Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3798.272ON75975937530.0
Smik_4.3638.272ON76576627020.0
YDR119W (VBA4)8.272ON76875926890.0
Suva_2.2798.272ON77577526590.0
TDEL0F039908.272ON6315285063e-54
SAKL0H16808g8.272ON6575434563e-47
AGR076C8.272ON6865504564e-47
ZYRO0C01430g8.272ON5904904428e-46
Kwal_26.6669singletonON5905224295e-44
KLLA0A04631g8.272ON5795234003e-40
TPHA0A017508.272ON6365503971e-39
KLTH0G13464g8.272ON5936143897e-39
TBLA0F030408.272ON9064923931e-38
Kwal_56.237548.272ON5895083835e-38
Kpol_543.448.272ON6434993846e-38
Ecym_42988.272ON6785533261e-30
NDAI0J012808.272ON6944361897e-14
Ecym_73992.473ON5632001583e-10
KLLA0F17776gna 1ON5534461441e-08
NCAS0A078102.473ON5681901422e-08
SAKL0C02178gsingletonON5652341413e-08
Skud_13.2442.473ON5621721351e-07
NCAS0B037808.272ON5894411351e-07
NDAI0H022002.473ON5711901333e-07
YMR088C (VBA1)2.473ON5621721323e-07
CAGL0J01375g2.473ON5641641324e-07
Suva_13.2652.473ON5611671307e-07
Smik_13.2722.473ON5611721299e-07
Smik_17.11singletonON5442031271e-06
KLTH0E06138g4.30ON6143691253e-06
SAKL0E04246gna 1ON5654881191e-05
KLLA0F13684g2.473ON5711581191e-05
YPR198W (SGE1)singletonON5431491182e-05
Kpol_467.242.473ON3701931135e-05
Skud_16.503singletonON5432021129e-05
KNAG0E025602.473ON5781941056e-04
KLTH0D05434g2.473ON5761781010.002
TPHA0G031502.473ON600158980.005
KAFR0B054508.272ON62594960.008
TBLA0A08510singletonON633186960.008
TDEL0A024902.473ON554160950.009
Kwal_55.206864.30ON613181950.010
SAKL0D11000g1.451ON65769940.012
YKR105C (VBA5)singletonON582155940.014
TBLA0A03460singletonON568106910.029
KNAG0H031808.272ON677115910.031
NDAI0D00820singletonON562155910.032
KLLA0D19941gsingletonON611194900.034
Smik_16.81na 2ON625155900.037
TBLA0A03700singletonON572141900.039
KLLA0F18106g4.30ON589140890.050
KLTH0H05456gna 3ON568170890.056
Kwal_26.9616singletonON562164880.062
Kwal_14.728singletonON568206880.062
NCAS0H018905.396ON591258880.070
KLTH0D16962gsingletonON571159870.076
Kwal_14.854na 4ON570153870.084
ABL040W2.473ON567164870.092
TBLA0B00840singletonON637106860.10
TDEL0G03260singletonON612155860.12
Kpol_478.34.30ON580253850.14
SAKL0E02992g2.473ON570197850.14
TBLA0A03400singletonON574106840.17
CAGL0E03674g4.30ON577303840.17
SAKL0A00726gsingletonON598157840.19
TBLA0A03500singletonON573106840.22
TBLA0A03450singletonON573141830.24
KLTH0B10142gsingletonON568155820.33
SAKL0C05588gsingletonON677179820.33
TBLA0A03470singletonON578147820.35
KNAG0B043705.394ON55793820.38
KLTH0B00132gsingletonON568202820.38
CAGL0B02079gna 2ON624164810.43
KLLA0E09879gsingletonON630152810.45
SAKL0B12716gsingletonON632155810.46
TBLA0A03480singletonON574141810.50
KLLA0E20945g3.23ON528105800.51
KLTH0E16720gsingletonON574567800.56
ZYRO0G03234g2.473ON562159800.61
KAFR0I014004.30ON589165800.66
YGR224W (AZR1)na 2ON613149790.69
TBLA0A04910singletonON575106790.76
Skud_7.560na 2ON642149790.79
Ecym_7258na 5ON638147790.82
NCAS0C03460na 2ON630149790.84
TBLA0J00100singletonON574106780.94
TDEL0C00120singletonON569216780.96
ZYRO0G21868gna 3ON620194780.99
KLTH0C10142gsingletonON573176781.0
ZYRO0G16302g5.284ON547234771.3
Kwal_14.1585na 3ON570175771.5
TBLA0D05800singletonON574141761.7
NDAI0F01930singletonON564155761.8
TBLA0B04810singletonON575106761.8
TDEL0H010601.224ON1213138761.8
Suva_9.197singletonON289150751.9
NDAI0D048404.30ON639154752.1
Suva_13.4925.19ON852159752.2
TBLA0D05810singletonON574106752.3
ZYRO0D13310gsingletonON616152752.4
ZYRO0D00286gsingletonON508127742.6
Suva_37.1singletonON265150732.7
Smik_13.171na 6ON541150742.7
KNAG0C051905.395ON564153742.7
TDEL0B019908.437ON31966732.9
KAFR0D00750singletonON557106743.3
TBLA0E01970singletonON578106733.5
SAKL0H25498g4.30ON602155733.5
CAGL0C01771g6.155ON48597733.7
Kpol_1053.243.84ON62040733.8
KLTH0E10164g8.437ON28966723.9
KLTH0C00462gna 4ON570155733.9
TBLA0A035105.396ON570153734.0
Skud_13.163na 6ON547150734.1
Kwal_26.77552.473ON559180734.1
CAGL0D02640gsingletonON564151734.4
CAGL0D02662gsingletonON564151734.4
ZYRO0G00286gsingletonON589106734.5
NCAS0F031105.396ON56868724.6
TDEL0F016704.30ON582149724.7
TBLA0A03430singletonON564106725.5
TBLA0E015104.30ON671139716.2
KNAG0I030804.30ON592139716.3
KAFR0F043904.30ON567304717.2
KLLA0E09175g2.324ON636102717.3
TBLA0A01240singletonON569106717.4
TDEL0A04250singletonON573155717.8
CAGL0A02321g5.396ON556153707.8
KAFR0C014803.84ON57729708.4
SAKL0A06050g6.155ON52342708.5
SAKL0G10758g5.284ON53399708.7
Suva_13.174na 6ON541150709.2
Suva_2.6743.84ON57933709.3
KNAG0C052505.394ON564153709.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.379
         (759 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...  1450   0.0  
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...  1045   0.0  
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...  1040   0.0  
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...  1028   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   199   3e-54
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   180   3e-47
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   180   4e-47
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   174   8e-46
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   169   5e-44
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   158   3e-40
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   157   1e-39
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   154   7e-39
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   155   1e-38
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   152   5e-38
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   152   6e-38
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   130   1e-30
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....    77   7e-14
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    65   3e-10
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    60   1e-08
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    59   2e-08
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    59   3e-08
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    57   1e-07
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    57   1e-07
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    56   3e-07
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    55   3e-07
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    55   4e-07
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    55   7e-07
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    54   9e-07
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    54   1e-06
KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} simila...    53   3e-06
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    50   1e-05
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    50   1e-05
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    50   2e-05
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    48   5e-05
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    48   9e-05
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    45   6e-04
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    44   0.002
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    42   0.005
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    42   0.008
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             42   0.008
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    41   0.009
Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028...    41   0.010
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    41   0.012
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    41   0.014
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     40   0.029
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    40   0.031
NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {O...    40   0.032
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    39   0.034
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    39   0.037
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               39   0.039
KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} simi...    39   0.050
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    39   0.056
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    39   0.062
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    39   0.062
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    39   0.070
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    38   0.076
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    38   0.084
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    38   0.092
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    38   0.10 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               38   0.12 
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    37   0.14 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    37   0.14 
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    37   0.17 
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    37   0.17 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    37   0.19 
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    37   0.22 
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    37   0.24 
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    36   0.33 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    36   0.33 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     36   0.35 
KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON}               36   0.38 
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    36   0.38 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    36   0.43 
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    36   0.45 
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    36   0.46 
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               36   0.50 
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    35   0.51 
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    35   0.56 
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    35   0.61 
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    35   0.66 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    35   0.69 
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    35   0.76 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    35   0.79 
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    35   0.82 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    35   0.84 
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        35   0.94 
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         35   0.96 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    35   0.99 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    35   1.0  
ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]...    34   1.3  
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    34   1.5  
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    34   1.7  
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               34   1.8  
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    34   1.8  
TDEL0H01060 Chr8 complement(188716..192357) [3642 bp, 1213 aa] {...    34   1.8  
Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W (...    33   1.9  
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    33   2.1  
Suva_13.492 Chr13 complement(852013..854571) [2559 bp, 852 aa] {...    33   2.2  
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    33   2.3  
ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]...    33   2.4  
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    33   2.6  
Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W...    33   2.7  
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    33   2.7  
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             33   2.7  
TDEL0B01990 Chr2 (353614..354573) [960 bp, 319 aa] {ON} Anc_8.43...    33   2.9  
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    33   3.3  
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    33   3.5  
SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]...    33   3.5  
CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} simila...    33   3.7  
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    33   3.8  
KLTH0E10164g Chr5 complement(919912..920781) [870 bp, 289 aa] {O...    32   3.9  
KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON...    33   3.9  
TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {O...    33   4.0  
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    33   4.1  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    33   4.1  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    33   4.4  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    33   4.4  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    33   4.5  
NCAS0F03110 Chr6 complement(622619..624325) [1707 bp, 568 aa] {O...    32   4.6  
TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {O...    32   4.7  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    32   5.5  
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    32   6.2  
KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.3...    32   6.3  
KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.3...    32   7.2  
KLLA0E09175g Chr5 complement(817829..819739) [1911 bp, 636 aa] {...    32   7.3  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    32   7.4  
TDEL0A04250 Chr1 (756579..758300) [1722 bp, 573 aa] {ON}  YBR298C      32   7.8  
CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {...    32   7.8  
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    32   8.4  
SAKL0A06050g Chr1 (548837..550408) [1572 bp, 523 aa] {ON} simila...    32   8.5  
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    32   8.7  
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    32   9.2  
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    32   9.3  
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             32   9.3  

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score = 1450 bits (3753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/759 (93%), Positives = 711/759 (93%)

Query: 1   MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE 60
           MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE 60

Query: 61  NTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDHH 120
           NTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDHH
Sbjct: 61  NTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDHH 120

Query: 121 KFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNSLEGNGDIHV 180
           KFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNSLEGNGDIHV
Sbjct: 121 KFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNSLEGNGDIHV 180

Query: 181 AQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDA 240
           AQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDA
Sbjct: 181 AQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDA 240

Query: 241 FVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIG 300
           FVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIG
Sbjct: 241 FVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIG 300

Query: 301 QXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKST 360
           Q                CMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKST
Sbjct: 301 QLLFLKLSIISSVKLLLCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKST 360

Query: 361 IMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNAS 420
           IMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNAS
Sbjct: 361 IMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNAS 420

Query: 421 IMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTELE 480
           IMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEI                DLTELE
Sbjct: 421 IMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEILTLTLFLLCFVQVTTLDLTELE 480

Query: 481 HRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMC 540
           HRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMC
Sbjct: 481 HRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMC 540

Query: 541 IIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL 600
           IIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL
Sbjct: 541 IIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL 600

Query: 601 ILYITLMGVGLSLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFG 660
           ILYITLMGVGLSLPVWKQYVCLS                YHEYHEQRKSLNSGSIVYCFG
Sbjct: 601 ILYITLMGVGLSLPVWKQYVCLSLPFLGSSMLLTLLSSLYHEYHEQRKSLNSGSIVYCFG 660

Query: 661 AIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPK 720
           AIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPK
Sbjct: 661 AIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPK 720

Query: 721 FIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN 759
           FIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN
Sbjct: 721 FIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN 759

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/766 (67%), Positives = 596/766 (77%), Gaps = 8/766 (1%)

Query: 1   MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENK- 59
           MGKKDRQRKKLREFAKLKNRQ+ L+ SVQNLK EVQ++   SE+ + + +ENDKSEE   
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQRNLKESVQNLKKEVQQKAVCSEHLDLVQLENDKSEEIND 60

Query: 60  ------ENTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSED 113
                 EN PLL T   ++E+  SK  D+DT +T P    SK+ +  Q E D  E KS +
Sbjct: 61  ESEEINENVPLLSTHGGQKEEKVSKVPDVDTINTHPLHS-SKNDDSHQTEADCAERKSGN 119

Query: 114 KADQDHHKFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNSLE 173
           K D D+ K LSQDE G K PLQ+SM DF+DRSISPLQSITS++T MSE ELP SSTNSLE
Sbjct: 120 KTDHDYPKSLSQDEPGIKLPLQSSMTDFTDRSISPLQSITSNNTPMSEHELPASSTNSLE 179

Query: 174 GNGDIHVAQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSISQTIEDVEDETDPSYI 233
              ++ + Q  S+ PT + L+ A S P VP  RA++ PYGYGSIS+TIEDVE   +P+Y+
Sbjct: 180 RGDNMPIVQPSSQIPTGQILSMAASPPEVPGGRAQMDPYGYGSISRTIEDVESGANPTYV 239

Query: 234 ASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVY 293
           A++SSD  VH  TR+RIFSSCMCTYLFFIAMDSSI+LVI SKIASEFHELWRLSL++SVY
Sbjct: 240 ANSSSDELVHDLTRKRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISVY 299

Query: 294 LLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGS 353
           LL NAIGQ                C+AQFSFILGSYLSWSS HFWTFI AR V GFGSGS
Sbjct: 300 LLGNAIGQLMFLKLSLVSGVKLLLCVAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGS 359

Query: 354 LIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
           LIALKSTIMNRFSQKNE++Y LS S+ +FSLGVA+GPF+V  FDSSHGSGWKNAFLIPVP
Sbjct: 360 LIALKSTIMNRFSQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVP 419

Query: 414 FCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXX 473
           FCLVNASIMLADIYSVK+ +HHEG T TL KR KK+L SPDLYEI               
Sbjct: 420 FCLVNASIMLADIYSVKNTIHHEGPTTTLQKRFKKVLWSPDLYEILTLALFLLCFVQATS 479

Query: 474 XDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISF 533
            D T LEH TMIQ ++FSVI+ICGVLF++IE +D  MNSV S+SLQGDK LIWT+ GI F
Sbjct: 480 LDSTRLEHSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFF 539

Query: 534 CFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKF 593
           CF+ALMCIIPFGTTYF IVLNL+TL+IAERLLPFFFSIV+GYFSVCYFW S++QNYL KF
Sbjct: 540 CFAALMCIIPFGTTYFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNSERQNYLFKF 599

Query: 594 VLSGVTLILYITLMGVGLSLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSG 653
           VLSGVTL+LY+ LMG+ LSL VWKQY CLS                YHEYH QRKS  SG
Sbjct: 600 VLSGVTLLLYVALMGMNLSLSVWKQYTCLSLPLLGSSMILTLLSTLYHEYHVQRKSPISG 659

Query: 654 SIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDW 713
           SI YCF A+GGTIG+S  GYVFHKTL ++++EEVMKFSKQGYLKKDL KIIKHAT+SS+W
Sbjct: 660 SIAYCFAAMGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNW 719

Query: 714 VHESAPKFIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN 759
           VH+SAPKFIF+TLIECYLQACRNVFKLSA+FFTI V+++FFFN+I+
Sbjct: 720 VHKSAPKFIFRTLIECYLQACRNVFKLSALFFTITVVTLFFFNRIH 765

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score = 1040 bits (2689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/759 (67%), Positives = 592/759 (77%), Gaps = 1/759 (0%)

Query: 1   MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE 60
           MGKKDRQRKKLREFAKLKNRQ+ L+ SVQ LKNEVQRE       N IA+ NDK EE  E
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60

Query: 61  NTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDHH 120
           N+PLL   S++ E    K +DIDT D +P  E  K  +  Q E + ++GK  DKA++D  
Sbjct: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120

Query: 121 KFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNSLEGNGDIHV 180
           K  SQ E+   S LQ+S+ DFSDRS+SPLQSITS +T MSE ELP SS+NS E   D+ V
Sbjct: 121 KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV 180

Query: 181 AQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDA 240
            Q++++  +SK+L     +P VPVS  EI+ YGYGSI Q+I DVE+  +P Y+ +TSSD 
Sbjct: 181 VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSSDE 240

Query: 241 FVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIG 300
            VH  TRRRIFSSCMCTYLFFIAMDSSI+LVI SKIASEFHELWRLSL++S YLLSNAIG
Sbjct: 241 LVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIG 300

Query: 301 QXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKST 360
           Q                C+AQFSFILG YLSWSS+HFWTFIFAR V GFG GSLIALKST
Sbjct: 301 QLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKST 360

Query: 361 IMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNAS 420
           IMNRFSQKN+SRYSLSAS+I F++GV IGPF++ LFDSSHGSGW+NAFLIPVPFCLVNAS
Sbjct: 361 IMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNAS 420

Query: 421 IMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTELE 480
           IMLAD+YSVK  L+    T TLWKR K  LLSPDLYEI                DLT L+
Sbjct: 421 IMLADMYSVKSTLYGR-PTPTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTSLDLTGLK 479

Query: 481 HRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMC 540
           + TMIQ +LFSVI++CG+LF+LIE +DTYMNSVISMSLQGDKRLIWT+ GISFCF+ALMC
Sbjct: 480 NNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMC 539

Query: 541 IIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL 600
           IIPFGTTYF IVLNL+TLQ+AERL PFFFSIV+GYFSV YFWKSK QN+LLKFVLSG TL
Sbjct: 540 IIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATL 599

Query: 601 ILYITLMGVGLSLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFG 660
           +LY+ LMGV L+LPVWKQY+CLS                YHEYHEQRKS  SGSIVYCFG
Sbjct: 600 LLYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISGSIVYCFG 659

Query: 661 AIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPK 720
           A+GGT+GISLGGYVFHKTL K +HE+VM FSKQGYLKKDLLKIIKHATESSDWVHESAPK
Sbjct: 660 AVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPK 719

Query: 721 FIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN 759
           F+F+TLIECYLQACRNVFKLS +FFTI V+++F FN+I+
Sbjct: 720 FVFQTLIECYLQACRNVFKLSTLFFTITVVAIFIFNRIH 758

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/775 (66%), Positives = 589/775 (76%), Gaps = 16/775 (2%)

Query: 1   MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE 60
           MGKKDRQRKKLREFAKLKNRQQ L+ SVQ+LK EVQR+    EN N I   N K EE  E
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQQNLRKSVQSLKKEVQRKSVAPENLNRIVFGNLKREEASE 60

Query: 61  NTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDHH 120
           N+PLL   SE RE  G K L+I+  DTR   E  ++   V+ E DD+EGK  + A+++  
Sbjct: 61  NSPLLPAPSEPREGSGPKTLNINANDTRSLPELPENSTSVETESDDIEGKLAENANEEPP 120

Query: 121 KFLSQDES---------GTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNS 171
           KFLSQ+E          G KSP QNS+ DFSDRS+SPLQSITSD+T MS  E+P S  N+
Sbjct: 121 KFLSQEEPPKFLSREEPGKKSPSQNSVSDFSDRSVSPLQSITSDNTPMSVHEVPESLANA 180

Query: 172 LEGNGDIHVAQSESERPTSKTLAT-------ATSAPAVPVSRAEISPYGYGSISQTIEDV 224
           LEGNGDI VAQ +S  P    L T       ATSAP V V R ++  Y YGSIS+T++DV
Sbjct: 181 LEGNGDIVVAQLDSCVPAINALPTSDLSPTSATSAPEVLVDRPQMRAYEYGSISRTVKDV 240

Query: 225 EDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELW 284
           E+ T  SY    SSD FVH  TRRRIFSSCMCTYLFFIAMDS+IL+ IVSKIASEFHELW
Sbjct: 241 ENGTTSSYARVASSDKFVHDLTRRRIFSSCMCTYLFFIAMDSTILMSIVSKIASEFHELW 300

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFAR 344
           RLSLI+S+YLLSNAIGQ                C+AQFSFILGSYLSWS+ HFWTF+FAR
Sbjct: 301 RLSLIISIYLLSNAIGQLVFLKLSIVTSVKLLLCVAQFSFILGSYLSWSAFHFWTFVFAR 360

Query: 345 FVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGW 404
            + GFGSG+L+ALKSTIMNRFS K ++ YSLSASVI+FSLGVAIGPF+V LFD+S GSGW
Sbjct: 361 SITGFGSGALMALKSTIMNRFSDKKKNGYSLSASVIVFSLGVAIGPFLVYLFDNSRGSGW 420

Query: 405 KNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEIXXXXXX 464
           KNAFLIPVPFCLVNASIMLADIYS+KDNLHH GS    WKR+KKIL+SPDLYEI      
Sbjct: 421 KNAFLIPVPFCLVNASIMLADIYSIKDNLHHGGSAPISWKRIKKILMSPDLYEILTLALL 480

Query: 465 XXXXXXXXXXDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRL 524
                     D+T LEH  +IQ VLF VI+ CG+LFW IE N+TY NS+ISMSL+GDK L
Sbjct: 481 LLCFVQVTSLDITRLEHSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHL 540

Query: 525 IWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKS 584
           +WT+ GISFCF+ALMCIIPFGTTYFTIVLN++TLQIAERLLP   +IV+GYFSVCYFWK 
Sbjct: 541 MWTIMGISFCFAALMCIIPFGTTYFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKP 600

Query: 585 KKQNYLLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYH 644
           + +NYLL+ VL GVTLILYI LMG  LSLPVWKQYVCLS                YHEYH
Sbjct: 601 QMKNYLLEVVLGGVTLILYIALMGASLSLPVWKQYVCLSLPLLGSAMILTLLSSLYHEYH 660

Query: 645 EQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKII 704
           + +KS  SGSIVYCF A+GGTIGISLGGYVFHKTL K++H+ VMKFSK GY +KDLLKII
Sbjct: 661 QPKKSPISGSIVYCFSAMGGTIGISLGGYVFHKTLLKAVHDGVMKFSKHGYHEKDLLKII 720

Query: 705 KHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN 759
           +HAT+SSDWVHESAPKFIF+TLIECYLQACRNVFKLSA+ FTI V++MFFFN++N
Sbjct: 721 EHATQSSDWVHESAPKFIFQTLIECYLQACRNVFKLSAILFTITVMTMFFFNRVN 775

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  199 bits (506), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 142/528 (26%), Positives = 239/528 (45%), Gaps = 17/528 (3%)

Query: 213 GYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVI 272
           GYGSI+   +       P   A   S A      R R+    M   +F  A+D++I+   
Sbjct: 81  GYGSITDPHDGDNKSERPVSTAEEISGA------RLRVIMLSMYLGIFLAAIDNTIVSTT 134

Query: 273 VSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSW 332
            + +ASEF++L ++S I + YLLS+A  Q                     +F++G  +  
Sbjct: 135 SAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCG 194

Query: 333 SSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV 392
            S  FW  + ARFVAG G G L ++ S  +       E         + + LG A G  V
Sbjct: 195 LSKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIV 254

Query: 393 VGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILLS 452
            G F  + G GW+ AFLI VP   ++  +++  +      L  + +T      +K+ LL+
Sbjct: 255 GGWFSDNKG-GWRMAFLIQVPLSAISLLVIILHL-----KLPSKRATRNQDNSIKRKLLA 308

Query: 453 PDLYEIXXXXXXXXXXXXXXXXDLTELEH--RTMIQWVLFSVILICGVLFWLIEANDTYM 510
            D                       E+ +  RT    +L S +L C ++F  +E      
Sbjct: 309 IDWLGASTLVIFLVLFLLTASLGGKEIAYGSRTF-ALMLISSLLSC-LVFIYVELR-VAA 365

Query: 511 NSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFS 570
           + ++ +     + ++ +     FC  A M    +   YF+ VLN++   + +RL+P FFS
Sbjct: 366 DPILPLRFLAIRSVLGSSLSNWFCMMATMTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFS 425

Query: 571 IVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSXXXXXXX 630
           +  G     Y+ K  ++ Y    +   V ++  + ++ +   +P W+QY+ L        
Sbjct: 426 VAFGSLGAGYYMKKTRKYYWFSLIFCAVAVLGQLQILLIDPKIPTWRQYILLLVPGVGTS 485

Query: 631 XXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKF 690
                                + SI Y F + G T+G+S+GG +F ++L+K     V+++
Sbjct: 486 VLITVALLAMIAAVPHEHQAATTSISYAFRSAGCTLGVSIGGAIFRESLSKLTTRYVLRY 545

Query: 691 SKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVF 738
             + + K++LLKII  A+ESS+WVH SAP FI +TL+ECY +AC+N F
Sbjct: 546 ISKEHPKEELLKIIDKASESSEWVHHSAPDFIRQTLLECYHKACKNTF 593

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 1  MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPI 48
          MGKKD+QR KLREF     RQ++LQ + +N   E  R +    +  PI
Sbjct: 1  MGKKDKQRNKLREF----TRQKQLQQAKKNDMLEETRPLVAPSSAEPI 44

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  180 bits (456), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 142/543 (26%), Positives = 240/543 (44%), Gaps = 15/543 (2%)

Query: 213 GYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVI 272
           GY SI +         D    +  + +       R +I    M   +F  ++D++I+  +
Sbjct: 93  GYDSIKKNTVATAKTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTL 152

Query: 273 VSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSW 332
           ++ IASEF+E+  +S I + YLLS+A  Q                  +   F LG  +  
Sbjct: 153 LAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICG 212

Query: 333 SSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSASVIIFSLGVAIGPF 391
            S   W  +  RF+AG G G L ++ S T  +    +N + Y        F LG A G  
Sbjct: 213 LSPGLWCLVAGRFIAGIGGGGLTSMSSITTSDIVPLRNRALYQ-GICNFFFGLGTACGGL 271

Query: 392 VVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILL 451
           V G F S HG GW+ AFLI +P C ++ S+++A +  +       G       ++ + L 
Sbjct: 272 VGGWF-SEHGGGWRVAFLIQIPLCAISCSLIVAYL-ELPKGCKGSGIQSDEDNQISEKLR 329

Query: 452 SPDLYEIXXXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYM- 510
             D +                     EL  ++   + L   I++ G  F  +E   TY+ 
Sbjct: 330 RIDWFGALSLVVFLLLFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVE---TYVS 386

Query: 511 -NSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFF 569
            + ++ ++   ++ ++ +     F    +M    F   Y+  VLN+    + +R +P FF
Sbjct: 387 KDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFF 446

Query: 570 SIVIGYFSVCYFWK--SKKQNYLLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSXXXX 627
           S  +G     Y+ K   K +  L+ F    V   L I+L  +  ++ VW+QY+ L     
Sbjct: 447 STALGSLGAGYYMKKTGKYKWLLMAFCALAVVGQLQISL--IEPNIAVWRQYILLVIPGF 504

Query: 628 XXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEV 687
                                   + SI Y F + G T+G+S+GG +F K+L   L   V
Sbjct: 505 GLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNV 564

Query: 688 MKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFK--LSAVFF 745
           MK +   + +++L KII  A  SSD++H+SAP+F+ + LIE Y  ACRN +K  L+++F 
Sbjct: 565 MKLASDKHPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFC 624

Query: 746 TIM 748
            ++
Sbjct: 625 ALL 627

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 17/70 (24%)

Query: 4  KDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKENTP 63
          K++QRKKL+ F KLK RQ++L N         + +V   +NP         S E  E TP
Sbjct: 8  KNKQRKKLQAFVKLKERQRQLLND--------EPKVVIQQNP-------AHSIEPTETTP 52

Query: 64 LLLTSSERRE 73
           L     RRE
Sbjct: 53 FL--QPIRRE 60

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  180 bits (456), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 150/550 (27%), Positives = 234/550 (42%), Gaps = 37/550 (6%)

Query: 220 TIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASE 279
           T +  E     + + +   DA     TRRR+  + MC  +F  A+D +I+  ++  IASE
Sbjct: 111 TQKPTEVYLTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASE 170

Query: 280 FHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWT 339
           F+EL R+S I + YLLS+A  Q                  +   F LG+ +   S + W 
Sbjct: 171 FNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWV 230

Query: 340 FIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDS 398
            +  RFVAG G G L ++ S T  +    ++ + Y    +V  F LG A G  V GLF +
Sbjct: 231 LVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVF-FGLGTACGGLVGGLF-A 288

Query: 399 SHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGS--TFTLWKRVKKILLSPDLY 456
               GW+ AFL+ VP  L++ + +   +   K    H+G+      W    +++      
Sbjct: 289 DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGTV 348

Query: 457 EIXXXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSVILICGVLFW---LIEANDTYM--- 510
            +                DL  L       +++F VIL+ G  F    L  A D  +   
Sbjct: 349 TLVVFLFCFTLVCSLYGEDLPHL-------YLIFVVILLSGSYFIYHELYVATDPILPIR 401

Query: 511 ----NSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLP 566
                SV++ SL       W      FC   +M    +   Y+  VLN+    I +R++P
Sbjct: 402 FLENRSVLAASLSN-----W------FCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVP 450

Query: 567 FFFSIVIGYFSVCYFWKSKKQNY--LLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSX 624
            FFS   G     Y+ K   + Y  LL F L GV   + I+   V  S+  W+QY     
Sbjct: 451 SFFSTAFGSLGAGYYMKRTGKYYWFLLAFCLVGVLGQVQISY--VTPSISTWRQYCLYMI 508

Query: 625 XXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLH 684
                                QR    + SI Y F + G T+G+S+GG +F   L+  L+
Sbjct: 509 PGFGSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLY 568

Query: 685 EEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVF 744
            ++M      +   +LL+II+ A  S++WVH+ AP+F    LI+CY  A R  F      
Sbjct: 569 SKLMPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLAC 628

Query: 745 FTIMVISMFF 754
             +  ++  F
Sbjct: 629 MVLATVACCF 638

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  174 bits (442), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 136/490 (27%), Positives = 229/490 (46%), Gaps = 28/490 (5%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           +F  A D +++  I++ IASEF+EL R+S I + YLLS+A  Q                 
Sbjct: 89  IFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSA 377
           +    F++G  +   +  FW  + ARF++G G G + ++ S TI +    ++ + Y    
Sbjct: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDRALYQ-GM 207

Query: 378 SVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEG 437
               F LG A G  V G F S HG GW+ AFLI VP   + +S+++A    +        
Sbjct: 208 CNFFFGLGTACGGVVGGWF-SDHGGGWRMAFLIQVPLSAL-SSLLIAVFMKLPPRSKRVN 265

Query: 438 STFTLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTEL--EHRTMIQWVLFSVILI 495
           S       +K  LLS D                       E+    +T +   + S  L 
Sbjct: 266 SP----ASIKNKLLSVDWIGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSS-LA 320

Query: 496 CGVLFW--LIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVL 553
           C       L  A D     ++ +S   ++ ++ +     FC  A+M    +   Y++ VL
Sbjct: 321 CAFFIGVELYGAKD----PILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVL 376

Query: 554 NLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILYITLMGVGLSL 613
           N+N  ++ +RL+P FFS  +G     Y+ K   + Y L      ++L+ ++ +  +   +
Sbjct: 377 NMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDI 436

Query: 614 PVWKQYVCL-----SXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGI 668
             W+Q++ L                       H +H       + SI Y F + G T+G+
Sbjct: 437 ATWRQFILLVIPGFGYSVLITVALLAMIAAVPHNHHAA-----TTSISYAFRSTGSTLGV 491

Query: 669 SLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIE 728
           S+GG +F ++L   L  +V+KF+ + + +K+LL+II+ A++SS+WVH+SAP+FI  TLI 
Sbjct: 492 SIGGAIFRQSLNGLLSRKVLKFADK-HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIG 550

Query: 729 CYLQACRNVF 738
           CY  AC++ F
Sbjct: 551 CYHFACKDTF 560

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  169 bits (429), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 134/522 (25%), Positives = 239/522 (45%), Gaps = 26/522 (4%)

Query: 248 RRIF--SSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXX 305
           RRIF  S+ M   +F  A+D++I+  ++  I SE +++  +SL+ + Y+ S AI Q    
Sbjct: 78  RRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVATSYVFSCAIFQPLFG 137

Query: 306 XXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRF 365
                         +   F  G      S   W  I  R V G G G L ++ + I+N  
Sbjct: 138 KTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIGGGGLTSMCTIIINDI 197

Query: 366 SQ-KNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVN--ASIM 422
              +N + Y    + + ++LG A G  V GLF S +G+GW+ AF+I +PFC ++  + I+
Sbjct: 198 VPLRNRAVYQGFGN-LFYALGTACGGLVGGLF-SEYGNGWRMAFMIQLPFCFLSTISIIV 255

Query: 423 LADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTELEHR 482
             D+   K +L       +L+ +++ I    D                        + + 
Sbjct: 256 YLDLSDDKQDLGRS----SLYCKLRLI----DWLGALTLVTFLLLFLVTMTIGGQHVPYG 307

Query: 483 TMIQWVLFSVILICGVLFWLIE---ANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALM 539
           ++  ++L   +   G+    +E   AND     ++ +S   +K ++ +     FC   +M
Sbjct: 308 SLRFFLLCVAVCASGLALAYVEIFLAND----PILPISFLRNKNVLGSSLANWFCMMGMM 363

Query: 540 CIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVT 599
            I  +   Y++ V N   +Q+ ++ +P FFS+ +G F   Y+ +     Y  + +++   
Sbjct: 364 TITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGTYY--RLLMTSCL 421

Query: 600 LILYITLMGVGLS--LPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVY 657
           +I++  L  V ++  +P W+QY+ L+                       +    + S+ Y
Sbjct: 422 IIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHKHQAATTSLSY 481

Query: 658 CFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHES 717
            F   G  IG SL G +F  TL K++   VMKF    + KK+L  +I+ A  SSDWV+  
Sbjct: 482 AFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKALRSSDWVNNG 541

Query: 718 APKFIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN 759
           +P+F+ + L++CY  AC   F+   + F + VIS  F  +IN
Sbjct: 542 SPEFVHEALLKCYENACGQTFRFCLLCFLLTVISCSFITEIN 583

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  158 bits (400), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 142/523 (27%), Positives = 231/523 (44%), Gaps = 24/523 (4%)

Query: 225 EDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELW 284
           EDE       S  S A +H      I  S MC   F  A+D++I+  ++S IASEF+EL 
Sbjct: 43  EDEAREGLQVSEMSRARLH------IIISSMCLGSFLAALDNTIVTTLLSHIASEFNELS 96

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFAR 344
            +S I + YLLS+A  Q                 ++   FILG  +   S + WT +  R
Sbjct: 97  HISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGR 156

Query: 345 FVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGW 404
           F+AG G G + +L S   +       SR         F         ++G + S   +GW
Sbjct: 157 FIAGIGGGGVTSLGSITASDIVPL-RSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGW 215

Query: 405 KNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEI-----X 459
           + AFL+ VP C +  S++L  I+ +K     +G       +  K+ +   L  I      
Sbjct: 216 RMAFLVQVPLCAI--SLVLIIIF-LKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSL 272

Query: 460 XXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYM--NSVISMS 517
                             E+ + + I  +L    ++ G  F  +E    Y+  + ++ + 
Sbjct: 273 SLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVE---LYISDDPILPIR 329

Query: 518 LQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFS 577
              ++ ++       FC  + + +  +   Y++ V NL    + +R+ P FFS   G   
Sbjct: 330 FLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIG 389

Query: 578 VCYFWKSKKQNY--LLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSXXXXXXXXXXXX 635
             Y+ K   + Y  LLKF  +G+ ++  + ++ +   +  W+QY+ L             
Sbjct: 390 AGYYMKKTGRYYGFLLKF--TGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITV 447

Query: 636 XXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGY 695
                           + SI Y F + G T+G+S+G  +F   L+ SL + VMKF    Y
Sbjct: 448 TLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKY 507

Query: 696 LKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVF 738
            K+ LL IIK A+ESS++VH +APKFI  TLI+CY QAC++ F
Sbjct: 508 SKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTF 550

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  157 bits (397), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 146/550 (26%), Positives = 243/550 (44%), Gaps = 55/550 (10%)

Query: 214 YGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIV 273
           YGS++ +I    D+ + S              TR R+  S M   +F  A+D++I+  ++
Sbjct: 73  YGSVANSIILDNDKNNLS-------------PTRLRLAMSSMYLGIFLSALDNTIVSTLL 119

Query: 274 SKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWS 333
           ++I SEF+EL R+S I + YLLS+A  Q                     +F +G  +  +
Sbjct: 120 ARIGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGT 179

Query: 334 SSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV 392
           +  FW  +  RF++G G G + ++ + T+ +    +N + Y        + LG+A+G  +
Sbjct: 180 AKSFWVLVIGRFISGVGGGGITSMSTITVSDIIPLRNRALYQ-GVCNFYYGLGIALGGII 238

Query: 393 VGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKD------------NLHHEGSTF 440
            G F    GS W+ AFL  VP  +++   ++  +   KD            N  + G+  
Sbjct: 239 GGWFTEKLGS-WRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTES 297

Query: 441 TLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTEL--EHRTMIQWVLFSVI-LICG 497
            + K++K I    D Y                    +++  +  T +   L SV   I  
Sbjct: 298 IIMKKLKTI----DWYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISF 353

Query: 498 VLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNT 557
           +   L  A D     ++ +    D+ ++ +     F    LM I  +   YFT V+ +  
Sbjct: 354 IYIELKFAKD----PILPLVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGA 409

Query: 558 LQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLK--FVLSGVTLILYITLMGVGLSLPV 615
             + +R LP FFS+  G     Y+ K   + Y     F L  V   L I L+  G+S  V
Sbjct: 410 YDVGKRTLPNFFSVAFGSLGAGYYMKKTGKYYWFVTFFCLVVVIGCLQIYLINDGIS--V 467

Query: 616 WKQYVC-----LSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISL 670
           W+QY+      L                  HEY        + SI Y F + G T+G+S+
Sbjct: 468 WRQYLLSFVPGLGAAVLITIALLSMIVAVPHEYQAV-----TTSISYAFRSTGCTLGVSI 522

Query: 671 GGYVFHKTLTKSLHEEVMKFSKQG--YLKKDLLKIIKHATESSDWVHESAPKFIFKTLIE 728
           G  +F  +L K L  ++++   Q   Y +K+LL+II HA++S DWVH  AP+F  +T++E
Sbjct: 523 GAALFRDSLNKYLRAKILELGSQNGNYSEKELLQIIDHASKSIDWVHNEAPRFFKRTILE 582

Query: 729 CYLQACRNVF 738
           CY  AC+ VF
Sbjct: 583 CYHYACKKVF 592

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  154 bits (389), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 143/614 (23%), Positives = 251/614 (40%), Gaps = 56/614 (9%)

Query: 147 SPLQS-ITSDHTQMSERELPGSSTNSLEGNGDIHVAQSESERPTSKTLATATSAPAVPVS 205
           SPL + +  D  Q    +LPG   N +E     H+   E  R    T  ++ S+      
Sbjct: 7   SPLLTPVDRDAMQDPSTDLPGFVANQIEQQD--HLLDIEQGRAYGSTTKSSISS------ 58

Query: 206 RAEISPYGYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMD 265
                           E+  ++   + +A   S  F    +R  I    M   +F  A+D
Sbjct: 59  ----------------ENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALD 102

Query: 266 SSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFI 325
            +I+  +++ I SEF+ L + S I + YLLS++  Q                  +   F 
Sbjct: 103 GTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFA 162

Query: 326 LGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLG 385
           +G  +   S+  W  +  RF++G G   L +L + IM+      +          +F LG
Sbjct: 163 IGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLG 222

Query: 386 VAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLW-K 444
            A G  V   F       W+ AF++  P  +++   +L  +Y ++       S    W  
Sbjct: 223 TASGGLVGAYFRD-----WRLAFILQCPISVLSG--ILIVVY-LELPPRASASNKDCWSA 274

Query: 445 RVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSVILICGVLFWLIE 504
           R++++    D                      + + + + +   + +  L+ G +F  +E
Sbjct: 275 RLRRL----DWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVE 330

Query: 505 ANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERL 564
                 + V+ ++   D+ ++ +     FC  ++M    +   Y++ VL +    + +R 
Sbjct: 331 LR-VAADPVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRA 389

Query: 565 LPFFFSIVIGYFSVCYFWKSKKQNY--LLKFVLSGVTLILYITLMGVGLSLPVWKQYVC- 621
           +P FFS+  G      + K   + Y  LL F +  +   + I L  +   +PVW+QY+  
Sbjct: 390 MPSFFSVAFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVL--ITPQMPVWRQYLLQ 447

Query: 622 ----LSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHK 677
                                  HE+H    S++     Y F + G T+G+S+G  VF  
Sbjct: 448 VVPGFGVSVLITVTLLAMIAAVPHEHHAATTSIS-----YAFRSTGATLGVSVGAAVFRS 502

Query: 678 TLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNV 737
           +LT  L  +VM+F+  G+ +++L  II  A  SSDWVH SAP F+  TL+ECY  A R  
Sbjct: 503 SLTSLLDAKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRAT 562

Query: 738 FKLSAVFFTIMVIS 751
           FK      T MV++
Sbjct: 563 FKFC---LTTMVLA 573

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  155 bits (393), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 127/492 (25%), Positives = 225/492 (45%), Gaps = 22/492 (4%)

Query: 255 MCT-YL--FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXX 311
           MC+ YL  F  A+D++++  +++ I SEF+++ ++  + + YLLS+A+ Q          
Sbjct: 400 MCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIF 459

Query: 312 XXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNE 370
                   +   F  G  +   S+     ++ RFVAG G G + ++ + T+ +    ++ 
Sbjct: 460 GRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSDIVPLRSR 519

Query: 371 SRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVK 430
           + Y        F LG A G  + G+F   H  GW+  F   VP   + +++++     V 
Sbjct: 520 AVYQ-GICNFFFGLGTAFGGVIGGIF-VDHQYGWRMVFWSQVPVSGL-STLLICSFLVVP 576

Query: 431 DNLHHEGSTFTLWKRVKKI--LLSPDLYEIXXXXXXXXXXXXXXXXDLTELEHRTMIQWV 488
              ++E S   L +++ ++  L S  +                   D+   +   +I + 
Sbjct: 577 RIKNYEVS---LGRKLMRVDWLGSISMILWLTSFLLITTMMGGISLDIDSDQFHYLIMFS 633

Query: 489 LFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTY 548
             S I+   VL  L  A+D     V+ +    ++ ++    G  FC    M I  +   Y
Sbjct: 634 SVSAIIF--VLTELFVASD----PVLPLRFLSNRSVLGASLGNFFCVMGFMTICFYLPIY 687

Query: 549 FTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNY--LLKFVLSGVTLILYITL 606
           F  VL+++   I +R+ P F    +G      + K   + Y  ++ F L       Y+TL
Sbjct: 688 FASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFVVLFALVSTLGHYYLTL 747

Query: 607 MGVGLSLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTI 666
           + + +S+ V    V L                     H+ + +  + SI Y F + GGT+
Sbjct: 748 IPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAA--TTSISYAFRSTGGTL 805

Query: 667 GISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTL 726
           G++LG  VFH+TL K LH +V+++    + +K+LL+IIK A+ S++WVH  AP FI  TL
Sbjct: 806 GVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEWVHRKAPTFIRDTL 865

Query: 727 IECYLQACRNVF 738
           I CY  AC +VF
Sbjct: 866 ITCYDVACHDVF 877

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  152 bits (383), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 118/508 (23%), Positives = 218/508 (42%), Gaps = 22/508 (4%)

Query: 241 FVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIG 300
           F    +R RI    M   +F  A+D +I+  ++++I SEF+ L ++S I + YLLS++  
Sbjct: 74  FALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTC 133

Query: 301 QXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKST 360
           Q                  +   F +G  +   S+  W  +  RFV+G G   L  L S 
Sbjct: 134 QPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASM 193

Query: 361 IMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNAS 420
           +++      E          IF LG A G  V   F       W+ AF I  P  L + +
Sbjct: 194 VISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD-----WRMAFTIQCPISLASCA 248

Query: 421 IMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTELE 480
           ++++ +   +    HE      W    + L   D   +                   E+ 
Sbjct: 249 LIVSYL---ELPPRHEDDKDRHWTSKLRDL---DWAGVVTLVCFLFLFMLVSSLGGKEIA 302

Query: 481 HRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMC 540
           + +++  +L    L+ G +F  +E     ++ V+ ++    + ++ +     F   +++ 
Sbjct: 303 YDSVLFALLCVTTLVLGSIFAYVELY-VAVDPVLPIAFLKYRSVLGSSLANWFAMMSMLT 361

Query: 541 IIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL 600
              +   Y+  VLN+    I +R +P FFS+  G      + K   + Y       G+ +
Sbjct: 362 TNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYWFLLAFCGIGI 421

Query: 601 ILYITLMGVGLSLPVWKQYVCL-----SXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSI 655
           +  + +  +  + PVW+QY+ L                       HE+H    S++    
Sbjct: 422 LGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHAATTSIS---- 477

Query: 656 VYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVH 715
            Y F + G T+G+S+G  +F  TL   L  +V++F+   + +++LL+II +A  S++WVH
Sbjct: 478 -YAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIINNAAHSANWVH 536

Query: 716 ESAPKFIFKTLIECYLQACRNVFKLSAV 743
           + AP+F+  TL+ECY  A ++ FK   +
Sbjct: 537 KEAPEFVRATLVECYHYASKSTFKFCLI 564

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  152 bits (384), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 131/499 (26%), Positives = 227/499 (45%), Gaps = 15/499 (3%)

Query: 247 RRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXX 306
           R +I    M   +F  A+D++I+  +++ IASEF+EL R+S + + YLLS+A  Q     
Sbjct: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178

Query: 307 XXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRF 365
                           +F +GS +   S  F   +  RF+AG G G + ++ S T  +  
Sbjct: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIV 238

Query: 366 SQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLAD 425
             +N + Y        F LG A+G  V G F S    GW+ +FLI +P    +  +++  
Sbjct: 239 PLRNRALYQ-GICNFYFGLGTALGGVVGGWF-SDRSVGWRMSFLIQLPIAFFSTILIILF 296

Query: 426 IYSVKDN----LHHEGSTFTLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTELEH 481
           +   K++    L  +G+ F+    +K  L + D                       E+ +
Sbjct: 297 LRLPKESKGRGLQVDGNYFS---TIKVRLSAVDWIGATTLVLFLFSFMITASLGGKEIPY 353

Query: 482 RTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCI 541
            T  +++   V+ + G L +         + ++ +    D+ ++ +     FC  ALM +
Sbjct: 354 -TSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNWFCMMALMTV 412

Query: 542 IPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL- 600
             +   YF  VLN+    I +R++P FFS   G     Y+ K   + Y   FV+S   L 
Sbjct: 413 SYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW--FVISFCVLA 470

Query: 601 -ILYITLMGVGLSLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCF 659
            I  + ++ +   + V+KQY  +                             + SI Y F
Sbjct: 471 SIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQAVTTSISYAF 530

Query: 660 GAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAP 719
            + G T+G+S+GG +F ++L   L  +V+KF    + + +L++II  A++S++WV  S+P
Sbjct: 531 RSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKASQSTEWVQNSSP 590

Query: 720 KFIFKTLIECYLQACRNVF 738
            FI +TLI+CY  AC+NVF
Sbjct: 591 SFIKQTLIDCYHFACKNVF 609

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 1  MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE 60
          MGKKD+QRKKLR F K K +Q  +Q   + +  +     G       +A  +  ++E+ E
Sbjct: 1  MGKKDKQRKKLRNFTKAKVKQ--VQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDE 58

Query: 61 NTPLLLTSSERREDDGSK 78
          N+ LL    E  +D  ++
Sbjct: 59 NSVLLPIRDELLQDPSTE 76

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  130 bits (326), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 135/553 (24%), Positives = 225/553 (40%), Gaps = 20/553 (3%)

Query: 214 YGSISQTIEDVEDETDPSYIASTS------SDAFVHQETRRRIFSSCMCTYLFFIAMDSS 267
           YGS S T+    ++    +I S+S       D+    + R     S +   +F  ++D +
Sbjct: 111 YGSTSTTVTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIVSSLVVGVFLGSLDGT 170

Query: 268 ILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILG 327
           IL  ++  IASEF  L  +S I + YLLS  I Q                  +   F LG
Sbjct: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230

Query: 328 SYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVA 387
             +  ++   W  +  RFVAG G G L ++ S I++                I + LG+ 
Sbjct: 231 CLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290

Query: 388 IGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVK 447
           +G  + G   + +G GW+  FL+ V   L++   + A  + +   +HH G+   L     
Sbjct: 291 LGGSMGGWL-AEYG-GWRLVFLLQVVAALISGCFIQA--FLILPKVHH-GNGIAL---AN 342

Query: 448 KILLSPDLYEIX-XXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSVILICGVLFWLIEAN 506
           K  L   LY +                   + ++       +L  ++ + G  F   E N
Sbjct: 343 KESLKTKLYMMDWLGTFCLVIFLASLTLTCSLVDLNFNFLLLLILLMFVSGYYFVYHELN 402

Query: 507 DTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLP 566
               + ++S+ L  D+ ++ +     FC    +  I +   YF  VL +   +I +R + 
Sbjct: 403 IA-ADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTII 461

Query: 567 FFFSIVIGYFSVCYFWK--SKKQNYLLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSX 624
            F    IG F   Y+ K   K + ++    + G+   L I L  +  S+  W+QY+ L  
Sbjct: 462 SFLGTSIGSFGTGYYIKRRGKYRTFICLACIIGILGQLQIAL--IKPSISTWRQYLLLLI 519

Query: 625 XXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLH 684
                                 +    + SI Y F + G  +G SLGG +F  +L   L+
Sbjct: 520 PILYTTTVRTSLLISLIAAVPYKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLN 579

Query: 685 EEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVF 744
             +M    + + K  LL II  AT S+DWVH  +P++    LI CY   C+ +F  S V 
Sbjct: 580 TNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVC 639

Query: 745 FTIMVISMFFFNK 757
                IS +F  +
Sbjct: 640 VLFTSISCYFLKE 652

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 2  GKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKEN 61
          G K ++R +L+EFAKLK RQ+ L++         +  +G+  N       +  S+E++  
Sbjct: 7  GIKTKERNRLKEFAKLKGRQRTLKSDEAG-----ETYLGDKSNTISFGPYSRSSDESQGE 61

Query: 62 TPLLLTSSER 71
          T   LT  ++
Sbjct: 62 TIPFLTRIDK 71

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 106/436 (24%), Positives = 171/436 (39%), Gaps = 99/436 (22%)

Query: 1   MGKKDRQRKKLREFAKLKNRQQKLQ-----NSVQNLKNEVQREVGESENPNPIAIE---- 51
           MG+KD+QRK+LR+FAKLK +Q++L       +  NLKN++   +  S+N  P  I+    
Sbjct: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKL---IATSQNSVPQTIDEQPT 57

Query: 52  -NDKSEENKENTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGK 110
            N +  ++ E TPLLL          ++   ID   +   +E      P++ E   +   
Sbjct: 58  GNIEDNDSTELTPLLLKKQSENHIAVAESSGIDALKSDTVEE------PIEEEVTSLA-- 109

Query: 111 SEDKADQDHHKFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTN 170
                   H K                            Q   SD  Q+ E         
Sbjct: 110 --------HQK----------------------------QKNISDDNQLIEEP------- 126

Query: 171 SLEGNGDIHVAQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSISQ---------TI 221
                     ++ +S R    + A+   AP VP    +I    YGSI Q         T 
Sbjct: 127 ----------SRPQSSREEISSSASTNEAPIVP--HKKIHSPSYGSIEQRLSHEEPAFTE 174

Query: 222 EDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFH 281
           E V+ ET+   I+  +      Q T   IF       LF I  D ++ +++ +   S   
Sbjct: 175 EVVDLETNNRDISLLNEP----QLTAGMIF--LFSLLLFTIIFDFTLAMMLSTTSGSHVK 228

Query: 282 ELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC-MAQFSFILGS-YLSWSSSHFWT 339
           +    S I++ YL++  I Q                  +    F++GS  L+  +  FW 
Sbjct: 229 QSSNSSWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWW 288

Query: 340 FIFARFVAGFGSGSLIALKSTIMNR-FSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDS 398
            + ARF+ G  SGSLI +  TI+N+    K  SR S+    I    G+++  +   +F +
Sbjct: 289 IVMARFILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLA-YATAIFIT 347

Query: 399 SHGSGWKNAFLIPVPF 414
           S    W+N + +   F
Sbjct: 348 S----WQNVYFLLAIF 359

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 106/260 (40%), Gaps = 33/260 (12%)

Query: 508 TYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPF 567
           T  N +I +    +K + +    + F   +L+  I +   Y    LN++   I +R  P 
Sbjct: 447 TNKNPIIPLDFIENKVIFFKSLTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPM 506

Query: 568 FFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILYITLMG-VGLSL------------P 614
           F +I+    +V    +   QN L         L+ +  +MG +G  +             
Sbjct: 507 FLTILFIIITVSR--RISTQNTL------SYGLVTFFGIMGLIGQCILLNYVYNDTADYK 558

Query: 615 VWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYV 674
           +WKQ  C+                      +++  + S S  +    +G  +GI + G++
Sbjct: 559 LWKQ--CMIGILPILGSTFLVIATLMDVTDDKKLPIISTS-SFAVSTLGSILGICISGFI 615

Query: 675 FHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQAC 734
           F++     L++E+   S +   +K L KII+    +S++  ES+ ++    ++E Y    
Sbjct: 616 FNQ----GLYDELWVHSTE---EKGLGKIIRKMINNSEY--ESSSRYYCYEILESYFIVS 666

Query: 735 RNVFKLSAVFFTIMVISMFF 754
             VF  SA+   + VIS  F
Sbjct: 667 GYVFLFSAICLLVAVISFCF 686

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 93/200 (46%), Gaps = 5/200 (2%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  +MD +I+  I++ +  EF E  R+  + + +LL++ + Q                 +
Sbjct: 58  FLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVL 117

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIM-NRFSQKNESRYSLSAS 378
           A   F+LG  ++  + + W F F R + G G+G +  +    M + FS K +S Y  S +
Sbjct: 118 AYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKEQSIYQ-SYA 176

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGS 438
            II+++G  +G  + G+  +    GW+  FL  VP   +   + L D    + ++   G 
Sbjct: 177 HIIYTIGEVLGAPIGGI--ALETVGWRAIFLAQVPVLTICIYLTLCDDDLAQQHIPPHGE 234

Query: 439 TFTLWKRVKKILLSPDLYEI 458
             T WK + ++ LS  +  I
Sbjct: 235 RLT-WKNISRMDLSGSILLI 253

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 100/446 (22%), Positives = 164/446 (36%), Gaps = 30/446 (6%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           +  A+D++I+  ++  IASE     ++S I + YLLS +  Q                  
Sbjct: 43  YLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIW 102

Query: 320 AQFSFILGSYLSWS--SSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSA 377
           +   F  G  L  +  +   W     RF+AG G G L +L +   +      +       
Sbjct: 103 SNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPLRQRGVYQGM 162

Query: 378 SVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEG 437
             I+F+LG A G  ++G F      GW+ AFL  VP  L++ S+++  +     NL    
Sbjct: 163 GNIVFALGCASGS-LIGAFLQQR-IGWRWAFLCQVPLSLLSCSLIMKFL-----NLPAGS 215

Query: 438 STFTLWKRVKKILLSPDLYEIX-----XXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSV 492
               L     K + + D+ E                       L    H T   W LF V
Sbjct: 216 PGRGLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWALFIV 275

Query: 493 IL-ICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYF-T 550
            L + G  F  +    +  N ++ + L G  R +   +  ++ F+    ++ +    F  
Sbjct: 276 GLALAGYTF--VSTELSVHNPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPVFWQ 333

Query: 551 IVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGV----TLILYITL 606
            V +L    I  R +  FF I IG      + K   +   L   L+ V    TLI+Y++ 
Sbjct: 334 TVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVYLST 393

Query: 607 MGV---GLSLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIG 663
                 GL      +Y  L                      +        SI Y F AIG
Sbjct: 394 YNTEPKGL-----LEYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIG 448

Query: 664 GTIGISLGGYVFHKTLTKSLHEEVMK 689
            T+G+S  G ++   L  SL   +++
Sbjct: 449 STLGVSFAGLIYQSKLQTSLLRNIVE 474

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 87/190 (45%), Gaps = 3/190 (1%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++DS+I+  I++K+A EF E  +   I + +LL+N   Q                  
Sbjct: 51  FLSSLDSTIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLT 110

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           + F F LG +L+  + +   F  AR + G G+G + A+ S  ++      E       + 
Sbjct: 111 SHFFFGLGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRERGIYQGYAN 170

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGST 439
           I+F LG  +G  + GLF  S   GW+  F + VP  L+ +++   +I     ++      
Sbjct: 171 IVFGLGQLLGAPLGGLFIDS--VGWRVIFGVQVPMLLLCSTLATRNINVKLAHIPPRKER 228

Query: 440 FTLWKRVKKI 449
           FT WK + +I
Sbjct: 229 FT-WKNLSRI 237

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 98/234 (41%), Gaps = 8/234 (3%)

Query: 221 IEDVEDETDPSYIASTSSDAFVHQE---TRRRIFSSCMCTYLFFIAMDSSILLVIVSKIA 277
           +  +   T+ + + +       H E   T+ RI    +    F  A+D++I+  ++  IA
Sbjct: 10  VPVISPTTETALVDTGEESTTSHSELPPTKVRITVLALLMGSFLSALDTTIVATLLPTIA 69

Query: 278 SEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWS--SS 335
           S+     ++S I + YLLS +  Q                 ++  +F LG  +  S  ++
Sbjct: 70  SDLDASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTN 129

Query: 336 HFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGL 395
           + W     RFVAG G G    L +   +      +         I FSLG A G  +  +
Sbjct: 130 NVWVLSTGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAV 189

Query: 396 FDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKI 449
                G GW+ AFL+ VP  LV A +M+A +  +  +    G  +   KR K++
Sbjct: 190 LQ--QGIGWRWAFLVQVPMALVCA-LMIAVVLDLPADSPGRGLLWLELKRGKRL 240

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 79/172 (45%), Gaps = 8/172 (4%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++DS+I+  I++++A +F E  R   I + +LL+N   Q                 +
Sbjct: 47  FLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLI 106

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           AQF F LG  L+  + +   F  AR + G G+G L A+ S  ++      E       + 
Sbjct: 107 AQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYAN 166

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKD 431
           I+F  G  +G  + G+F  +   GW+  F + VP       IML  I ++K+
Sbjct: 167 IVFGFGQLLGAPLGGVFIET--IGWRALFGVQVPM------IMLCTILAIKN 210

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 95/441 (21%), Positives = 173/441 (39%), Gaps = 90/441 (20%)

Query: 1   MGKKDRQRKKLREFAKLKNRQQKLQNSVQN-LKNEVQREVGESENPNPIAIENDKSEENK 59
           MG+KD+QRKKLREFAKLK +Q+ L+N + +   N  Q+   E        +   +  E +
Sbjct: 1   MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSE--------LNTVQQLEPE 52

Query: 60  ENTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDH 119
           E+TPLL TS+     + S P + +  D R                 D++  +   + Q  
Sbjct: 53  ESTPLLKTSNH----ETSTPAEKEMPDKR-----------------DLKFPAPSFSTQYR 91

Query: 120 HKFLS-QDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNSLEGNGDI 178
           +  L+ QD S  + P+             PL       T+   +++  S T ++  + + 
Sbjct: 92  NMALNIQDASAAQDPV-------------PLP------TEELRQQITSSDTTTIYTDNNT 132

Query: 179 HVAQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSI---SQTIEDVEDETDPSYIAS 235
                     TS   A  T               GYGSI   S    D++   D     S
Sbjct: 133 ----------TSSLYARTTD--------------GYGSIHGQSSNTSDIDLHVDTE---S 165

Query: 236 TSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLL 295
           ++  A +    + ++  + +   LF I  + S ++ + S I S F    +L+L +     
Sbjct: 166 SAPQADLMTCVKSKLLLTVLSLGLFMIFFEFSAMIELSSFILSGFDRFSQLALSLGSSFA 225

Query: 296 SNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLI 355
              +                       +F++GS L ++S  +++F   R +   G+ +LI
Sbjct: 226 LIGLTLSALIEYPKLCTLKSSIIAGNVAFVVGSLLIFNSKLYFSFGLGRCINAIGA-ALI 284

Query: 356 ALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFC 415
              +   N  + +   +Y      +I  LG   G    G+F       W+  ++IP    
Sbjct: 285 IYTTFTTNLMAHELCKKY---VYYLISMLGAVCGTITSGVF----CDLWRKIYIIPTILA 337

Query: 416 LVNASIMLADIYSVKDNLHHE 436
           ++   I+L  +Y   D++ ++
Sbjct: 338 IIQ--IVLLFLYFPLDDITNK 356

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 85/208 (40%), Gaps = 21/208 (10%)

Query: 533 FCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLK 592
           F   AL+  + +   Y TIV N + LQ++ R+LP + S+    F+V        + Y   
Sbjct: 374 FSMLALIATLIYLPVYSTIVWNESYLQLSIRVLPIYLSM----FAVVLIQARYAKKYNTS 429

Query: 593 FVLSGVTLILYITLMGVGLSLPVWKQYV--CLSXXXXXXXXXXXXXXXXYHEYHEQRKSL 650
            + S V LI Y  L  +  S P W  +V  C+                      +  +  
Sbjct: 430 LLGSLVGLIGYYQLYSLDKSTPDWFHFVAGCIPLIGVTSVIMANT---------KNMRDF 480

Query: 651 NSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATES 710
             G +V      GG+  I L   +F +TL  +L + ++K   +G  KK+LLKI++   ++
Sbjct: 481 AVGILV------GGSATIILCQGLFTRTLHDTLRDNLLKLQSEGLKKKELLKILEKTIKN 534

Query: 711 SDWVHESAPKFIFKTLIECYLQACRNVF 738
             W    AP      +   +  A   +F
Sbjct: 535 PQWALIDAPAITRGAITNSFALAIHQIF 562

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 84/190 (44%), Gaps = 3/190 (1%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           FF ++DS+I+  I++++A EF E  +   I + +LL+N   Q                  
Sbjct: 54  FFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLT 113

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           A F F LG  L+  + +   F  AR + G G+G + A+ S   +      E       + 
Sbjct: 114 AHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRERGIFQGYAN 173

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGST 439
           I+F +G  +G  + GLF      GW+  F I VP  +  + + + ++     ++      
Sbjct: 174 IVFGMGQVLGAPLGGLFLDH--IGWRTLFGIQVPMIMFCSYLTITNVNIKLLHVPPRKER 231

Query: 440 FTLWKRVKKI 449
           FT WK + +I
Sbjct: 232 FT-WKNLSRI 240

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 78/172 (45%), Gaps = 8/172 (4%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++DS+I+  I++++A EF E  +   I + +LL+N   Q                  
Sbjct: 47  FLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLT 106

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           AQF F LG  L+  + +   F  AR + G G+G L A+ S  ++      E       + 
Sbjct: 107 AQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYAN 166

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKD 431
           I+F  G  +G  + G+F  +   GW+  F I VP       IML  + ++K+
Sbjct: 167 IVFGFGQLLGAPLGGVFIET--IGWRALFGIQVPV------IMLCSVLAIKN 210

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 79/164 (48%), Gaps = 4/164 (2%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++D +I+  I++++A EF E  +   I + YLL+N   Q                  
Sbjct: 48  FLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLT 107

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSAS 378
           A F F LG  L+  ++    F  AR + G G G + A+ S T+ +  +Q+    Y   A+
Sbjct: 108 AHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYAN 167

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIM 422
            I+F LG  +G  + GLF  +   GW+  F + VP  L+ +S++
Sbjct: 168 -IVFGLGQILGAPIGGLFIDTL--GWRILFGLQVPTILLCSSLV 208

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 77/167 (46%), Gaps = 2/167 (1%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++DS+I+  I++++A EF E  +   I + +LL+N   Q                  
Sbjct: 47  FLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLT 106

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           AQF F LG  ++  + +   F  AR V G G+G L A+ S  ++      E       + 
Sbjct: 107 AQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARERGVYQGYAN 166

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADI 426
           I+F  G  +G  + G+F  +   GW+  F + VP  +V + + + +I
Sbjct: 167 IVFGFGQLLGAPLGGIFIET--IGWRALFGVQVPMIIVCSILAIKNI 211

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++D +I+  I++++A EF E  R   I + +LL+N   Q                  
Sbjct: 47  FLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLT 106

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           A F F +G  L+  + +   F  AR + G G+G L A+ S  ++      E       + 
Sbjct: 107 AHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARERGVYQGYAN 166

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKD 431
           I+F LG  +G  + G+F  +   GW+  F + VP       IML  + ++K+
Sbjct: 167 IVFGLGQLLGAPLGGVFIET--IGWRALFGVQVPV------IMLCSVLAIKN 210

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 88/203 (43%), Gaps = 18/203 (8%)

Query: 265 DSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           D  I++ +   I  +FH+   +  +V+ Y LSNA+                   ++   F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSL 384
            +GS +S  S+   T I  R +AGFG   + +L   +     Q+N     ++A  + + +
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 385 GVAIGPFVVGLFDSSHGSGWKNAFLIPVP----------FCLVNAS------IMLADIYS 428
              +GPF+ G F+  H S W+  F I +P          FC  +         +L+ I S
Sbjct: 144 AEGVGPFIGGAFN-EHLS-WRWCFYINLPIGAFAFISLAFCCASGGKWLSKKWLLSKINS 201

Query: 429 VKDNLHHEGSTFTLWKRVKKILL 451
           +    ++E    + WK+V +IL+
Sbjct: 202 ITSYKYYEIFKASFWKKVFQILV 224

>KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 614

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 79/369 (21%), Positives = 148/369 (40%), Gaps = 48/369 (13%)

Query: 101 QAEGDDMEGKSEDKA-DQDHHKFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQM 159
           +A  DD    + D   +   H F +   +G        M D           + SD   +
Sbjct: 28  RASSDDTRSSASDPTLNAKMHSFDTAGNTGVAD--SGVMAD----------DVRSDTDVL 75

Query: 160 SERELPGSSTNSLEGNGDIHVAQSESE------RPTSKTLA-TATSAPAVPVSRAEISPY 212
           +ER+   +++ S E + +     + SE      R  S+ L+ +      V V  +   P 
Sbjct: 76  NERKRHSAASASFEQDLERTGTNATSETHAAINRRVSRILSGSQNEVEKVKVDYSHCPPM 135

Query: 213 GYGSISQTIEDVEDETDPSYIASTSSDAFVHQ---ETRRRIFSSCMCTYLFF----IAMD 265
           G G   +         +P  +A    D  +H      R+R F   +C  L      +AM 
Sbjct: 136 GGG---RPFPPTLPSREPYEVAFDGPDDPIHPYNWPMRKRAF---LCLLLGLNAVTVAMG 189

Query: 266 SSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           SSI    V +I +++H    + ++ V++Y+   A                    ++ F F
Sbjct: 190 SSIFASAVPQICAKYHVAQVVGVLGVTLYVFGFAASPVIYAPLSELYGRQKLLIISSFGF 249

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMNRFSQKNESRYSLSASVIIFS 383
           +L  + + ++    T +  RF AGF G+  L  + +   + F   NE+R     +V++F+
Sbjct: 250 VLFMFATATAKDLQTIMICRFFAGFIGAAPLAIVPACFFDMFD--NETR---GTAVVVFA 304

Query: 384 LGVAIGPFVVGLFDS--SHGSGWK-NAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTF 440
           +GV +GP +  +F S     + W+   + + +   LV  +I+LA  Y   +  HH     
Sbjct: 305 MGVFMGPILAPVFGSYIVQHTTWRWTQYCVGMFAALV--TILLAIFY---EETHHPTILV 359

Query: 441 TLWKRVKKI 449
              +R+++I
Sbjct: 360 NKARRMRQI 368

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 113/488 (23%), Positives = 186/488 (38%), Gaps = 53/488 (10%)

Query: 229 DPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSL 288
           D SY A+ +    V  ET+ RI    +    F  A+D++I+  ++  IAS+     ++S 
Sbjct: 23  DSSYDAAANHS--VLTETKTRIIVIALFLGSFLSALDTTIVSTLLPTIASDLDASSQMSW 80

Query: 289 IVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWS--SSHFWTFIFARFV 346
           I + YLLS +  Q                  +   F +G  L  S  +++ W     RF+
Sbjct: 81  IATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCGSPWTTNIWILSAGRFI 140

Query: 347 AGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKN 406
           AG G G L  L +   +      +         I FSLG A G  +  +     G GW+ 
Sbjct: 141 AGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGCASGSVLGAVLQ--QGIGWRW 198

Query: 407 AFLIPVPFCLVNASIMLADIYSVKDNL--------HHEGSTFTLWKRVKKILLSPDLYE- 457
           AFLI VP  L++  +++  +    D+         H  G+TF  W +V K++   D    
Sbjct: 199 AFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGNTFQ-WSKVTKMI---DFVGS 254

Query: 458 -IXXXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISM 516
                             D ++L   +   WV+  V+L+ G     +    T  N ++ +
Sbjct: 255 ITLVMSMLLLMITISFLSDPSQLSENS---WVVL-VLLVAGFCAKFVHTECTIHNPMVPL 310

Query: 517 SLQGDKRLI-------WTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLLPFFF 569
            L  + R +       W +T  +F   A+M  IP    ++  V       I  R +  F 
Sbjct: 311 RLLWENRTVFASSFTNWFMTMSTF---AVMYYIP---VFWQTVFKFTPYDIGFRSISNFV 364

Query: 570 SIVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILYITLMGVGLSLPVWK---------QYV 620
            I  G      + K   + +   F L  VT ILY T  G+ LSL             +Y+
Sbjct: 365 GIATGSMLAGVYMKCTGKYW--NFSL--VTNILYFT--GI-LSLFACTFRNTPQGVLEYL 417

Query: 621 CLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLT 680
            +                      +        SI Y F A G T+G+SL G ++  +L 
Sbjct: 418 LMFLPGFGYATMLTVTLLALIASVDFEHQAQVTSIQYAFRATGSTLGVSLAGLIYQASLQ 477

Query: 681 KSLHEEVM 688
             L+ +++
Sbjct: 478 YKLYRDIL 485

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 70/158 (44%), Gaps = 4/158 (2%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++DS+I+  I++K+A EF E  +   IV+ +LL+N   Q                 +
Sbjct: 51  FLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMV 110

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           A   F++G   +  S +   F  AR V G G+G + AL S  ++      E       + 
Sbjct: 111 AHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYAN 170

Query: 380 IIFSLGVAIGPFVVG-LFDSSHGSGWKNAFLIPVPFCL 416
           ++F  G  +G  + G L DS    GWK  F   VP  +
Sbjct: 171 VVFGTGSMLGGPIGGWLMDS---FGWKVIFAGQVPLIM 205

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 265 DSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           D  I++ +   I  +FH+   +  +V+ Y LSNA+                   ++   F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSL 384
            +GS +S  S+   T I  R VAGFG   + +L   +     ++N     ++A  I + +
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 385 GVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              +GPF+ G F+  H S W+  F I +P
Sbjct: 144 AEGVGPFIGGAFN-EHLS-WRWCFYINLP 170

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 93/193 (48%), Gaps = 9/193 (4%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++DS+I+  I++K+A EF E      I + +LL+N   Q                  
Sbjct: 45  FLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLT 104

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSAS 378
           A   F LG +L+  S++   F  AR + G G G + A+ S T+ +  + K+   Y   A+
Sbjct: 105 ALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKDRGIYQGYAN 164

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH--E 436
            I+F +G  +G  V GLF ++   GW+  F I VP  LV  +I+L ++Y V   L H   
Sbjct: 165 -IVFGMGQLLGAPVGGLFIATI--GWRALFWIQVP--LVIIAIILGEMY-VNIKLVHVPP 218

Query: 437 GSTFTLWKRVKKI 449
            S    WK + +I
Sbjct: 219 PSERFKWKNISRI 231

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 17/202 (8%)

Query: 265 DSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           D  I++ +   I  +FH+   +  +V+ Y L+NA+                   ++   F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSL 384
            +GS +S  S+   T I  R +AGFG   + +L   +     Q+N     ++A    + +
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 385 GVAIGPFVVGLFDSSHGSGWKNAFLIPVP---FCLVNASI------------MLADIYSV 429
              +GPF+ G F+  H S W+  F I +P   F L+  +             +L+ I S+
Sbjct: 144 AEGVGPFIGGAFN-EHLS-WRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSI 201

Query: 430 KDNLHHEGSTFTLWKRVKKILL 451
               + E    + WK+  K+ +
Sbjct: 202 MSYKYDEVFKASFWKKAFKVFV 223

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 88/194 (45%), Gaps = 11/194 (5%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  A+D +++  I++ IA+EF E  +   I + YLL+N   Q                  
Sbjct: 53  FVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVIT 112

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSAS 378
           A F F LG  L+  + +   F  AR + G G G + A+ S T+ +  S +    Y   A+
Sbjct: 113 AHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARERGVYQGYAN 172

Query: 379 VIIFS---LGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH 435
           V+  +   LG  IG F   L DS    GW++ F I VP  ++ + + L ++     ++  
Sbjct: 173 VVFGTGQLLGAPIGGF---LLDS---IGWRSIFGIQVPMLMLCSVLALKNVNIKLVHIPP 226

Query: 436 EGSTFTLWKRVKKI 449
               FT WK + +I
Sbjct: 227 RNERFT-WKNLSRI 239

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 78/178 (43%), Gaps = 12/178 (6%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQ-XXXXXXXXXXXXXXXXC 318
           F +A+D +I+  ++++IA EF E  +   I + +LL+N   Q                  
Sbjct: 51  FLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATL 110

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRF-SQKNESRYSLSA 377
           +AQF F LG  +S  + +   F   R V G G G + A+ S  ++   + K    Y   A
Sbjct: 111 IAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMYQGYA 170

Query: 378 SVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP---FCLV----NASIMLADIYS 428
           +++  S  +   P    L  +    GW+  F I VP   FC+     N +I LA + S
Sbjct: 171 NIVFGSGQLLGAPLGGLLITT---IGWRAIFAIQVPMALFCMFLTGRNVNIKLAHLPS 225

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 68/158 (43%), Gaps = 2/158 (1%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  A+D++I+ VI++++A +F+   +   I + YLL+N   Q                 +
Sbjct: 77  FLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDIIGRKYTQLI 136

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
             F F +GS+L+  S     F  AR VAG G G + A+ S  ++      E       + 
Sbjct: 137 VPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKERGMYQGYAN 196

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLV 417
           I +  G  IG  + GL       GW+  F   VP   V
Sbjct: 197 IFYGAGQLIGAPIGGLLIDR--IGWRALFAFQVPMVAV 232

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
           {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 660 GAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAP 719
           G       I + G  F   + ++L  E+ ++    +   +L   IK A  S +W+ E +P
Sbjct: 522 GTTSALFAIIVSGVPFKGIVQENLKRELSQYLPGDHSVDELKYAIKKALSSVEWIREDSP 581

Query: 720 KFIFKTLIECYLQACRNVFKLSAVFFTIMVISMF 753
             I  ++  CYL + R VF  + +F T + IS F
Sbjct: 582 DLISTSIFSCYLDSIRYVFIFN-LFCTCIGISFF 614

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 25/97 (25%)

Query: 1  MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIEN-------- 52
          MGKKD+QRK+LR+F +LK  Q+   +    +  E         N  PI +E         
Sbjct: 1  MGKKDKQRKRLRKFVQLKEAQRLFDDPTTPIAKETIL-----ANAIPIKLETKLNATLPT 55

Query: 53 ------------DKSEENKENTPLLLTSSERREDDGS 77
                       K  E+   +P L TS+  RE D S
Sbjct: 56 AKKEPDHELQRIKKGTESCLFSPKLTTSNPLRETDLS 92

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 85/186 (45%), Gaps = 14/186 (7%)

Query: 246 TRRRIFSSCM--CTYLFFIAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQX 302
           +++R F +C+  C     I+  SSI    V+++  ++H +  ++++ +++Y+L  A    
Sbjct: 188 SKKRKFLTCLILCIDCITISWGSSIYAPGVTQLCEQYHVIQVVAILGITLYVLGFAASPI 247

Query: 303 XXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTI 361
                           ++   F L  +   ++ +F T +  RF AGF G+  +  + +  
Sbjct: 248 IYAPLSELYGRKGVLVVSGLGFALFQFAVATAENFQTIMICRFFAGFIGAAPMAIVPAVF 307

Query: 362 MNRFSQKNESRYSLSASVIIFSLGVAIGPF---VVGLFDSSHGS-GWKNAFLIPVPFCLV 417
            + F      +     ++ +F+LGV +GP    V+G +   H +  W N +++    C V
Sbjct: 308 ADMFDTDFRGK-----AICLFTLGVFVGPILGPVMGSYIVQHTTWRWLN-YVVGFQACAV 361

Query: 418 NASIML 423
             +I+L
Sbjct: 362 FVAIVL 367

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 72/160 (45%), Gaps = 2/160 (1%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++D +I+  I++++A EF E  +   I + +LL+N   Q                 M
Sbjct: 46  FVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLM 105

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           A F  ++G  L+  + +   F  AR + G G G + A  S  ++      E       + 
Sbjct: 106 AYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKERGIYQGYAN 165

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNA 419
           I+F +G  +G  + GLF  +   GW+  F I VP  +V+A
Sbjct: 166 IVFGMGQMLGAPLGGLFIDTI--GWRAIFGIQVPVVMVSA 203

>Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028W
           (TPO1) - polyamine transport protein [contig 140] FULL
          Length = 613

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 77/181 (42%), Gaps = 17/181 (9%)

Query: 227 ETDPSYIASTSSDAFVHQ---ETRRRIFSSCMCTYLFF----IAMDSSILLVIVSKIASE 279
           + +P  +A    D  +H      R+R F   +C  L      +AM SSI    V ++   
Sbjct: 146 DREPYEVAFDGPDDPLHPYNWPARKRSF---LCLLLGLNAVTVAMGSSIFASAVPQVCEI 202

Query: 280 FHELWRLSLI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW 338
           +     + ++ V++Y+   A                    ++ F F+L  + + ++ +  
Sbjct: 203 YGVAQVVGVLGVTLYVFGFAASPVIYAPLSELYGRQRLLIISSFGFVLFMFATATAENLQ 262

Query: 339 TFIFARFVAGF-GSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFD 397
           T +  RF AGF G+  L  + +   + +  +N        +V++F++GV +GP +  +F 
Sbjct: 263 TIMICRFFAGFVGAAPLAIVPACFFDMYDNENR-----GTAVVVFAMGVFMGPILAPVFG 317

Query: 398 S 398
           S
Sbjct: 318 S 318

>SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} similar
           to uniprot|P25351 Saccharomyces cerevisiae YCR023C
           Hypothetical ORF
          Length = 657

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 334 SSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVV 393
           S +F+  +FAR + G  +G++  L++ I    S++     + S   ++F  G  IGP + 
Sbjct: 152 SQNFYQALFARSLMGLLNGNVAVLRTVIGEVASERRHQALAFSTMPLLFQFGSVIGPMIG 211

Query: 394 GLFDSSHGS 402
           G F    GS
Sbjct: 212 GFFSFPKGS 220

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 63/155 (40%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+  I+  +A +F    +   +V+ Y L NAI                   
Sbjct: 47  LFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLI 106

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
           +A   F  GS ++  +S     IF R VAG G   L  L   I      +      +S  
Sbjct: 107 LAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVISIL 166

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              F++   +GP + G F ++H + W+  F I +P
Sbjct: 167 SCAFAVAAIVGPIIGGAF-TTHVT-WRWCFYINLP 199

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+ S++ +  AIG                  +A F FI+G+ +  +S   W  ++  
Sbjct: 112 RTGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQYMIG 171

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R VAG G G +  L   +++  S KN     +S   ++ +LG+ +G
Sbjct: 172 RIVAGLGCGLIAILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLG 217

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 5/115 (4%)

Query: 641 HEYHEQRKSLNSG--SIVYCFGAIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKK 698
           H   +QRK L        Y        + I+    +F+  L KSL   + +   + + ++
Sbjct: 556 HYILQQRKDLQRSMWRNNYWKEVTAAGVAITGASILFNVALRKSLWTALEQLVSEEHPQE 615

Query: 699 DLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVFFTIMVISMF 753
            L +I+  A ESS W+  SAP+F  +T+   +      +F L+A+  T++  S+F
Sbjct: 616 QLQQILHRALESSHWIQHSAPEFAQETIYASFRHNFTTLF-LAAI--TLLTTSLF 667

>NDAI0D00820 Chr4 complement(183287..184975) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 72/155 (46%), Gaps = 10/155 (6%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+VS++ +  AIG                  +A F +I+G  +  +S   W  +   
Sbjct: 106 RTGLLVSIFNVGCAIGSVVLGRLGDTVGRRKGIVIAVFIYIVGIVIQIASIDKWYQYFIG 165

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGS- 402
           R +AG GSG++  L   +++  S K+     +S   ++ + G+ +G      + +++G+ 
Sbjct: 166 RIIAGLGSGTIAVLSPMLISEISPKHLRGTLVSCYQLMITFGMFLG------YCTNYGTK 219

Query: 403 GWKNA--FLIPVPFCLVNASIMLADIYSVKDNLHH 435
            + N+  + +P+  C   A +M+  ++ V ++  +
Sbjct: 220 TYDNSIQWRVPLGLCFAWALVMIGAMFIVPESPRY 254

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 79/194 (40%), Gaps = 4/194 (2%)

Query: 226 DETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWR 285
           D   P +  + +S+  +    R  +  + +    F  A+D  I+  I+  +++      +
Sbjct: 37  DANTPDH--NDNSNVRLMSGLRLYVCVAALVLATFIFALDVFIVNTIIDSVSASLGGYSK 94

Query: 286 LSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARF 345
              +++ Y L N++                   ++ F F +GS +S S++     I  R 
Sbjct: 95  SGWLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRV 154

Query: 346 VAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWK 405
           +AG G   L  L   I +   ++      +S  +  F+    IGPFV G F ++H   W+
Sbjct: 155 IAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAF-TTH-VIWR 212

Query: 406 NAFLIPVPFCLVNA 419
             F I +P   V A
Sbjct: 213 WCFWINLPIGAVTA 226

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 66/155 (42%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+  I+ ++A +      +  + + Y L NA+                   
Sbjct: 71  LFLAALDVMIVSTIIEEVAKQLGSYSEIGWLFTGYSLPNALLVLIWGRIATPIGFKATML 130

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
            A   F +GS +S  +S     I  R +AG G   + +L   I +   ++++    ++  
Sbjct: 131 FAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGSTLVEESKRGMLIAIL 190

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              F++   +GPF+ G+F SS    W+  F I +P
Sbjct: 191 SSSFAIASVVGPFLGGVFTSS--VTWRWCFYINLP 223

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 61/141 (43%), Gaps = 2/141 (1%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+ S++ + NAIG                  +A   FI+G+ +  +S   W  ++  
Sbjct: 115 RTGLLTSMFNIGNAIGCFFLGRLGDMYGRRIGLIVAAVIFIVGNIIQIASIRAWYQYMIG 174

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R VAG G+G +  L   +++  + KN     +S   ++ +LG+ +G     G     + +
Sbjct: 175 RIVAGVGAGLIAILSPMLISEVAPKNSRGAMVSCYQLMITLGIFLGYCTNFGTKRYHNST 234

Query: 403 GWKNAFLIPVPFCLVNASIML 423
            W+    +   +CL   S M+
Sbjct: 235 QWRVGVGLQFAWCLCMISAMM 255

>KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 589

 Score = 38.9 bits (89), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 9/140 (6%)

Query: 262 IAMDSSILLVIVSKIASEFHELWRLSLI--VSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           I M SSI    V+ I SE +E+  +  I  +++Y+L  A                    +
Sbjct: 160 ITMGSSIFASAVTTI-SEIYEVANVVSILGITLYVLGFAASPVIYAPLSELYGRQGVLLI 218

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMNRFSQKNESRYSLSAS 378
           A F F L  +   ++ +  T +  RF  GF G+  L  + ++  + F   N  R     +
Sbjct: 219 ASFGFALFQFAVATAENLQTILICRFFGGFIGAAPLAVVPASFSDMFD--NTQR---GTA 273

Query: 379 VIIFSLGVAIGPFVVGLFDS 398
           V +F+LGV +GP +  +F S
Sbjct: 274 VTMFALGVFVGPILAPVFGS 293

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 77/170 (45%), Gaps = 2/170 (1%)

Query: 263 AMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQF 322
           A+D +I+   +++IAS F E  +++ + + Y+L+    Q                  A+ 
Sbjct: 62  AVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEV 121

Query: 323 SFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIF 382
            FI+G  +  ++      I AR + G G   L A+ + I++  +  ++         +I+
Sbjct: 122 VFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQRSIYWGWGSVIW 181

Query: 383 SLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
               ++G  + GL  +  G   +  F++ +PFCL + S+ +  I+ + + 
Sbjct: 182 GFSQSVGGPLGGLLLNWFGV--RGLFVVQIPFCLFSLSLTVKYIHDLSNQ 229

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 65/164 (39%), Gaps = 2/164 (1%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I + +   I   F++   +  +++ Y L NA+                   
Sbjct: 17  LFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLV 76

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
            +   F  GS L+  ++     I  R +AGFG   +  L   +  R   +      ++  
Sbjct: 77  ASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEKHRARVVTIL 136

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIM 422
            I + L    GPF+ G F + H S W+  F I +P   V  +I+
Sbjct: 137 GIAYMLAEGAGPFIGGAF-AEHVS-WRWCFFINIPIGGVALAIL 178

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 77/206 (37%), Gaps = 4/206 (1%)

Query: 243 HQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQX 302
           +  TR  +    +   +F  A+D  I+  I+  +   F +  +   IV+ Y L NA+   
Sbjct: 37  NNNTRLLLSLFSLGLSMFVTALDVLIVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSL 96

Query: 303 XXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIM 362
                                F  GS +S  +      I  R V+G G   L  L   I 
Sbjct: 97  LWGRISANLGPRISIVACIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIG 156

Query: 363 NRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIM 422
            +   +      LS     F++   IGPF+ G F ++H + W+  F I +P   V     
Sbjct: 157 CQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAF-TTHVT-WRWCFYINLPIGGVAILTF 214

Query: 423 LADIYSVKDNLHHEGSTFTLWKRVKK 448
           L       +NL  EG     +KRV K
Sbjct: 215 LCFYNPHNENLLEEGK--KAFKRVLK 238

>NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 45/258 (17%), Positives = 99/258 (38%), Gaps = 27/258 (10%)

Query: 197 TSAPAVPVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMC 256
           T A  +P+++    P   G+ S +    ED+          +D+ +  + R+ +F  C+C
Sbjct: 34  TDAQTIPITQGSSVPRSQGT-SNSFTTKEDQMSE---LQKEADSQLESKPRKDLFFVCLC 89

Query: 257 TYL-----FFIAMDSSILLVIVSKI------------ASEFHELWRLSLIVSVYLLSNAI 299
             +     F    D+  +   + +              + +    R  LIVS++ +  AI
Sbjct: 90  CIMVSFGGFIFGWDTGTISGFIRQTDFIRRFGQTRANGTHYLSTVRTGLIVSIFNIGAAI 149

Query: 300 GQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFARFVAGFGSGSLIALK 358
           G                       +I+G  +  +S + W  +   R ++G G G +  L 
Sbjct: 150 GGITLSKTGDMWGRRLGLITVIGIYIVGILIQITSFNKWYQYFIGRIISGLGVGGITVLA 209

Query: 359 STIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGSGWKNAFLIPVPFCLV 417
             +++  + K      +S   ++ +LG+ +G     G  + S+   W+    +P+  C  
Sbjct: 210 PMLISEVAPKKLRGTMVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWR----VPLGLCFA 265

Query: 418 NASIMLADIYSVKDNLHH 435
            A  M++ +  V ++  +
Sbjct: 266 WALFMISGMTLVPESPRY 283

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 66/159 (41%), Gaps = 2/159 (1%)

Query: 255 MCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXX 314
           +C  LF  A+D  I + +   I  EF++   +  +++ Y L NA+               
Sbjct: 13  LCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLK 72

Query: 315 XXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYS 374
                +   F  GS ++ +++     I AR ++GFG   + +L   +     ++      
Sbjct: 73  CSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEKHRARV 132

Query: 375 LSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
           ++   I + L    GPFV G   + H S W+  F + +P
Sbjct: 133 ITVLGIAYMLAEGAGPFVGGGL-AEHVS-WRWCFYVNLP 169

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score = 38.1 bits (87), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 66/153 (43%), Gaps = 6/153 (3%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIVS++ +  AIG                       +++G  +  +SS+ W  +   
Sbjct: 117 RTGLIVSIFNIGCAIGGLTLGRLGDMYGRRLGLMAVILVYVVGIIIQIASSNKWYQYFIG 176

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R V+G G G +  L  T+++  + K+     +S   ++ +LG+ +G     G    S+  
Sbjct: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFMGYCTNYGTKTYSNAV 236

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH 435
            WK    +P+  C + A  M+A +  V ++  +
Sbjct: 237 QWK----LPLGLCFLWAIFMIAGMIFVPESPRY 265

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 38.1 bits (87), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 79/164 (48%), Gaps = 7/164 (4%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++D+SI+  I++KIA EFHE  +   + + +LL+NA  Q                 +
Sbjct: 55  FLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLI 114

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKS-TIMNRFSQKNESRYSLSAS 378
           AQ  F+LG+ L+  + +   F  AR + G G G + A+ S T+ +  + K    Y   A+
Sbjct: 115 AQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGYAN 174

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAF---LIPVPFCLVNA 419
           V IF  G  +G  V GL   +    W+  F   ++ +  C++ A
Sbjct: 175 V-IFGAGQVLGAPVGGLIMETF--NWRIIFAAQVVAIMICMILA 215

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+ S++ +  AIG                  +A   FI+G+ +  +S   W  ++  
Sbjct: 119 RTGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIG 178

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R +AG G G +  L   +++  S KN     +S   ++ +LG+ +G
Sbjct: 179 RIIAGLGCGLIAILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLG 224

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           +F  A+D  I+  I+  +A EF +  +   I + Y L +A+                   
Sbjct: 65  IFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSML 124

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
            A   F +GS ++  ++     I  R +AG G   +  L   I++   ++++    ++  
Sbjct: 125 TAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKRGLLIACM 184

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              F +   +GPF+ G F ++H + W+  F I +P
Sbjct: 185 GSAFGIASVVGPFLGGAF-TTHVT-WRWCFWINLP 217

>Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON}
           (12238..13980) [1743 nt, 581 aa]
          Length = 580

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 53/253 (20%), Positives = 103/253 (40%), Gaps = 22/253 (8%)

Query: 201 AVPVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLF 260
           A+P+      P G     Q     +   DP +        F    T++    + +C    
Sbjct: 99  ALPMGGGRPYPPGLPDRDQFQVTFDGPDDPLH-------PFNWTTTKKVFLCTVLCLDCI 151

Query: 261 FIAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
            I M SSI    V ++  EFH +  +S++ +++Y+L  A                    +
Sbjct: 152 AITMGSSIFGSGVLQLNEEFHVITVVSVLGITLYVLGFAASPIIYAPLSELYGRKGVIIL 211

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMNRFSQKNESRYSLSAS 378
           + F F +  +    S  F + +  RF  G  G+  +  + +   + F      +     +
Sbjct: 212 SAFGFSVFQFAVAVSKDFQSIMICRFFGGLIGAAPMAVVPACFADMFDTNMRGK-----A 266

Query: 379 VIIFSLGVAIGPF---VVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH 435
           + +FSLGV +GP    V+G +   H + W+  +L  V  C  +A+I +A ++ +++  HH
Sbjct: 267 IALFSLGVFVGPILGPVMGSYIVQH-TTWR--WLEYVIGCF-SAAIFVALLFFMEET-HH 321

Query: 436 EGSTFTLWKRVKK 448
                   K+++K
Sbjct: 322 PSILVNKAKQMRK 334

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 17/197 (8%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  A+D +I+  I++++A EF E  +   I + +LL+N   Q                 +
Sbjct: 62  FLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLV 121

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           A   F LG  L+  + +   F  AR + G G G + A+ S  ++      E       + 
Sbjct: 122 AHTFFCLGCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARERGAYQGYAN 181

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLV-------NASIMLADIYSVKDN 432
           ++FS G  +G  + G   +    GW+  F + VP  L+       N +I LA +  +++ 
Sbjct: 182 VVFSTGQLLGAPLGGF--ALDRIGWRAIFGLQVPMLLICMVLGYRNVNIKLAHVPPLEER 239

Query: 433 LHHEGSTFTLWKRVKKI 449
                  FT WK + +I
Sbjct: 240 -------FT-WKNLSRI 248

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIVS++ +  AIG                  +A   FI+G+ +  +S   W  +   
Sbjct: 117 RTGLIVSIFNVGCAIGCVALGRLGDMYGRRMGLIIASIIFIVGNVIEIASVEAWYQYFIG 176

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R VAG G G +  L   +++  S K      +S   ++ ++G+ +G
Sbjct: 177 RIVAGVGMGVIAVLSPMLISEVSPKAMRGAMVSCYQLMITMGIFLG 222

>CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1
          Length = 577

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 59/303 (19%), Positives = 126/303 (41%), Gaps = 20/303 (6%)

Query: 111 SEDKADQDHHKFLSQDESGTKSPLQNSMIDFSD-RSISPLQSITSDHTQMSERELPGSST 169
           S   +D+ +     ++E    S ++++  D  + RS  P + +  + +Q+ ++  P  S 
Sbjct: 2   SSTSSDRPYDPLAPENEGVASSDVEST--DSGEIRSYGP-EEVLKNGSQIKDKG-PALSK 57

Query: 170 NSLEGNGDIHVAQSESERPTSKTLATATSAPAV-PVSRAEISPYGYGSISQTIEDVEDET 228
           NS + +  +  A + + R  SK L      P V  V  ++  P G G         + + 
Sbjct: 58  NSTQTSA-VESAVAANRR-LSKILTNTVDEPDVLEVDYSKCPPMGGGRPFPPTLPEKTQF 115

Query: 229 DPSYIASTSSDAFVHQETRRRI-FSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLS 287
           + ++          +   R+++     +C     I M SSI    + +I   +H +  ++
Sbjct: 116 EVTFDGPNDPLHPFNWPLRKKVMLCIILCLNCISITMGSSIFATGIRQICEIYHVIPVVA 175

Query: 288 LI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFV 346
           ++ +++Y+L  A                    ++ F F L ++   ++    T +  RF 
Sbjct: 176 ILGITLYVLGFAASPVIYAPLSEIYGRRGVLVISSFGFALFNFAVATAKDLQTIMICRFF 235

Query: 347 AGF-GSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPF---VVGLFDSSHGS 402
           AGF G+  L  + +   + F      +     ++ +FSLGV +GP    V+G + + H +
Sbjct: 236 AGFIGAAPLAVVPAAFADMFDTNIRGK-----AICLFSLGVFVGPILAPVIGSYITQH-T 289

Query: 403 GWK 405
            W+
Sbjct: 290 TWR 292

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 71/157 (45%), Gaps = 6/157 (3%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+  I+  ++ +F+E  +   +V+ Y L  A+                   
Sbjct: 53  LFLSALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSML 112

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
           ++   F +GS +S  ++     I  R ++G G   L  L   I++     NE    ++ S
Sbjct: 113 LSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTL--VNERSRGMAIS 170

Query: 379 VIIFSLGVA--IGPFVVGLFDSSHGSGWKNAFLIPVP 413
           V+  S  VA  +GPF+ G F ++H + W+  F I +P
Sbjct: 171 VLSCSFAVASIVGPFLGGAF-TTHVT-WRWCFYINLP 205

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+ S++ +  AIG                  +A   FI+GS +  +S   W  ++  
Sbjct: 117 RTGLLTSMFNVGQAIGCFFLGRLGDIYGRRIGLIVASVIFIIGSVIQIASVKAWYQYMIG 176

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R VAG G G +  L   +++  S KN     +S   ++ +LG+ +G
Sbjct: 177 RIVAGIGCGLIAILSPMLISEVSPKNMRGAMVSCYQLMVTLGIFLG 222

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 57/141 (40%), Gaps = 2/141 (1%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+VS++ +  AIG                  MA   F++G  +  +S   W  +   
Sbjct: 116 RTGLLVSIFNVGCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIG 175

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R +AG G G +  L   +++  S K+     +S   ++ ++G+ +G     G    S  +
Sbjct: 176 RIIAGIGMGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDST 235

Query: 403 GWKNAFLIPVPFCLVNASIML 423
            W+    +   +CL     M+
Sbjct: 236 QWRVGLGLQFAWCLCMVGGMM 256

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 61/155 (39%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           +F  A+D  I+  I+  +   F +  +   IV+ Y L NA+                   
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
                F  GS +S  ++     I  R VAG G   L  L   I  +   +      LS  
Sbjct: 114 SCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLL 173

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              F++   +GPF+ G F ++H + W+  F I +P
Sbjct: 174 NCTFAVASIVGPFLGGAF-TTHVT-WRWCFYINLP 206

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 76/179 (42%), Gaps = 9/179 (5%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+   +  IA +F +  +   IVS Y L+ A+                   
Sbjct: 128 LFLAALDVLIISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLL 187

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
           ++   F  GS +S  S+     I  R VAG G   + +L   I +  +        +S  
Sbjct: 188 VSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLTPDRSRVIIISVL 247

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIY------SVKD 431
              +++   +GPF+ G   ++H + W+  F I +P   + A ++LA +Y      S+KD
Sbjct: 248 SCSYAVAAVVGPFLGGAL-TTHVT-WRWCFYINLPIGGL-AFVVLAMVYNPSGRKSIKD 303

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 61/147 (41%), Gaps = 14/147 (9%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+ S++ +  AIG                  +A   FI G+ +  +S   W  ++  
Sbjct: 122 RTGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIG 181

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSG 403
           R VAG G G +  L   +++  S KN     +S   ++ +LG+ +G      + +++G+ 
Sbjct: 182 RIVAGLGCGLIAILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLG------YCTNYGTK 235

Query: 404 -------WKNAFLIPVPFCLVNASIML 423
                  W+    +   +CL+    ML
Sbjct: 236 RYHDSTQWRVGLGLQFAWCLLMIGAML 262

>KNAG0B04370 Chr2 (835663..837336) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 10/93 (10%)

Query: 342 FARFVAGFGSGSL--IALKSTIMNRFSQKNE------SRYSLSASVIIFSLGVAIGPFVV 393
           F  F+ G+ +G++     ++  + RF QKN       S+      V IF++G AIG  V+
Sbjct: 64  FGGFIFGWDTGTISGFVAQTDFLRRFGQKNADGTHYLSKVRTGLVVSIFNIGCAIGGLVL 123

Query: 394 GLFDSSHGSGWKNAFLIPVPFCLVNASIMLADI 426
                +HG   K A  I V   +V   I +A I
Sbjct: 124 AKLGDTHGR--KLALAIVVSIYIVGIVIQIASI 154

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 76/202 (37%), Gaps = 5/202 (2%)

Query: 215 GSISQTIEDVEDETDPSYI---ASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILLV 271
           G  S+    + DET    +   A  + DA      +  +    +   +F  A+D  I+  
Sbjct: 7   GQNSEYNRKISDETKDLSVKQSACIAPDASKRNRVKLFLSLLSLGLSMFVTALDVLIVGT 66

Query: 272 IVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLS 331
           I+  + + F +  +   IV+ Y L NA+                        F  GS +S
Sbjct: 67  IIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETGSLIS 126

Query: 332 WSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPF 391
             +      I  R +AG G   L  L   I  +   +      LS     F++   +GPF
Sbjct: 127 ALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPF 186

Query: 392 VVGLFDSSHGSGWKNAFLIPVP 413
           + G F ++H + W+  F I +P
Sbjct: 187 LGGAF-TTHVT-WRWCFYINLP 206

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 73/164 (44%), Gaps = 8/164 (4%)

Query: 252 SSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXX 311
           S  +C  LF  A+D   +  I+ +++ +F +  ++  + + Y L NA+            
Sbjct: 48  SLVLC--LFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLV 105

Query: 312 XXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNES 371
                   A   F +GS +S  ++     I  R +AG G   + +L   I +   +  E 
Sbjct: 106 GFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVE--ER 163

Query: 372 RYSLSASVIIFSLGVA--IGPFVVGLFDSSHGSGWKNAFLIPVP 413
              L  +V+  S G+A  +GPF+ G F ++H + W+  F I +P
Sbjct: 164 NRGLIIAVMSSSFGIASVVGPFLGGAF-TTHVT-WRWCFYINLP 205

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/152 (19%), Positives = 65/152 (42%), Gaps = 2/152 (1%)

Query: 262 IAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQ 321
           +A+D  I+  ++  ++       +   +++ Y L N++                   ++ 
Sbjct: 88  VALDVFIVNTVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISI 147

Query: 322 FSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVII 381
           F F +GS +S +++     +  R VAG G   L  +   I     ++      ++  +  
Sbjct: 148 FIFEVGSIVSATATSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSA 207

Query: 382 FSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
           F++   IGPF+ G F ++H + W+  F I +P
Sbjct: 208 FAVSSLIGPFIGGAF-TTHAT-WRWCFWISLP 237

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 66/155 (42%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+   +  I+ +F++  +   IVS Y L  A+                   
Sbjct: 51  LFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLL 110

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
           ++   F  GS +S  S+     I  R VAG G   + +L   I +  + +     ++S  
Sbjct: 111 LSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVL 170

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              +++    GPF+ G F ++H + W+  F I +P
Sbjct: 171 SCAYAVAAVAGPFMGGAF-TTHVT-WRWCFYINLP 203

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 57/141 (40%), Gaps = 2/141 (1%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+VS++ +  AIG                  MA   F++G  +  +S   W  +   
Sbjct: 117 RTGLLVSIFNVGCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIG 176

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R +AG G G +  L   +++  S K+     +S   ++ ++G+ +G     G    S  +
Sbjct: 177 RIIAGIGMGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDST 236

Query: 403 GWKNAFLIPVPFCLVNASIML 423
            W+    +   +CL     M+
Sbjct: 237 QWRVGLGLQFAWCLFMVGGMM 257

>KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weakly
           similar to uniprot|P42833 Saccharomyces cerevisiae
           YNL318C, HXT14 protein with similarity to hexose
           transporter family members, expression is induced in low
           glucose and repressed in high glucose; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studie
          Length = 528

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 5/105 (4%)

Query: 286 LSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWS-SSHFWTFIFAR 344
           + LIVS++ +S A+G                   A   + LG+ + W+  S +W F FAR
Sbjct: 109 IGLIVSIFNISCALGGLFLVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFAR 168

Query: 345 FVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           F++G G G+     + ++  F  ++       A V+++ L + +G
Sbjct: 169 FISGLGVGA----TAVMIPMFIAESAPINIRGAMVVLYQLMITLG 209

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 112/567 (19%), Positives = 210/567 (37%), Gaps = 47/567 (8%)

Query: 203 PVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFI 262
           P  R  + P  Y SIS+  +       PS+           +  +  +  + + T +F  
Sbjct: 8   PNERKNVPP-SYSSISREEQMFSLTERPSW----------SERHKVLLIETALFTNVFLS 56

Query: 263 AMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQF 322
            +DS+I       I +EF ++   S I + YL++    Q                  A  
Sbjct: 57  GLDSTISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANT 116

Query: 323 SFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNR--FSQKNESRYSLSASVI 380
            F LG +   +++  ++ I  R       G  +   STI+N      K    Y    +V+
Sbjct: 117 IFALGCFGCGTTTTIYSLILMR-ALTGIGGGGLITLSTIINSDIIPAKKRGIYQAFQNVL 175

Query: 381 IFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTF 440
           +   G  +G    GL  ++   GW+  FL+ VP  +    +    ++  + +++   S  
Sbjct: 176 L-GTGAVVGASCGGLIATTM--GWRWCFLLQVPISVGGTLVAFFFVHDQRPDINGGVSAV 232

Query: 441 --TLWKRVKKILLSPDLYEIXXXXXXXXXXXXXXXXDLTELEHRTMIQWVLFSVILICGV 498
             T W++++KI  S  L  +                  +E    +    VL     +  +
Sbjct: 233 RTTGWEKLEKIDFSGALLLVLGLACQLFFLTLNSTSKSSESYWYSPQSIVLTLSTGVSLI 292

Query: 499 LFWLIEANDTYMNSVISMSL----QGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLN 554
           LF  +E + T  N +I   L     G   LI +V  + F   A +  +P    YF +V+ 
Sbjct: 293 LFAYVE-HTTKANPIIPHDLLRQAHGATVLIISVL-VGFVAYAYIFTLPL---YFQVVIG 347

Query: 555 LNTLQIAERL-LPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILY--ITLMGVGL 611
               +   RL +P F + + G  +       K  N+L   ++SG+T +L   +  + +  
Sbjct: 348 DTAAKAGLRLTVPSFCTPIGGLITGL---SMKNPNHLPVLLISGITCMLLGNLCFLFIKP 404

Query: 612 SLPVWKQYVCLSXXXXXXXXXXXXXXXXYHEYHEQRKSLNSGSIVYCFGAIGGTIGI--- 668
             P W+  + L                 +       K   + S +Y F ++G   G+   
Sbjct: 405 WTPYWQTSLLLVPANVGQGITFPSTLFTFLFAFPPYKQATATSTLYLFRSVGCVWGVAGT 464

Query: 669 -SLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLI 727
            SL  Y       KSL+  +         +K++ K++   + ++  + +  P  +   +I
Sbjct: 465 SSLIQYAVRNQAKKSLNGLLT--------EKEIRKLLLQLSHTTSQIKKLPPD-VRSAVI 515

Query: 728 ECYLQACRNVFKLSAVFFTIMVISMFF 754
             Y  A R  + LS    TI ++  F 
Sbjct: 516 SSYDNAIRQAYFLSVFLCTIAILLSFL 542

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 66/159 (41%), Gaps = 5/159 (3%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F  ++D +I+  I++++A EF E  +   I + +LL+N   Q                  
Sbjct: 44  FIGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLT 103

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASV 379
           A F F LG  L+  +     F  AR + G G G + A  S  ++      E       + 
Sbjct: 104 AHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKERGSYQGYAN 163

Query: 380 IIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP---FC 415
           I+F  G  +G  + GL   +   GW+  F + VP   FC
Sbjct: 164 IVFGTGQMLGGPIGGLLIDT--IGWRAIFAVQVPIIMFC 200

>KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {ON}
           Anc_4.30 YLL028W
          Length = 589

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 72/165 (43%), Gaps = 11/165 (6%)

Query: 246 TRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXX 304
            R+ I    +C     I + S+I    V +I +EFH +  ++++ +++Y+L  A      
Sbjct: 146 ARKIIPCFILCLNCICITLGSAIYASGVLQICAEFHIIQVVAILGITLYVLGFAASPVIF 205

Query: 305 XXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMN 363
                         ++ F F + ++   ++    T +  RF AGF G+  L  + +   +
Sbjct: 206 APLSEVYGRKGVLVVSAFGFTIFNFAVATAKDLQTLLICRFFAGFIGAAPLAVVPAAFAD 265

Query: 364 RFSQKNESRYSLSASVIIFSLGVAIGPF---VVGLFDSSHGSGWK 405
            F      +     ++ +FSLGV +GP    V+G +   H + W+
Sbjct: 266 IFDTNVRGK-----AICLFSLGVFVGPILGPVIGSYIVQH-TTWR 304

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 63/149 (42%), Gaps = 2/149 (1%)

Query: 265 DSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           D  I+  I+ ++A +F     +  + + Y L NA+                    A   F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSL 384
            +GS +S  ++     I  R +AG G   + +L   I +   ++++    ++     F++
Sbjct: 143 EIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAI 202

Query: 385 GVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              +GPF+ G+F SS    W+  F + +P
Sbjct: 203 ASVVGPFLGGVFTSS--VTWRWCFYVNLP 229

>TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+V+++ +  AIG                  MA   F+ G  +  +S+  W  +   
Sbjct: 119 RTGLLVAIFNIGCAIGSVTLGRVGDVYGRRLGLIMATIIFVAGVVIQIASTDKWYQYFIG 178

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R +AG G G +  L   +++  S K+     +S   ++ + G+ +G
Sbjct: 179 RIIAGIGMGVIAVLSPMLISEVSPKHLRGAMVSCYQLMITFGIFLG 224

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 62/149 (41%), Gaps = 2/149 (1%)

Query: 265 DSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           D+ I+  I+ ++A +F     +  + + Y L NA+                    A   F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSL 384
            +GS +S  ++     I  R +AG G   + +L   I +   +++     ++     F++
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 385 GVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              +GPF+ G+F S     W+  F I +P
Sbjct: 212 ASVVGPFLGGVFTSR--VTWRWCFYINLP 238

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score = 35.0 bits (79), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 61/147 (41%), Gaps = 1/147 (0%)

Query: 247 RRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFH-ELWRLSLIVSVYLLSNAIGQXXXX 305
           RR I   C+  + F     +S+L    SK+++E    L ++S +V   +LS  +G     
Sbjct: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFAS 172

Query: 306 XXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRF 365
                        +    F++GS     S+ F   + +R V+GFG  ++ +L S  +   
Sbjct: 173 PTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEI 232

Query: 366 SQKNESRYSLSASVIIFSLGVAIGPFV 392
              +E  Y L    ++   G  + P +
Sbjct: 233 YFAHERAYRLGIYTLLLLGGKNLVPLL 259

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 60/149 (40%), Gaps = 2/149 (1%)

Query: 265 DSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           D  I+  I+  +A +F    +   I + Y L NA+                    A   F
Sbjct: 94  DIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIF 153

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSL 384
            +GS +S  ++     I  R +AG G   + +L   I +    +      ++     F++
Sbjct: 154 EIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAV 213

Query: 385 GVAIGPFVVGLFDSSHGSGWKNAFLIPVP 413
              IGPF+ G F ++H + W+  F I +P
Sbjct: 214 ASVIGPFLGGAF-TTHAT-WRWCFYINLP 240

>TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 34.7 bits (78), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+V+++ +  AIG                  MA   F+ G  +  +S+  W  +   
Sbjct: 118 RTGLLVAIFNVGCAIGSVTLGRVGDVYGRRLGLIMATIIFVAGVVIQIASTDKWYQYFIG 177

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R +AG G G +  L   +++  S K+     +S   ++ + G+ +G
Sbjct: 178 RIIAGIGMGVIAVLSPMLISEVSPKHLRGAMVSCYQLMITFGIFLG 223

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 81/216 (37%), Gaps = 6/216 (2%)

Query: 210 SPYGYGSISQT--IEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSS 267
           S   YGSIS+T   E+  +E +  + A    D  +       I  + + T +F    D +
Sbjct: 14  SATSYGSISETRIPENSLEELENIHGADEDEDIKLSDIPNLWIIEAALFTNVFLSGFDGT 73

Query: 268 ILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILG 327
           +       I +EF+ +   S I + YL+++   Q                  A  SF +G
Sbjct: 74  VTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIG 133

Query: 328 SYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSA-SVIIFSLGV 386
                 S +     F R       G  +   STI+N     +  R    A   ++  LG 
Sbjct: 134 CLACGLSPNIVVLSFMR-ALTGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLLGLGA 192

Query: 387 AIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIM 422
             G    G   SS G  W+  F + VP C+ N+ IM
Sbjct: 193 ICGASFGGSIASSIG--WRWCFFVQVPICITNSLIM 226

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 75/194 (38%), Gaps = 28/194 (14%)

Query: 263 AMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQF 322
           A+D +I+   V+ +AS F +   ++ + + YLL+    Q                   + 
Sbjct: 116 ALDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEI 175

Query: 323 SFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNE-SRYSLSASVII 381
            F +G  L   S        AR + G G     A+ + I++  +  +E  +Y        
Sbjct: 176 VFAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSERGKY-------- 227

Query: 382 FSLGVAIGPFVVGLFDSSHGS---------GWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
           +  G  +G    G+F S  G          G    F+  +PFCL  A++ L+  Y    N
Sbjct: 228 WGYGSMLG----GVFQSLGGPLGGILLTYFGVSGLFIPQIPFCL--ATLYLSWKYVQDYN 281

Query: 433 LHHEGSTFTLWKRV 446
              +GS    WKR+
Sbjct: 282 QDTKGS----WKRI 291

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 69/176 (39%), Gaps = 3/176 (1%)

Query: 265 DSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSF 324
           D  I++ +   I  +F +  R+  +V+ Y L NA+                    +   F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSL 384
            +GS +   S+     I  R VAG G   + +L   +     ++      ++   + F++
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 385 GVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTF 440
             A+GP + G F  +    W+  F I +P   V A  ML   Y+  +    E  T+
Sbjct: 143 AFAVGPVIGGAF--TENVSWRWCFYINLPIGGV-ALTMLTFSYNTTEKSVQETLTY 195

>ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]
           {ON} similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048W Hypothetical ORF
          Length = 547

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 95/234 (40%), Gaps = 38/234 (16%)

Query: 225 EDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYL-FFIAMDSSILLVIVSKIASEFHEL 283
           E   DP  IA       +H    R+ + S + T +   I M SS   ++   + S FH  
Sbjct: 88  EGSMDPENIA-------MHLSWPRKYYVSTLVTLISGIITMISSCWSLVAEDVMSHFHIS 140

Query: 284 WRLSLI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWT--- 339
             +S++ +S+Y+     G                     F F L   ++W     W+   
Sbjct: 141 REVSVLGISLYIFGLGCGPLLLSPISELYGRRI-----TFIFSLSFSVAWQCLVIWSPTI 195

Query: 340 --FIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFD 397
              +F RF++GF   S +++ S  ++    K++    ++   +    G ++GP + G F+
Sbjct: 196 EGVLFGRFLSGFFGSSFLSVASGTISDIFTKDQIGIPMTFYALAPFAGPSLGPVLSGAFN 255

Query: 398 SSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRVKKILL 451
                G+K  F++     ++ +S++L  +            TFT+ +  K +LL
Sbjct: 256 K---DGYKWPFIV----MMIVSSVLLGLV------------TFTVPESYKPVLL 290

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 12/175 (6%)

Query: 263 AMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQF 322
           A+D +I+   ++++AS F E   ++ + + Y+L+    Q                  A+ 
Sbjct: 65  AIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEV 124

Query: 323 SFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIF 382
            FI+G  L   +        AR + G G   L A+ + I++  +        LS   I +
Sbjct: 125 VFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAP-------LSQRSIYW 177

Query: 383 SLGVAIGPFVVGLFDSSHGS-----GWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
            LG  I  F   +     G      G    F+I VPFCL +  + +  I+ + D 
Sbjct: 178 GLGSLIWGFSQSIGGPLGGLLLNWFGVSGLFVIQVPFCLFSLFLTVRYIHDLTDQ 232

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 56/141 (39%), Gaps = 2/141 (1%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+VS++ +  AIG                  MA   F++G  +  +S   W  +   
Sbjct: 117 RTGLLVSIFNIGCAIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIG 176

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R +AG G G +  L   +++  S +      +S   ++ +LG+ +G     G    S+  
Sbjct: 177 RIIAGVGMGVIAILSPMLISEVSPREMRGAMVSCFQLMITLGIFLGDCTEYGTKTYSNSV 236

Query: 403 GWKNAFLIPVPFCLVNASIML 423
            W+    +   +CL     M+
Sbjct: 237 QWRVGLGLQFAWCLCMVGGMM 257

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/155 (18%), Positives = 69/155 (44%), Gaps = 10/155 (6%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+VS++ +  AIG                  +    +I+G  +  +S   W  +   
Sbjct: 108 RTGLLVSIFNVGCAIGSVFLGRLGDSIGRRKGIVVGASIYIVGIVIQIASIDKWFQYFIG 167

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGS- 402
           R + G GSG++  L   +++  S K+     +S   ++ + G+ +G      + +++G+ 
Sbjct: 168 RIIGGLGSGAIAVLSPMLISEVSPKHLRGTLVSCYQLMVTFGIFLG------YCTNYGTK 221

Query: 403 GWKNA--FLIPVPFCLVNASIMLADIYSVKDNLHH 435
            + N+  + +P+  C   A +M+  ++ V ++  +
Sbjct: 222 NYNNSVQWRVPLGLCFAWALVMIGAMFLVPESPRY 256

>TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa]
           {ON} 
          Length = 575

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+V+++ +  AIG                  MA   F+ G  +  +S+  W  +   
Sbjct: 119 RTGLLVAIFNVGCAIGSVTLGRVGDVYGRRLGLIMATVIFVAGVVIQIASTDKWYQYFIG 178

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R +AG G G +  L   +++  S K+     +S   ++ + G+ +G
Sbjct: 179 RIIAGIGMGVIAVLSPMLISEVSPKHLRGAMVSCFQLMITFGIFLG 224

>TDEL0H01060 Chr8 complement(188716..192357) [3642 bp, 1213 aa] {ON}
           Anc_1.224 YJL129C
          Length = 1213

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 57/138 (41%), Gaps = 24/138 (17%)

Query: 70  ERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDHHKFLSQDESG 129
           E RED+G   L I     RP   R++     QA         ED    DHH  L++++S 
Sbjct: 295 EAREDEGPA-LVIGAPTDRPVA-RNEEAKQKQA--------PEDGTKDDHHSILTENQSK 344

Query: 130 TKSPLQNSMIDFSDRSISPLQSITS----------DHTQMSERELPGSSTNSLEGNGDIH 179
             S L NS ID       P+Q + S          + T+M  ++      N      D+ 
Sbjct: 345 HTSAL-NSSIDPHHTQTPPVQKVQSSPIASLKTIDEETKMGRKDYDEPEANKPTIQFDV- 402

Query: 180 VAQSESERPTSKTLATAT 197
              ++ +RP+SK +  +T
Sbjct: 403 --SAQPKRPSSKIVKDST 418

>Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W
           (REAL)
          Length = 289

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 60/150 (40%), Gaps = 6/150 (4%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIV ++ +  A+G                       +I+G  +  +S   W  +   
Sbjct: 98  RTGLIVGIFNIGCAVGGLTLGRLGDICGRRIGLMCVILVYIVGIIIQIASIDKWYQYFIG 157

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R V+G G G +  L  T+++  S K+     +S   ++ +LG+ +G     G    S+  
Sbjct: 158 RIVSGMGVGGVAVLSPTLISEISPKHLRGTCISFYQLMITLGIFLGYCTNYGTKKYSNSI 217

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
            W+    +P+  C   A  M+  +  V ++
Sbjct: 218 QWR----VPLGLCFAWAIFMVVGMVMVPES 243

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/154 (18%), Positives = 66/154 (42%), Gaps = 7/154 (4%)

Query: 247 RRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXXX 305
           ++ I    +C     I+M SSI    V +I   +  +  ++++ +++Y+L  A+      
Sbjct: 197 KKVILCVVLCLDCIGISMGSSIFGSAVLQICEIYDVIQVVAILGITLYVLGFAVSPVIYA 256

Query: 306 XXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAG-FGSGSLIALKSTIMNR 364
                        ++ F+F +  +   ++ +  T +  RF +G  GS  +  + +   + 
Sbjct: 257 PLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMICRFFSGVIGSAPMAVVPAAFADM 316

Query: 365 FSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDS 398
           F      +     ++ +FSL V +GP +  +F S
Sbjct: 317 FDTNLRGK-----AICLFSLFVFVGPILSPVFGS 345

>Suva_13.492 Chr13 complement(852013..854571) [2559 bp, 852 aa] {ON}
           YMR302C (REAL)
          Length = 852

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 63/159 (39%), Gaps = 18/159 (11%)

Query: 52  NDKSEENKENTPLLLTSSERREDDGS-KPLDIDTFDTRPFQERSKSGN-PVQAEGDDMEG 109
           ND    +K+   ++L   E ++ D S +PL     D + F  R KSG  P +A    +E 
Sbjct: 629 NDDLNSDKKKAEVILNEKELQDIDASLEPLGGRMLDLQAFVRRVKSGEEPTEALDKMIEQ 688

Query: 110 KSEDKADQDHHKFLSQDESGTKSPLQNSMID-FSDRSISPLQSITSDHTQMSERELPGSS 168
            SE    Q    FLS    GTKS     +I+  S   + P   + +       +  P + 
Sbjct: 689 ASE----QITQMFLSDKIDGTKSAQAWELIELLSSHPVLPFHEVVN---MPLFKAAPETG 741

Query: 169 TNSLEGNGDIHVAQSESERPTSKTLATATSAPAVPVSRA 207
              LE NG I V++                 PA P+ RA
Sbjct: 742 IMELENNGLITVSRDRG--------VLQEIRPAKPLYRA 772

>TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+VS++ +  AIG                  MA   F++G  +  +S   W  +   
Sbjct: 117 RTGLLVSIFNIGCAIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIG 176

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R +AG G G +  L   +++  S K      +S   ++ +LG+ +G
Sbjct: 177 RIIAGVGMGVIAILSPMLISEVSPKEVRGGMVSCFQMMITLGIFLG 222

>ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]
           {ON} similar to uniprot|P43581 Saccharomyces cerevisiae
           YFL011W HXT10 Putative hexose transporter expressed at
           low levels and expression is repressed by glucose
          Length = 616

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 70/152 (46%), Gaps = 10/152 (6%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R+ LIVSV+ +  AIG                   +   +++G  +  +S + W  + F 
Sbjct: 168 RMGLIVSVFNVGCAIGGFTLGRLGDIYGRREGLMCSVLVYVVGIVVQIASINTWYQYFFG 227

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSG 403
           R ++G G GSL  L  T+++  S K      +S   ++ +LG+ +G      + + +G+ 
Sbjct: 228 RILSGLGVGSLSVLSPTLISEISPKQLRGTCVSFYQLMITLGIFLG------YCTDYGTK 281

Query: 404 -WKNA--FLIPVPFCLVNASIMLADIYSVKDN 432
            + N+  + +P+  C + A  ML  +  V ++
Sbjct: 282 FYANSVQWRVPLGLCFLWAIFMLVGLMVVPES 313

>ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON}
           similar to uniprot|O43081 Schizosaccharomyces pombe
           SPBC947 SPBC947.06c protein and weakly similar to
           YHR048W uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 508

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 324 FILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFS 383
           F LGS    SS  F + +  RF AGF  GS +     +++ F        ++    +   
Sbjct: 143 FTLGSA---SSKDFASLLATRFFAGFFGGSPVVSSGGVLSDFWSIRVRSIAMVFYAMFVV 199

Query: 384 LGVAIGPFVVGLFDSSHGSGWKNAFLIPVPF-CLVNASIMLADIYSVKDNLHHEGSTFTL 442
            G  +GP +  L     G    + +  P+ F C+V   IM+  +++V ++  H G     
Sbjct: 200 CGTTVGPVICSLLTFQVGG--SDEWRWPLWFSCIVQGFIMVVAVFTVSES--HSGVLLA- 254

Query: 443 WKRVKKI 449
             R KKI
Sbjct: 255 -YRAKKI 260

>Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W
           (REAL)
          Length = 265

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 60/150 (40%), Gaps = 6/150 (4%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIV ++ +  A+G                       +I+G  +  +S   W  +   
Sbjct: 98  RTGLIVGIFNIGCAVGGLTLGRLGDICGRRIGLMCVILVYIVGIIIQIASIDKWYQYFIG 157

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R V+G G G +  L  T+++  S K+     +S   ++ +LG+ +G     G    S+  
Sbjct: 158 RIVSGMGVGGVAVLSPTLISEISPKHLRGTCISFYQLMITLGIFLGYCTNYGTKKYSNSI 217

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
            W+    +P+  C   A  M+  +  V ++
Sbjct: 218 QWR----VPLGLCFAWAIFMVVGMVMVPES 243

>Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345C
           (REAL)
          Length = 541

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 6/150 (4%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIV ++ +  AIG                       +I+G  +  +SS  W  +   
Sbjct: 105 RTGLIVGIFNIGCAIGGLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIG 164

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R V+G G G +  L  T+++  + K+     +S   ++ +LG+ +G     G  D S+  
Sbjct: 165 RIVSGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSV 224

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
            W+    +P+      A  M+A +  V ++
Sbjct: 225 QWR----VPLGLNFAFAIFMIAGMLMVPES 250

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/153 (18%), Positives = 65/153 (42%), Gaps = 6/153 (3%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R+ L+VS++ +  AIG                  +    +I+G  +  ++ + W  +   
Sbjct: 108 RIGLVVSIFNIGCAIGGIILSKAGDMYGRKKGLIIVVSIYIVGIVIQIATINKWYQYFIG 167

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R ++G G G +  L   +++  S K+     +S   ++ +LG+ +G     G    S+ +
Sbjct: 168 RIISGLGVGGISVLSPMLISEVSPKHLRGTLVSCFQLMITLGIFLGYCTNYGTKKYSNST 227

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH 435
            W+    +P+  C   A  M+  +  V ++  +
Sbjct: 228 QWR----VPLGLCFAWALFMIGGMTFVPESPRY 256

>TDEL0B01990 Chr2 (353614..354573) [960 bp, 319 aa] {ON} Anc_8.437
           YLR220W
          Length = 319

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 662 IGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKF 721
           I GTI + LGGY+  ++ +   H EV +  ++ Y   D + +I H  E  D + E  P F
Sbjct: 137 ISGTISMGLGGYLGARSESDYYHAEVKQEKRKFY---DNMTVINHEIE--DILLEINPNF 191

Query: 722 IFKTLI 727
             +T++
Sbjct: 192 SDETIV 197

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIVS++ +  AIG                  +    +++G  +S +S   W  +   
Sbjct: 103 RTGLIVSIFCIGCAIGGIVFSKLGDQYGRRIALVIVTIVYMVGILISIASIDKWYQYFIG 162

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R +AG G G +      +++  S K+     +S   ++ +LG+ IG
Sbjct: 163 RIIAGLGVGGIAVYSPLLISEVSPKHLRGTLVSCYQLMITLGIFIG 208

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/106 (19%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R+ L+VS++ +  A+G                  +A   F++G  +  +S   W  +   
Sbjct: 114 RMGLLVSIFNIGCAVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIG 173

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R +AG G G +  L   +++  + K      +S   ++ + G+ +G
Sbjct: 174 RIIAGIGMGLIAVLSPMLISEVAPKELRGAMVSCYQLMITFGIFLG 219

>SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]
           {ON} similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 602

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 71/155 (45%), Gaps = 8/155 (5%)

Query: 247 RRRIF-SSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXX 304
           ++++F  + +C     I M SSI    + +I++ +H    ++++ +++++L  A      
Sbjct: 158 KKKVFLCTILCLNCIGITMGSSIFSSAILQISAIYHVHQVVAILGITLFVLGFAASPVIY 217

Query: 305 XXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMN 363
                         ++ F F L  +   ++    T +  RF  GF G+  L  + +   +
Sbjct: 218 APLSELYGRQGVLVISSFGFALFQFAVATAKDLQTIMICRFFGGFIGAAPLAVVPAAFSD 277

Query: 364 RFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDS 398
            F   N+SR     +V +F+LGV +GP +  +F S
Sbjct: 278 MFD--NKSR---GTAVALFALGVFVGPILSPVFGS 307

>CAGL0C01771g Chr3 (187030..188487) [1458 bp, 485 aa] {ON} similar
           to uniprot|P38142 Saccharomyces cerevisiae YBR241c or
           uniprot|P53142 Saccharomyces cerevisiae YGL104c
          Length = 485

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 2/97 (2%)

Query: 322 FSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVII 381
           F + +GS +   ++ +WT IF R + G  SG  I +    +N  +         + + + 
Sbjct: 122 FVYFIGSLMLTMANGYWTMIFGRLLVGMASGISIVVIPVYINEITPAEYKGAMGTMNQLS 181

Query: 382 FSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVN 418
            ++G+     +  +F +S+   W+   LI     LVN
Sbjct: 182 INIGILFTQTIALVFTNSY--YWRWILLIGTAIALVN 216

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 319 MAQFSFILGSYLSWSSSHFWTFIFARFVAGFGS--GSLIA 356
           ++   F++G+ +  ++  FW  +  RF+ GFG   GSLIA
Sbjct: 194 LSNLMFLIGAIIQVTAHTFWQMVVGRFIMGFGVGIGSLIA 233

>KLTH0E10164g Chr5 complement(919912..920781) [870 bp, 289 aa] {ON}
           similar to uniprot|P47818 Saccharomyces cerevisiae
           YLR220W CCC1 Functions in the homeostasis of both
           calcium and manganese ions Possible transmembrane Ca2
           transporter
          Length = 289

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 662 IGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKF 721
           I G I + LGGY+  K+ +   H EV K  ++ Y   + + +I H  E  D + E  P+F
Sbjct: 106 ISGAISMGLGGYLGAKSESDYFHAEVKKEKRKFY---NNMNLINHEIE--DILLEINPEF 160

Query: 722 IFKTLI 727
             +T+I
Sbjct: 161 SDETII 166

>KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011W HXT2 High-affinity glucose
           transporter of the major facilitator superfamily
           expression is induced by low levels of glucose and
           repressed by high levels of glucose
          Length = 570

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/155 (18%), Positives = 69/155 (44%), Gaps = 10/155 (6%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIV+++ +  A+G                       +++G  +  S+S  W  +   
Sbjct: 117 RTGLIVAIFNIGCAVGGLTLGRLGDMQGRRLGLMAVILVYVVGIVIQISASGKWYQYFIG 176

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGS- 402
           R V+G G G +  L  T+++  + K+     +S   ++ +LG+ +G      + +++G+ 
Sbjct: 177 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLG------YCTNYGTK 230

Query: 403 GWKNA--FLIPVPFCLVNASIMLADIYSVKDNLHH 435
            + N+  + +P+  C + A  M+  +  V ++  +
Sbjct: 231 TYTNSVQWRLPLGLCFLWAIFMIGGMVFVPESPRY 265

>TBLA0A03510 Chr1 complement(865967..867679) [1713 bp, 570 aa] {ON}
           Anc_5.396 YHR096C
          Length = 570

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/153 (19%), Positives = 60/153 (39%), Gaps = 6/153 (3%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R+ LIVS++ +  AIG                       +I+G  +  +S   W  +   
Sbjct: 113 RMGLIVSIFNIGCAIGGIVLSKVGDVYGRKMGLTTVVLIYIVGIVIQIASIDKWYQYFIG 172

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R ++G G G +      +++  S K      +S   ++ +LG+ +G     G  +    +
Sbjct: 173 RIISGLGVGGIAVFSPMLISEVSPKAMRGAMVSCYQLMITLGIFLGYCTNYGTKNYDDST 232

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH 435
            W+    +P+  C   A  ML  +  V ++  +
Sbjct: 233 QWR----VPLGLCFAWALFMLGGMTLVPESPRY 261

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 63/150 (42%), Gaps = 6/150 (4%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIV ++ +  AIG                       +I+G  +  +SS+ W  +   
Sbjct: 105 RTGLIVGIFNIGCAIGGLTLGRLGDIYGRRIGLMCVVLVYIVGIVIQIASSNKWYQYFIG 164

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R ++G G G +  L  T+++  + K+     +S   ++ +LG+ +G     G  D ++  
Sbjct: 165 RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYTNSV 224

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
            W+    +P+      A  M+A +  V ++
Sbjct: 225 QWR----VPLGLGFAFAIFMIAGMLMVPES 250

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 10/180 (5%)

Query: 260 FFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCM 319
           F +A+D +I+  ++++IA EF E  +   I + +LL+N   Q                 +
Sbjct: 51  FLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKGAAL 110

Query: 320 -AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSAS 378
            AQF F LG  +S  + +   F   R V G G G + A+ S +++      E       +
Sbjct: 111 VAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAKERGMYQGYA 170

Query: 379 VIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVP---FCLV----NASIMLADIYSVKD 431
            I+F  G                 GW+  F I VP    C+V    N +I LA +   K+
Sbjct: 171 NIVF--GSGQLLGAPLGGLLITTLGWRAIFAIQVPVTLLCMVLAFRNVNIKLAHLPPPKE 228

>CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011w HXT2 high-affinity hexose transporter or
           uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10 or
           uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 63/151 (41%), Gaps = 8/151 (5%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIV+++ +  AIG                       +++G  +  SS+  W  +   
Sbjct: 111 RTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVG 170

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSG 403
           R V+G G G +  L  T+++  + K+     +S   ++ +LG+ +G +       +H + 
Sbjct: 171 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLG-YCTNYGTKTHTNS 229

Query: 404 --WKNAFLIPVPFCLVNASIMLADIYSVKDN 432
             W+    +P+  C   A  ML  +  V ++
Sbjct: 230 IQWR----VPLGLCFAWALFMLVGMSMVPES 256

>CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 high-affinity hexose transporter
           or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
           or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 63/151 (41%), Gaps = 8/151 (5%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIV+++ +  AIG                       +++G  +  SS+  W  +   
Sbjct: 111 RTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISSTTTWYQYFVG 170

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSG 403
           R V+G G G +  L  T+++  + K+     +S   ++ +LG+ +G +       +H + 
Sbjct: 171 RIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLG-YCTNYGTKTHTNS 229

Query: 404 --WKNAFLIPVPFCLVNASIMLADIYSVKDN 432
             W+    +P+  C   A  ML  +  V ++
Sbjct: 230 IQWR----VPLGLCFAWALFMLVGMSMVPES 256

>ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 589

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIVS++ +  A G                  +A   +++G+ +S +S   W  ++  
Sbjct: 134 RTGLIVSLFNIGCAFGGLILTKPADVYGRKLAVTIAAVFYVVGTVISIASIDKWYQYMIG 193

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R ++G G GSL  L   +++  + K      +S   ++ + G+ +G
Sbjct: 194 RIISGLGVGSLAVLSPMLISEVAPKQLRGTLVSIYQLMVTAGIFLG 239

>NCAS0F03110 Chr6 complement(622619..624325) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 342 FARFVAGFGSGSLIAL--KSTIMNRFSQKNE------SRYSLSASVIIFSLGVAIGPFVV 393
           F  FV G+ +G++     ++  + RF QK+       S+  +   V IF++G AIG  V+
Sbjct: 72  FGGFVFGWDTGTISGFVAQTDFLRRFGQKHHNGTPYLSKVRMGLIVSIFNIGCAIGGIVL 131

Query: 394 GLFDSSHG 401
                +HG
Sbjct: 132 ARLGDTHG 139

>TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {ON}
           Anc_4.30 YLL028W
          Length = 582

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 262 IAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCMA 320
           IAM SSI    V +I + +H +  ++++ VS+++L  A                    ++
Sbjct: 155 IAMASSIFASGVEQICAIYHVIPVVAILGVSLFVLGFAASPIVYAPLSELYGRRGVLVIS 214

Query: 321 QFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMNRFSQKNESRYSLSASV 379
            F F L  +   ++    T +  RF AG  G+  +  + +   + F      +     S+
Sbjct: 215 AFGFTLFHFAIATAKDLQTIMICRFFAGLIGAAPMAVVPAAFADMFDTNTRGK-----SI 269

Query: 380 IIFSLGVAIGPF---VVGLFDSSHGSGWK 405
            +F+LGV +GP    V+G +   H + W+
Sbjct: 270 CLFALGVFVGPILAPVIGSYIVQH-TTWR 297

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+ S++ +  +IG                  +A   FI+G+ +  +S   W  ++  
Sbjct: 108 RTGLLTSMFNVGCSIGSFFLGRLGDMYGRRIGLIIATTIFIVGTIIQVASVKAWYQYMIG 167

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R VAG G G +  L   +++  S K+     +S   ++ ++G+ +G
Sbjct: 168 RIVAGVGCGVIAMLSPMLISEVSPKHLRGAMVSCYQLMVTMGIFLG 213

>TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.30
           YLL028W
          Length = 671

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/139 (18%), Positives = 61/139 (43%), Gaps = 7/139 (5%)

Query: 262 IAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCMA 320
           +++ SSI    + ++  ++H +  ++++ V++Y+L  A                    ++
Sbjct: 244 VSVGSSIFSSGMPQLEEKYHIIEVVAILGVTLYVLGFAFSPVIYAPLSELYGRRGVIVIS 303

Query: 321 QFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMNRFSQKNESRYSLSASV 379
            F F L  +   ++ +  T +  RF AGF G+     + +   + F      +     ++
Sbjct: 304 AFGFSLFQFAVATAENIQTIMICRFFAGFLGAAPFPVVPAAFADMFDTNLRGK-----AI 358

Query: 380 IIFSLGVAIGPFVVGLFDS 398
            +FS+GV +GP +  +  S
Sbjct: 359 CLFSMGVFLGPVIAPVMGS 377

>KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.30
           YLL028W
          Length = 592

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 58/139 (41%), Gaps = 12/139 (8%)

Query: 254 CMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXXXXXXXXXX 312
           C+C     I M SSI    V +I  ++H +  ++++ +++++L  A              
Sbjct: 162 CLC-----ITMASSIFASAVPQICEKYHVIQVVAILGITLFVLGFAASPIIYAPLSEIYG 216

Query: 313 XXXXXCMAQFSFILGSYLSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMNRFSQKNES 371
                 +A F F L  +   ++ +  T    RF  G  G+  +  + +   + F      
Sbjct: 217 RKGVLVIAAFGFALFQFAVATAENLQTIFICRFFGGLIGAAPMAVVPAAFADMFDTNMRG 276

Query: 372 RYSLSASVIIFSLGVAIGP 390
           +     ++ +FSLGV +GP
Sbjct: 277 K-----AICLFSLGVFVGP 290

>KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.30
           YLL028W
          Length = 567

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 55/304 (18%), Positives = 110/304 (36%), Gaps = 53/304 (17%)

Query: 91  QERSKSGNPVQAEGDDMEGKSEDKADQDHHKFLSQDESGTKSPLQNSMIDFSDRSISPLQ 150
           +ER+     + +E  D  G   D  +  H   + Q  +   S +++++      +   L 
Sbjct: 15  KERANDSISISSEPQDFRG---DNLEAQHADLMLQKTATISSAIESNV-----SATRQLS 66

Query: 151 SITSDHTQMSERELPGSSTNSLEGNGDIHVAQSESERPTSKTLATATSAPAVPVSRAEIS 210
            I +    + ER +    +N+L   GD         RP           P++P   A   
Sbjct: 67  RIATGTINVPER-IGVDYSNTLPMGGD---------RPYP---------PSLPDKDA--- 104

Query: 211 PYGYGSISQTIEDVEDETDPSYIASTSSDAFVHQETRRRIFSSCMCTYLFFIAMDSSILL 270
                    T +  +D   P          F    T++ I    +C     I+M SSI  
Sbjct: 105 ------FEVTFDGPDDPLHP----------FNWTLTKKTIICLILCLDCICISMASSIFA 148

Query: 271 VIVSKIASEFHELWRLSLI-VSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSY 329
             V++I   +H +  ++++ V++Y+   A                    ++   F +  +
Sbjct: 149 SGVTQICEIYHVIQVVAILGVTLYVFGFAASPIIYAPLSEIYGRRGVLVLSSLGFCIFQF 208

Query: 330 LSWSSSHFWTFIFARFVAGF-GSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAI 388
              ++ +  T +  RF  G  G+  +  + +   + F      +     +V +FSLGV +
Sbjct: 209 AVATAENLQTIMICRFFGGLIGAAPMAVVPAAFADMFDTNMRGK-----AVCLFSLGVFV 263

Query: 389 GPFV 392
           GP +
Sbjct: 264 GPII 267

>KLLA0E09175g Chr5 complement(817829..819739) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q07528 Saccharomyces cerevisiae
           YDL113C ATG20 Protein required for transport of
           aminopeptidase I (Lap4p) through the
           cytoplasm-to-vacuole targeting pathway binds
           phosphatidylinositol-3-phosphate involved in
           localization of membranes to the preautophagosome
           potential Cdc28p substrate
          Length = 636

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 19/102 (18%)

Query: 43  ENPNPIAIENDKS-EENKENTPLLLTSSE-RREDDGSKPLDIDTFDTRPFQERS------ 94
           EN +P  ++N+K+ EE+KE+ P L T SE RRE +GS P D    +    Q         
Sbjct: 16  ENNSPSRLKNNKTVEEHKEHEPDLQTQSEMRRESNGS-PKDTAVTNQNGDQPHENVIHTQ 74

Query: 95  --KSGNPV------QAEGDDMEGKSEDKADQDHHKFLSQDES 128
             K  NP         +G D  GK++D  D ++ K    D++
Sbjct: 75  IIKKDNPFFNYMQDNVDGSDENGKNDD--DDENAKNAGSDDN 114

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+ S++ +  AIG                  +A   FI+G+ +  +S   W  ++  
Sbjct: 113 RTGLLTSMFNIGQAIGCFFLGRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIG 172

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIG 389
           R VAG G G +      +++  S K+     +S   ++ ++G+ +G
Sbjct: 173 RIVAGLGCGIIAISSPMLISEVSPKHLRGAMVSCYQLMITMGIFLG 218

>TDEL0A04250 Chr1 (756579..758300) [1722 bp, 573 aa] {ON}  YBR298C
          Length = 573

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 30/155 (19%), Positives = 70/155 (45%), Gaps = 10/155 (6%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R+ LIVS++ +  A+G                  +    +++G  +  SS+  W  +   
Sbjct: 116 RIGLIVSIFNIGCALGGLTLSHLGDIYGRRIGLMVVVLVYVVGIIIQISSTDLWYQYFIG 175

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSG 403
           R V+G G G++  L   +++  S K+     +S   ++ +LG+ +G      + +++G+ 
Sbjct: 176 RIVSGLGVGAIAVLSPALISEISPKHLRGTCVSFYQLMITLGIFLG------YCTNYGTK 229

Query: 404 -WKNA--FLIPVPFCLVNASIMLADIYSVKDNLHH 435
            + N+  + +P+  C   A  M+  +  V ++  +
Sbjct: 230 RYTNSIQWRLPLGLCFACAIFMIVGMLLVPESPRY 264

>CAGL0A02321g Chr1 complement(252192..253862) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3 or uniprot|P42833 Saccharomyces
           cerevisiae YNL318c HXT14
          Length = 556

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 29/153 (18%), Positives = 62/153 (40%), Gaps = 6/153 (3%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+V ++ +  AIG                       +I+G  +  ++   W  +   
Sbjct: 100 RTGLVVGIFNIGCAIGGVVLSKIGDTKGRKAGLVTVVLIYIVGIVIQIATIDKWYQYFIG 159

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R ++G G G +  L  T+++  + K      +S   I+ +LG+ +G     G  + S+  
Sbjct: 160 RIISGLGVGGISVLSPTLISEVAPKELRGSLVSLYQIMITLGIFLGYCTNYGTKNYSNSV 219

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH 435
            W+    +P+  C   A +M+  +  V ++  +
Sbjct: 220 QWR----VPLGLCFAWALLMIGGMTFVPESPRY 248

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 324 FILGSYLSWSSSHFWTFIFARFVAGFGSG 352
           F++G+ L  S+S+FW     R + GFG G
Sbjct: 160 FLIGAILQISASNFWQMTVGRLIMGFGVG 188

>SAKL0A06050g Chr1 (548837..550408) [1572 bp, 523 aa] {ON} similar
           to uniprot|P38142 Saccharomyces cerevisiae YBR241C
           Hypothetical ORF
          Length = 523

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 325 ILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFS 366
           ILGS L + S+ + + +F RF AG   GS I +   ++N  S
Sbjct: 124 ILGSLLLFRSNSYGSLLFGRFTAGVSCGSSIVITPLLINEIS 165

>SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} similar
           to uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 533

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 332 WSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPF 391
           WS +    F F RF+AGF   S +++   +++    + E    ++       LG A+GP 
Sbjct: 175 WSPTIVGMF-FGRFLAGFFGSSFLSVAGGVISDIFTRQEIGIPMTVYTTSPFLGPALGPV 233

Query: 392 VVGLFDSSHGSGWKNAF---LIPVPFCLVNASIMLADIY 427
           V G   + +G  +K  F   LI    CLV  +  + + Y
Sbjct: 234 VSG---ALYGVSYKWTFIALLIASGVCLVLIAFTVPETY 269

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/150 (20%), Positives = 63/150 (42%), Gaps = 6/150 (4%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  LIVS++ +  A+G                       +I+G  +  +S+  W  +   
Sbjct: 105 RTGLIVSIFNIGCAVGGLTLGRLGDIYGRKIGLMCVILVYIVGIVIQIASTDKWYQYFIG 164

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R ++G G G +  L  T+++  + K+     +S   ++ +LG+ +G     G  D S+  
Sbjct: 165 RIISGMGVGGIAVLSPTLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSI 224

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDN 432
            W+    +P+      A  M+A +  V ++
Sbjct: 225 QWR----VPLGMNFAFAIFMIAGMLMVPES 250

>Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {ON}
           YDR497C (REAL)
          Length = 579

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 18/33 (54%)

Query: 320 AQFSFILGSYLSWSSSHFWTFIFARFVAGFGSG 352
           + F F++G+ L  S+  FW     R + GFG G
Sbjct: 158 SNFMFVIGAILQVSAHTFWQMAVGRLIMGFGVG 190

>KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 29/153 (18%), Positives = 63/153 (41%), Gaps = 6/153 (3%)

Query: 285 RLSLIVSVYLLSNAIGQXXXXXXXXXXXXXXXXCMAQFSFILGSYLSWSSSHFW-TFIFA 343
           R  L+VS++ +  AIG                  +    +I G  +  ++ + W  +   
Sbjct: 108 RTGLVVSIFNIGCAIGGIILSKAGDMYGRKKGLLIVLVIYIAGIVIQIATINKWYQYFIG 167

Query: 344 RFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGS 402
           R ++G G G +  L   +++  S K+     +S   ++ +LG+ +G     G    S+ +
Sbjct: 168 RIISGLGVGGISVLSPMLISEVSPKHLRGTLVSCFQLMITLGIFLGYCTNYGTKKYSNST 227

Query: 403 GWKNAFLIPVPFCLVNASIMLADIYSVKDNLHH 435
            W+    +P+  C   A  M+  +  V ++  +
Sbjct: 228 QWR----VPLGLCFAWALFMIGGMTFVPESPRY 256

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,954,087
Number of extensions: 3126302
Number of successful extensions: 17893
Number of sequences better than 10.0: 654
Number of HSP's gapped: 18699
Number of HSP's successfully gapped: 732
Length of query: 759
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 642
Effective length of database: 40,065,477
Effective search space: 25722036234
Effective search space used: 25722036234
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)