEYSGRFEK 533

Query: 529 LRKLKIVRYQENPTKNWGPKARP 551
           LRKLKIVRYQENPTKNWGPKARP
Sbjct: 534 LRKLKIVRYQENPTKNWGPKARP 556

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 7/104 (6%)

Query: 120 ILEALSATGLRAIRYA--HEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDA 177
           +LE  S TGL  I YA  H I     +   DL PE + +++ NV  NN+ ++    LD  
Sbjct: 240 VLELGSGTGLVGISYALTHSINGDSVIFLTDL-PEILPNLQYNVRLNNLNDVTADVLDWT 298

Query: 178 NVLMYRNKAINNKFHVIDL-DP-YGTVTP--FVDAAIQSIEEDG 217
           + L +  K  N  F  I + DP Y    P   VD  ++ + E+G
Sbjct: 299 DPLSFTEKYGNEPFDTIVIADPIYSPQHPIWLVDMIVKFLSENG 342

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 13/94 (13%)

Query: 111 ANKKTPYINILEALSATGLRAIRYAHEIP-----HVKEVIANDLLPEAVESIRRNVEYNN 165
           AN  T  I +LE  S TGL  + +A +       H  E+   DL PE V ++++NV  NN
Sbjct: 245 ANCGTKRIKVLELGSGTGLVGLSWAAKWKELYGIHNIEIYVTDL-PEIVTNLKKNVLLNN 303

Query: 166 VGNIVKPNLDDANVLMYRNKA--INNKFHVIDLD 197
           + + V+     A VL + N    IN   H +D D
Sbjct: 304 LEDFVQ-----AEVLDWTNPQNFINQFGHEMDFD 332

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 111 ANKKTPYINILEALSATGLRAIRYAHEIPHV-----KEVIANDLLPEAVESIRRNVEYNN 165
           AN+ T  I +LE  S TGL  + +A +   +      E+   DL P+ V ++++NV  NN
Sbjct: 246 ANRGTKRIKVLELGSGTGLVGLSWASKWKELYGIDNTEIFVTDL-PDIVTNLKKNVSLNN 304

Query: 166 VGNIVKPNLDD 176
           + + V+  + D
Sbjct: 305 LQDFVQAEILD 315

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 15/100 (15%)

Query: 108 FEEANKKTPYINILEALSATGLRAIRYA------------HEIPHVKEVIANDLLPEAVE 155
           ++ +N+    + ILE  + TGL  I ++            + +P+  E+I  DL PE V 
Sbjct: 254 YKYSNQSDDKLRILELGAGTGLVGISWSCKWKEMMKLTNGNNLPNT-EIILTDL-PEIVG 311

Query: 156 SIRRNVEYNNVGNIVKPN-LDDANVLMYRNKAINNKFHVI 194
           +++RN+  NN+ +I + + LD  N   +  +  N KF +I
Sbjct: 312 NLQRNISINNLNDIARASVLDWTNPKSFIQEYSNEKFDII 351

>TDEL0E02810 Chr5 complement(540282..541763) [1482 bp, 493 aa] {ON}
           Anc_5.346 YHR070W
          Length = 493

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDANVL 180
           V+ANDL P++ + ++ N+E N V  +VKP NLD A  +
Sbjct: 297 VLANDLNPDSFKYLQENIEMNKVSTLVKPFNLDGAQFI 334

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 6/71 (8%)

Query: 111 ANKKTPYINILEALSATGLRAIRYAHEIPHVK-----EVIANDLLPEAVESIRRNVEYNN 165
           AN     I +LE  + TGL  + +A +   +      E+   DL PE V ++++NV  NN
Sbjct: 248 ANSDIKQIKVLELGAGTGLVGLSWALKWKELYGTENIEIFVTDL-PEIVTNLKKNVSLNN 306

Query: 166 VGNIVKPNLDD 176
           +G+ V+  + D
Sbjct: 307 LGDFVQAEILD 317

>KAFR0K02270 Chr11 (462616..464106) [1491 bp, 496 aa] {ON} Anc_5.346
           YHR070W
          Length = 496

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDANVL 180
           V+ANDL PE+ + ++ N++ N VG +VKP NLD    +
Sbjct: 291 VLANDLNPESFKYLQENIDNNKVGELVKPFNLDGGQFI 328

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 120 ILEALSATGLRAIRYAHEIPH---VKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDD 176
           +LE  + TGL  I YA  I H     ++I  DL P+ V ++R N++ NN+ N+    LD 
Sbjct: 240 VLELGAGTGLVGISYA--IAHQASTPQIILTDL-PDIVPNLRSNIKLNNLKNVHAAELDW 296

Query: 177 ANVLMYRNKAINNKFHVI 194
            +   +  +   +KF +I
Sbjct: 297 TDHSTFIAQHGGDKFDMI 314

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 11/117 (9%)

Query: 120 ILEALSATGLRAIRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANV 179
           +LE  + TGL  I YA       +V   DL PE V ++R N+  NN+ N+    LD ++ 
Sbjct: 232 VLELGAGTGLVGIAYALANIDADDVFVTDL-PEIVPNLRHNLALNNLTNVRASVLDWSDP 290

Query: 180 LMYRNKAINNKFHVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPE 236
             + ++    +F  I          FV   I S     L++ T       AG  Y E
Sbjct: 291 TSFLHEHGELQFDAI----------FVADPIYSPNHPQLLVQTVARFLAPAGTLYLE 337

>Kpol_1005.16 s1005 (26203..27708) [1506 bp, 501 aa] {ON}
           (26203..27708) [1506 nt, 502 aa]
          Length = 501

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDANVL 180
           V+ANDL PE+ + ++ N++ N V  IVKP NLD A  +
Sbjct: 308 VLANDLNPESYKYLQENIKLNKVEPIVKPFNLDGAEFI 345

>Suva_15.259 Chr15 (436542..438044) [1503 bp, 500 aa] {ON} YHR070W
           (REAL)
          Length = 500

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDANVL 180
           V+ANDL PE+ +S++ N+  N V   VKP N+D A  +
Sbjct: 303 VLANDLNPESYKSLQENIALNKVVQTVKPFNMDGAEFI 340

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 12/88 (13%)

Query: 118 INILEALSATGLRAIRYAHEIPHVK------EVIANDLLPEAVESIRRNVEYNNVGN--- 168
           + +LE  S TGL  I ++ +    K      E+   DL PE V ++++NVE NN+ +   
Sbjct: 249 LRVLELGSGTGLVGITFSCKYKESKTALGSCEMYLTDL-PEIVPNLQKNVEINNLNSQSG 307

Query: 169 --IVKPNLDDANVLMYRNKAINNKFHVI 194
             +    LD  N + +  K  ++KF VI
Sbjct: 308 LAVCADVLDWTNPVSFTEKYGDDKFDVI 335

>NCAS0H01660 Chr8 complement(317482..318999) [1518 bp, 505 aa] {ON}
           Anc_5.346 YHR070W
          Length = 505

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDANVL 180
           V+ANDL PE+ + ++ N+  N V + VKP NLD A  +
Sbjct: 297 VLANDLNPESFKYLKENIALNKVESTVKPFNLDGAEFI 334

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 118 INILEALSATGLRAIRYAHEIPHV-----KEVIANDLLPEAVESIRRNVEYNNVGNIVKP 172
           I +LE  S TGL  + +A +   +      E+   DL PE V ++++NV  NN+ + V+ 
Sbjct: 253 IKVLELGSGTGLVGLSWASKWKELYGTDKMEIFVTDL-PEIVTNLKKNVSLNNLQDFVQA 311

Query: 173 NLDD 176
            + D
Sbjct: 312 EILD 315

>NDAI0C01990 Chr3 complement(446632..448131) [1500 bp, 499 aa] {ON}
           Anc_5.346 YHR070W
          Length = 499

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLD 175
           V+ANDL PE+ + ++ N+  N V  +VKP NLD
Sbjct: 300 VLANDLNPESFKYLKENITLNKVDQLVKPFNLD 332

>KLLA0E12761g Chr5 (1131727..1133235) [1509 bp, 502 aa] {ON} similar
           to uniprot|P38793 Saccharomyces cerevisiae YHR070W TRM5
           tRNA(m(1)G37)methyltransferase methylates a tRNA base
           adjacent to the anticodon that has a role in prevention
           of frameshifting highly conserved across Archaea
           Bacteria and Eukarya
          Length = 502

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLD 175
           V++NDL PE+ + +++N+  N VGN V+P NLD
Sbjct: 298 VLSNDLNPESYKYMQQNIIDNKVGNFVEPLNLD 330

>KLLA0D11506g Chr4 (987844..988641) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit,
          Length = 265

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%)

Query: 472 VMQKCDDEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLRLSFTPNEQSGNIEK 528
           +++K  D +KD+ K+N +     IL AM      D +S     L+   NE   NIEK
Sbjct: 186 LLRKLVDTEKDVEKVNLDVAKKAILEAMKILYYRDARSSRKFSLAIIDNELGLNIEK 242

>KAFR0L00680 Chr12 (129379..131871) [2493 bp, 830 aa] {ON} Anc_7.205
           YFR038W
          Length = 830

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 500 PKWLSDDIKSEYDLRLSFTPNEQSGNIEKLRKL 532
           P WL DDI+S+ D+ L    +E  GN++  R L
Sbjct: 49  PIWLQDDIRSDSDVDLESEEDELDGNLKNYRNL 81

>TBLA0D05650 Chr4 (1384163..1387090) [2928 bp, 975 aa] {ON}
           Anc_1.224 YJL129C
          Length = 975

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%)

Query: 375 KEFIEEVLRINKEEHHDQDDTYGTRKRIEGMLSLAKNELSDSPFYFSPNHIASVIKLQVP 434
           + F+  + + NK     +++     + + G  SL+ N  S++ F  S ++I++V+   +P
Sbjct: 444 RSFLTLLEKTNKRSKQRRNNEQSYDEPLSGNHSLSFNTDSEASFSASLDNISTVMTYDLP 503

Query: 435 PLKKVVAGLGSLGYE 449
           PL       G L YE
Sbjct: 504 PLSARTMSTGYLSYE 518

>AAL033W Chr1 (280861..282330) [1470 bp, 489 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR070W (TRM5)
          Length = 489

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 138 IPHVKE---VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLD 175
           IP  K+   V+ANDL PE+   +R N+  N V   V+P NLD
Sbjct: 280 IPAAKKEVLVLANDLNPESFRYLRDNIAANKVDGFVRPKNLD 321

>CAGL0H07183g Chr8 complement(706436..707932) [1497 bp, 498 aa] {ON}
           similar to uniprot|P38793 Saccharomyces cerevisiae
           YHR070w
          Length = 498

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDANVLMYRNKAINN 189
           V+ANDL PE+ + ++ N+  N V + VKP N D A  +      ++N
Sbjct: 298 VLANDLNPESFKYLQENITLNKVSDFVKPFNHDGAEFIKQSANILDN 344

>KAFR0C05100 Chr3 (1011347..1013464) [2118 bp, 705 aa] {ON} Anc_7.37
           YOR354C
          Length = 705

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 26/43 (60%)

Query: 472 VMQKCDDEKKDLSKMNPNTTGYKILSAMPKWLSDDIKSEYDLR 514
           +  + +D++KD ++ N N    + +++ P WL D I++ Y LR
Sbjct: 226 ISSRLEDDEKDTARDNFNNLVSQYMNSHPNWLPDKIQNTYSLR 268

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 156 SIRRNVEYNNVGNIVKPNLDDANVLMYRNK 185
           + R+NV Y+N+GNI++ + DD N   Y N+
Sbjct: 267 TTRKNVRYDNLGNIIEDSEDDNNESDYSNE 296

>TPHA0D02040 Chr4 (419427..421016) [1590 bp, 529 aa] {ON} Anc_5.346
           YHR070W
          Length = 529

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDANVLMYRNKAINN 189
           V+ANDL PE+ + +  N+  N V  +VKP N D    +    K +NN
Sbjct: 314 VLANDLNPESYKYLLENIRLNKVEELVKPFNCDGGEFITESVKFLNN 360

>SAKL0G09130g Chr7 complement(784892..786397) [1506 bp, 501 aa] {ON}
           similar to uniprot|P38793 Saccharomyces cerevisiae
           YHR070W TRM5 tRNA(m(1)G37)methyltransferase methylates a
           tRNA base adjacent to the anticodon that has a role in
           prevention of frameshifting highly conserved across
           Archaea Bacteria and Eukarya
          Length = 501

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 22/29 (75%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP 172
           V++NDL PE+ + +++N+  N VG+ VKP
Sbjct: 300 VLSNDLNPESFKYMKQNIIDNKVGSFVKP 328

>KNAG0B01970 Chr2 complement(377618..379111) [1494 bp, 497 aa] {ON}
           Anc_5.346 YHR070W
          Length = 497

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 144 VIANDLLPEAVESIRRNVEYNNVGNIVKP-NLDDA 177
           V+ANDL PE+ + +  N++ N V   VKP NLD A
Sbjct: 291 VLANDLNPESFKYLEENIKRNKVELFVKPFNLDGA 325

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 60/118 (50%), Gaps = 12/118 (10%)

Query: 110 EANKKTPYINILEALSATGLRAIRYA----HEIPHVKEVIANDLLPEAVESIRRNVEYNN 165
           E+N+K   +  LE  + TGL  I +A     +  + K  I    LPE V++++ NV+ NN
Sbjct: 237 ESNRK---VRTLELGAGTGLVGIAWAAKWRDKFCNSKTEIYLTDLPEIVDNLKDNVKINN 293

Query: 166 VGNIVKPN-LDDANVLMYRNKAINNKF-HVIDLDP-YGTVTP--FVDAAIQSIEEDGL 218
           + +I   + LD  N   +  K  N +F +++  DP Y    P   V+  ++ +E +G+
Sbjct: 294 LQDIATADVLDWTNPDTFTEKYGNERFDYIVIADPIYSPQHPEWVVNMIVKFLEVNGI 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,789,115
Number of extensions: 2683819
Number of successful extensions: 8134
Number of sequences better than 10.0: 57
Number of HSP's gapped: 8291
Number of HSP's successfully gapped: 57
Length of query: 554
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 439
Effective length of database: 40,294,809
Effective search space: 17689421151
Effective search space used: 17689421151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)