Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3788.270ON65265232880.0
Suva_2.2778.270ON64964325270.0
Smik_4.3628.270ON64864924860.0
YDR118W (APC4)8.270ON65265024490.0
TDEL0F039708.270ON6195049161e-114
ZYRO0C01474g8.270ON5994468811e-109
KAFR0B054608.270ON6105308591e-106
Kpol_392.18.270ON4244177852e-97
KNAG0H031908.270ON6224256731e-78
TPHA0J007908.270ON6855476533e-75
NDAI0J012708.270ON7356176048e-68
NCAS0B037908.270ON6125745916e-67
CAGL0B01859g8.270ON6224265793e-65
TBLA0C045708.270ON6084035223e-57
KLTH0G13508g8.270ON6454154558e-48
SAKL0H16852g8.270ON6444314489e-47
Kwal_56.237668.270ON7404464351e-44
AGR078C8.270ON7154361637e-11
Ecym_43008.270ON7153621361e-07
KLLA0F19316g8.270ON6711961010.001
Kpol_513.125.49ON1532108820.35
NDAI0C035405.49ON155866820.37
CAGL0M13409g5.49ON152779800.56
YML055W (SPC2)4.307ON17891731.8
KLLA0C11407g2.208ON78535734.0
KLTH0A07260gna 1ON73364707.0
ZYRO0F02530g8.15ON105460708.9
ZYRO0B13002g4.276ON1130233699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.378
         (652 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...  1271   0.0  
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   978   0.0  
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   962   0.0  
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   947   0.0  
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   357   e-114
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   343   e-109
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   335   e-106
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   306   2e-97
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   263   1e-78
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   256   3e-75
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   237   8e-68
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   232   6e-67
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   227   3e-65
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   205   3e-57
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   179   8e-48
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   177   9e-47
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   172   1e-44
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    67   7e-11
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    57   1e-07
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    44   0.001
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    36   0.35 
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    36   0.37 
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    35   0.56 
YML055W Chr13 (164790..165326) [537 bp, 178 aa] {ON}  SPC2Subuni...    33   1.8  
KLLA0C11407g Chr3 complement(980649..983006) [2358 bp, 785 aa] {...    33   4.0  
KLTH0A07260g Chr1 (602127..604328) [2202 bp, 733 aa] {ON} weakly...    32   7.0  
ZYRO0F02530g Chr6 (199554..202718) [3165 bp, 1054 aa] {ON} simil...    32   8.9  
ZYRO0B13002g Chr2 (1048390..1051782) [3393 bp, 1130 aa] {ON} hig...    31   9.9  

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score = 1271 bits (3288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/652 (96%), Positives = 626/652 (96%)

Query: 1   MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK 60
           MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK
Sbjct: 1   MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK 60

Query: 61  FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL 120
           FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL
Sbjct: 61  FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL 120

Query: 121 PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY 180
           PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY
Sbjct: 121 PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY 180

Query: 181 TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIK 240
           TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIK
Sbjct: 181 TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIK 240

Query: 241 ELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLC 300
           ELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLC
Sbjct: 241 ELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLC 300

Query: 301 NSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNT 360
           NSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNT
Sbjct: 301 NSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNT 360

Query: 361 SDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFE 420
           SDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFE
Sbjct: 361 SDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFE 420

Query: 421 DDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQL 480
           DDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQL
Sbjct: 421 DDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQL 480

Query: 481 LINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGT 540
           LINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGT
Sbjct: 481 LINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGT 540

Query: 541 LKXXXXXXXXXXXXXXXPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYTX 600
           LK               PEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYT 
Sbjct: 541 LKDESLDIISRESSIRIPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYTE 600

Query: 601 XXXXXXXXXXSITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPKGRKFG 652
                     SITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPKGRKFG
Sbjct: 601 EENDNGEDDGSITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPKGRKFG 652

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/643 (73%), Positives = 538/643 (83%)

Query: 5   INDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSI 64
           +NDYFIDYNPRFPIFA R+ KGLAIHRVSDHAR+A+IPVRNIALVANY+WD ++GKFLSI
Sbjct: 1   MNDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSI 60

Query: 65  FFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDILPKLI 124
           FFKDGT+RIHDIFKDGRLVSFLR+P TKISRGIWDRIPLK E  +  FA NVID+LPKLI
Sbjct: 61  FFKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLI 120

Query: 125 RFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILL 184
           RFVKDSKRV+I PYTPPN LWRGPDEDDPE+ E LD+HVIFNEGNDKIT+FFNGDY ILL
Sbjct: 121 RFVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILL 180

Query: 185 PMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIG 244
           P+ DIENE+IL+SVVKVQ+GFYHCFYNDG+V T NL+ LL+S+PSVDLL Y+MVIKELIG
Sbjct: 181 PVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIG 240

Query: 245 YLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVG 304
           YLLAH+E INREL TPY+DFVKRICDEAYGY+KLKSEL+CLFLLGEV  DL+DWLCN+VG
Sbjct: 241 YLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVG 300

Query: 305 EKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLT 364
           EKN K+WK LGCEAYQKT Q+ TL FVPTCERIIIFV+KL+G LEAFS+Q       DLT
Sbjct: 301 EKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLT 360

Query: 365 AVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPY 424
           AVELLLK SQELLN TLKSII LG++ETLFEKF +WFNDRIHE LDEDYK KFEFEDDPY
Sbjct: 361 AVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPY 420

Query: 425 FGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQLLINI 484
           FGYDLL +F+K LS R+TESSSVI+MKLYR+LIN+M+ MEKDIAKNNV+ HIQ+Q+L+  
Sbjct: 421 FGYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQS 480

Query: 485 RKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGTLKXX 544
           R DV+SQ YPSS++ LLDAIKL  Q+YIVYLI+VT+  + +E S   NT KLY+GTLK  
Sbjct: 481 RADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDE 540

Query: 545 XXXXXXXXXXXXXPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYTXXXXX 604
                        PE FK+Y  ++ARFA KMVPNFIRE E   S+Y  S N+ +      
Sbjct: 541 SLDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNFGGEEDD 600

Query: 605 XXXXXXSITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPK 647
                 +ITIPTY+TENEK E +IACT+KISVDGR ASLVFPK
Sbjct: 601 DEEDDGTITIPTYITENEKTEGFIACTTKISVDGRGASLVFPK 643

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/649 (70%), Positives = 537/649 (82%), Gaps = 1/649 (0%)

Query: 1   MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK 60
           M PP NDYFIDYNPRFPIFATR  KGLAI+RVSDHAR+A IP+RNI LVANY+WD  +GK
Sbjct: 1   MPPPGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGK 60

Query: 61  FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL 120
           FLSIFFKDGT+RIHDIFKDGRLVSFLR+PSTKIS+G WDRIPL+ E  +   AYN+ID L
Sbjct: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL 120

Query: 121 PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY 180
           PKLIR+VKDSKR++IVPYTPPN LWRGPDED+PE+ E LD+H+IFNEG+DKIT+FFNGDY
Sbjct: 121 PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY 180

Query: 181 TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIK 240
            I +P+   ENER ++S+VK+QDGFYHCFY+DG+VRTLNL PLLRS+PS+++L YIM IK
Sbjct: 181 AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240

Query: 241 ELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLC 300
           ELIGYLL H+E INREL+TPYL+FV R+CDEAYGY+KL SELECLFLLGEVSCDLEDWLC
Sbjct: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC 300

Query: 301 NSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNT 360
           NSVGEKN K+WK LGCEAYQKTTQILTL+FVP CERIIIFVEKLRG LEAFS+QNK N++
Sbjct: 301 NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDS 360

Query: 361 SDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFE 420
           SDLTAV+ LLKNSQELL  TLKSI+ LG++ETLFE FFIW NDRIHE LDEDYKLK +FE
Sbjct: 361 SDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFE 420

Query: 421 DDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQL 480
           DDPYFGYDLLTYF  I S R  E+S V+NMKLYR+LIN+MSDMEK+IA++NV+ HIQQ +
Sbjct: 421 DDPYFGYDLLTYFHNI-SNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHI 479

Query: 481 LINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGT 540
           L+  R DVYS+ YPSSQ+ + DA+KLP  +YI+YLI+VT+  +T+E  S  +  KLY+GT
Sbjct: 480 LVESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGT 539

Query: 541 LKXXXXXXXXXXXXXXXPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYTX 600
           LK               PE F+ YSFS ARF LK VPN IRE+ELS  NY    N EY  
Sbjct: 540 LKDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYKE 599

Query: 601 XXXXXXXXXXSITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPKGR 649
                     +ITIPTY+T NEK+E +IACT+KISVDGRSASLVFPKG+
Sbjct: 600 GDDENGEDDGAITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPKGK 648

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/650 (69%), Positives = 538/650 (82%)

Query: 1   MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK 60
           MS PINDYFIDYNP FPIFATRI KGLAI+RVSDHAR+A+IP+RNI LVANY WD T+GK
Sbjct: 1   MSSPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGK 60

Query: 61  FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL 120
           FLSIFFKDGT+RIHDIFKDGRLVSFLR+PSTKIS+GIWDRIPL+ E ++  FA N+ID L
Sbjct: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDL 120

Query: 121 PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY 180
           PKLIRFVKDSKR++IVPYT PN LWRGPDEDD +S E LDVHV+FNEGNDKIT+FFNGDY
Sbjct: 121 PKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDY 180

Query: 181 TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIK 240
            + L +D+IENE  L+S++KVQDGFY CFY DG+V+TLNL PLL+SK SV+LL+YIMVIK
Sbjct: 181 AVFLSVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIK 240

Query: 241 ELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLC 300
           ELIGY+L H+E INREL TPYLDFVKR+CDEAYGY KLKSELE LFLLGE+SCDLEDWLC
Sbjct: 241 ELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLC 300

Query: 301 NSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNT 360
           NSVGEKN K+WK+LGCEAYQKT QILTL+FVP CERIII+VEKLR  L+AFS+QNK + T
Sbjct: 301 NSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYT 360

Query: 361 SDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFE 420
           SDLTAVE+LLK+SQ+LL  TL SII LGR+ETLFEKFFIWFNDR+HE LDEDYKLKF+FE
Sbjct: 361 SDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFE 420

Query: 421 DDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQL 480
           DD YFGYDLL+YFD+ILS + TE SS+I++KLYR+LIN+MSDMEKDIA++NV+ HIQQ +
Sbjct: 421 DDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHI 480

Query: 481 LINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGT 540
           L++++ DV++Q YPSSQ+ LLDAIKLP  +YIVYLI+VTK  + +E  S EN  KLY+GT
Sbjct: 481 LVDLKTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGT 540

Query: 541 LKXXXXXXXXXXXXXXXPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYTX 600
           LK               P  FK+Y  S+ RF    V + +R++ LS SNY  S  ++Y  
Sbjct: 541 LKDENLGIISKESSVKIPALFKSYRLSSTRFVPNRVHSLLRDIGLSDSNYHSSHVTDYRG 600

Query: 601 XXXXXXXXXXSITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPKGRK 650
                     +I IP Y+ EN +N+ +IACT+K+SVDGRSASLVFPK ++
Sbjct: 601 ENYENEEDDGTIAIPAYIRENRENDDFIACTAKVSVDGRSASLVFPKEKQ 650

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  357 bits (916), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/504 (37%), Positives = 313/504 (62%), Gaps = 15/504 (2%)

Query: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTV 71
           YNP + ++A +  KGL+I RV+D+A+IA + VR++ ++A + WD  +GK +++F+KDG  
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70

Query: 72  RIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDILPKLIRFVKDSK 131
           RI+D F+ G+L++ LR+  T++   IWDRI L R+  +  F + V++ +PK+IRF +D++
Sbjct: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTR 130

Query: 132 RVSIVPYTPPNGLWR-GPDEDD--PESGEILDVHVIFNEGNDKITIFFNGDYTILLPMDD 188
           ++ I+PY PPN  WR   +E+D      EILDVH++  E N  + +  +GD+ + L    
Sbjct: 131 QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNG-LVLMLDGDFILRLAAG- 188

Query: 189 IENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGYLLA 248
             +   L+ +V    G YHCFY D +V +L+L  L++   ++ L+ + + IK+L  YL  
Sbjct: 189 -PSGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQD 247

Query: 249 HVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVGEKNL 308
           H++LI R+L+ PY +F+ +ICD A+GY  L  ELE L L G +S +LE+W C +VGEKN 
Sbjct: 248 HLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCYTVGEKNF 307

Query: 309 KKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLTAVEL 368
           KKWK +G E YQKT QILTL F+P CER+I+  E+ R  L+A  +  +S+ T+D +    
Sbjct: 308 KKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQL-IESSTTTDSSEFAN 366

Query: 369 LLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPYFGYD 428
           L   SQ  L +T+++I  +   E LF+ F  WF+DR+HE LDEDYK K   + +   GY 
Sbjct: 367 LTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIGYQ 426

Query: 429 LLTYFD-KILSYRSTE-SSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQLLINIRK 486
           + TY D +I   + +E  +  + ++ ++E+++ MS   + I    +   + Q++    R 
Sbjct: 427 IATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKITRVNRH 486

Query: 487 DVYSQMYPSSQVRLLDAIK-LPNQ 509
           ++     P+S+ ++L A+  +P+Q
Sbjct: 487 NL-----PNSENQILLAVAPIPSQ 505

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  343 bits (881), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 178/446 (39%), Positives = 275/446 (61%), Gaps = 18/446 (4%)

Query: 9   FIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKD 68
           ++DYNP +P++  + T+G ++HR++D ARIA I VR+++ VA Y WD  +GKFLSIF+KD
Sbjct: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64

Query: 69  GTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPL---KREYDSETFAYNVIDILPKLIR 125
           GTVRI+D F+ GRLVS LR  S     GIWDRI L   +      +  ++V +++PK+++
Sbjct: 65  GTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVK 124

Query: 126 FVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLP 185
           F +DS+++ +VPYT P+ +WR    DD  +  +LD HVI    +D +++ F+G++TI + 
Sbjct: 125 FARDSRQLCVVPYTLPSDVWRPQAADD--TNALLDAHVI--RCHDSLSVMFDGEFTISIQ 180

Query: 186 MDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGY 245
           +  I +   L   V  Q   Y  FY DGSV   +L  L++   S+ LL  ++ +++L  Y
Sbjct: 181 LAAIPSP--LVKFVSAQHQ-YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRY 237

Query: 246 LLAHVELINRELITPYLDFVKRICDEAY-GYNKLKSELECLFLLGEVSCDLEDWLCNSVG 304
           L  H+ELI R+L+ PY +F++R C  A+ GY+ L+ +L  L L+G+V+ +LEDWL NS+G
Sbjct: 238 LQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMG 297

Query: 305 EKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLT 364
           EKNLK+W+ LG +AY KT Q+LTL  +P CER+I   ++  G L +  +  +      + 
Sbjct: 298 EKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQLTLQLPLLPPID 357

Query: 365 AVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPY 424
            ++  LK       N L++I +L   + L   F  WF+DR+ E +DEDYKL+F   D+  
Sbjct: 358 CLQFFLK-------NVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDNSS 410

Query: 425 FGYDLLTYFDKILSYRSTESSSVINM 450
            G D  +Y    L   S E SSV ++
Sbjct: 411 LGPDTASYLQLRLRNSSPEFSSVSDL 436

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  335 bits (859), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 173/530 (32%), Positives = 303/530 (57%), Gaps = 11/530 (2%)

Query: 1   MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK 60
           ++P    Y + YN + P++  +  KGL ++R SD+  IA   ++   LVA   WD+ SGK
Sbjct: 4   LNPKERSYCV-YNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGK 62

Query: 61  FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL 120
           +LSIFF+DG++RI D+FKDG+LV+FLR     +    WDRI  +   + + F  N++D++
Sbjct: 63  YLSIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLM 122

Query: 121 PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY 180
           P LI+FV  + ++S++PYTP N  WR  D    +   ++D+H +     D   +  NGDY
Sbjct: 123 PSLIQFVSSANKLSLIPYTPSNANWRELDAK-WKKNRVIDMHCLHQSETDSFLMVLNGDY 181

Query: 181 --TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMV 238
             T+  P  D+  +    S++K  +  Y C Y DGS R ++    L SK  +DLL  I+ 
Sbjct: 182 YLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILS 241

Query: 239 IKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDW 298
           +K++  Y   H++L+ R +I PYLDF+++ICD A+G  KL +EL+  FLLG +S +L+DW
Sbjct: 242 LKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDW 301

Query: 299 LCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSN 358
           L  SVG+KN+ +W+ L  +AYQ+TT++ T+  +  CER+I+  E+  G + AF  ++ ++
Sbjct: 302 LHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGAD 361

Query: 359 NTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFE 418
           + S L  +  L+ N Q++L + + +         + + F  W NDR+HE LD+DYK +  
Sbjct: 362 DNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLS 421

Query: 419 FEDDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNN---VSQH 475
              +    Y L   F+ +L     +S  ++N  + +   + +  +E +I++ N   +   
Sbjct: 422 ITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIK---HTLEKIEANISRMNTKYIEPI 478

Query: 476 IQQQLLINIRKDVYSQMY-PSSQVRLLDAIKLPNQSYIVYLIEVTKLMNT 524
           ++ ++ I+ +   +   Y P   V + D +K+    Y++Y+++++ +  T
Sbjct: 479 LENKIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLSSVTPT 528

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  306 bits (785), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 166/417 (39%), Positives = 250/417 (59%), Gaps = 16/417 (3%)

Query: 8   YFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFK 67
           Y+  YNP F ++ TR  +GLA++R+ D +++A I +++   VA Y WD  SG+F+S+F  
Sbjct: 10  YYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69

Query: 68  DGTVRIHDIFKDGRLVSFLRVPSTK-ISRGIWDRIPLKREYDSETFAYNVIDILPKLIRF 126
           DGT+RI+DIFK+GRLVS++R  S K +   +WDR         + F  N+I+ LP LI+F
Sbjct: 70  DGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKF 129

Query: 127 VKDSKRVSIVPYTPPNGLWRGPDEDDPESGE------ILDVHVIFNEGNDKITIFFNGDY 180
           VKDS+ ++I+ Y PPN  WR  D++  ++ +      +LDVH+  N   D  TI  NG Y
Sbjct: 130 VKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVY 189

Query: 181 TI-LLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVI 239
            I  + M DI    + + ++K+ +G Y  FY +G  R +N   LL    S  LL  I+ I
Sbjct: 190 EINGIVMPDISKSEVYQ-LLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEI 248

Query: 240 KELIGYLLAHVELINRELITPYLDFVKRICDEAY--GYNKLKSELECLFLLGEVSCDLED 297
           + L  Y+  H++LI RELI PY DFVK+IC +AY  G  KL  ELE L L GE++ + +D
Sbjct: 249 RNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKD 308

Query: 298 WLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKS 357
           WL N +G++N KKW+ LG + ++K  +ILTL  +P+CER +I++E+  G L  +   +  
Sbjct: 309 WLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGYMKTD-- 366

Query: 358 NNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYK 414
              +D   +  L +   +L+ N++  I +L      FE F  W ND+I+E  DEDYK
Sbjct: 367 ---TDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYK 420

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  263 bits (673), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 239/425 (56%), Gaps = 7/425 (1%)

Query: 8   YFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFK 67
           ++ + N   P++ TR TK L ++R +D + IA   +R+ + V +Y WD   G+ +S+ F+
Sbjct: 11  FYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQ 70

Query: 68  DGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVI-DILPKLIRF 126
           DG++RI+D+  D +LV+ LR   T +   +WDRI L     S  +  ++I   LP+L++F
Sbjct: 71  DGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKF 130

Query: 127 VKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLPM 186
           +      S+ PY P N  WR P+     +G ILDVH +  +  D +    NG+Y + L  
Sbjct: 131 MGSDASPSMSPYLPTNHSWRFPNSG--AAGGILDVHFLHQKLGDTLVALLNGEYQLQLTG 188

Query: 187 DDIENERILESVVKVQDG---FYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELI 243
              E++  L  ++   D     Y+C+Y  G VR ++L   +  K ++ LL   ++ ++ +
Sbjct: 189 PHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYL 248

Query: 244 GYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSV 303
           GY LAH+E I  E + PY +F++R+C++A+G  KL+  L   FL+G +  +L DWL  S+
Sbjct: 249 GYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSL 308

Query: 304 GEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRG-TLEAFSVQNKSNNTSD 362
           GE+NL++WK L   AY++T+Q++ +  VP  ER+II  E+L+   L A   +    ++ +
Sbjct: 309 GERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLE 368

Query: 363 LTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDD 422
           ++    LL+N QELL   L+++  L ++    + F +W  + +   +++DY   F   + 
Sbjct: 369 ISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSEC 428

Query: 423 PYFGY 427
             FG+
Sbjct: 429 GKFGF 433

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  256 bits (653), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 163/547 (29%), Positives = 293/547 (53%), Gaps = 34/547 (6%)

Query: 8   YFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFK 67
           Y+   NP + ++  +  KGLAI  +SDH+ +A I +++ +LV ++ WD  +GKFL   F 
Sbjct: 10  YYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69

Query: 68  DGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSE--TFAYNVIDILPKLIR 125
           DG++R++DIFK GRLVSF R P  +I    WDRI +    D +   F Y++ + +P L++
Sbjct: 70  DGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLVK 129

Query: 126 FVKDSKRVSIVPYTPPNGLWRGPDED----------DPESGEILDVHVIFNE-GNDKITI 174
           FVKD + + +VP       WR  D D          +  + ++LD+H+++ E G D   +
Sbjct: 130 FVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAV 189

Query: 175 FFNGDYTILLPMDDIE------NERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKP 228
             NG Y     + DI       N+ I   +VK   G Y  FY + S R +++ P   +  
Sbjct: 190 LVNGVY----DLSDIHVPNRSPNKVI--KLVKASQGKYLGFYENASYRLIDVTPFSSNDI 243

Query: 229 SVDLLHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAY-GYNKLKSELECLFL 287
            V+LL+  + ++  +  L   +E+I +ELI+P+  F+  +C +AY GY+ L   +  L L
Sbjct: 244 RVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLL 303

Query: 288 LGEVSCDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGT 347
            GE+S + EDWL N++GE+NL+KWK LG E   K  QIL+L+F+P  E+ II  E+++  
Sbjct: 304 TGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNY 363

Query: 348 LEAFSVQNKSNNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHE 407
           + A  + + S    + + +  L+ N   +L  ++K I  L  ++  FE F  W  + I+ 
Sbjct: 364 ITAMRLSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNTIYL 423

Query: 408 GLDEDYKLKFEFEDDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNM---SDM- 463
            +DE+YK K        + +D+  Y +  L ++    + +  +  +    N +    DM 
Sbjct: 424 IIDENYKSKLSLSSSNSYPFDIQKYIN--LQFKDHNKAILTVVDEFETYANKILIDLDMI 481

Query: 464 -EKDIAKNNVSQHIQQQLLINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLM 522
            EK I  +  +  I   ++ N  ++  ++++ SS +++LD +++  +S  +++++   L 
Sbjct: 482 DEKLIKPHLKTSIIISDIIDNTLQNS-NKIFESSNLKVLDVLRIEEKSCFLFVVKELPLN 540

Query: 523 NTKEVSS 529
           +  E+++
Sbjct: 541 HNSEIAT 547

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  237 bits (604), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 182/617 (29%), Positives = 293/617 (47%), Gaps = 104/617 (16%)

Query: 13  NPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTVR 72
           NP FP++ T+ +  +   R  D  +I+ I +RN+  V    WD  +GK+L+I F DGT R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 73  IHDIFKDGRLVSFLRVP--------STKISRGIWDRIPLKREYDSETFAYNVIDILPKLI 124
           I+DIF+DG+L++ +R           TK+   IWDR+ +        F +++  ++P LI
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 125 RFVKDSKRVSIVPYT--PPNGLWR--------------------GPDEDDPESGEILDVH 162
           +FVKDS  + IVPY+      +WR                      +++  +S   LD+H
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207

Query: 163 VIFNEGNDKITIFFNGDYTILLPMDDIENE------RILESVVKVQDGFYHCFYNDGSVR 216
           +I     D  TI  NG Y I L    I         RIL+S V    G YHCF+ +GS+R
Sbjct: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVH---GVYHCFHENGSIR 264

Query: 217 TLNLQPLLRSKPSVDLLHYIMVIKELIGYLLAHVELINRELITPYLDFV-KRICDEAY-- 273
           +L       S   V+LL   M I E+I Y   H++LIN+ L+  + DF+   I +E    
Sbjct: 265 SLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG 324

Query: 274 GYNKLKSELECLFLLGEVSCDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPT 333
           G N +  +L+   L GE+S +L +WL  S+GEKNLKKWK L  E Y K+ QI +L  +P 
Sbjct: 325 GGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPA 384

Query: 334 CERIIIFVEKLRGTLEAFSVQNKS----------NNT-------------------SDLT 364
           CE  ++  +K    L A  ++ K+          N+T                   S L 
Sbjct: 385 CELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLE 444

Query: 365 AVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDDPY 424
            +E+L K     L N L+ I  + +  +LF K   W  + I   LDED+  K +   +P 
Sbjct: 445 LIEILQKFGSRCLQN-LRKISYIEKQSSLFLK---WLQEMIFHALDEDHVPKLDTYSNPI 500

Query: 425 FGYDLLTYFDKILSY--------RSTESSSVINMKLYRELINNMSD----------MEKD 466
              DL  + +K++          R  + + ++N     EL  +M +          + + 
Sbjct: 501 ICLDLSNFLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRS 560

Query: 467 IAKNNVSQHIQQQLLI--NIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNT 524
           I +  +   +QQ L +  NI+     +  PS ++ + D +K+ N S ++YL++V K +++
Sbjct: 561 IDEKGIQPTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQV-KSLDS 619

Query: 525 KEVSSGENTPKLYVGTL 541
           +++         YVGT+
Sbjct: 620 RDL--------FYVGTI 628

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  232 bits (591), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 153/574 (26%), Positives = 272/574 (47%), Gaps = 20/574 (3%)

Query: 5   INDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSI 64
           + +  + YNP +P    + + G A+ R  D  +I  I +RN+  V    W+     +L++
Sbjct: 4   LTEELVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTV 63

Query: 65  FFKDGTVRIHDIFKDGRLVSFLRVP---STKISRGIWDRIPLKREYDSETFAYNVIDILP 121
            F DG+ RIHDIF++G+L++ LR+       +  GIW ++ ++++ +   F  ++  ++P
Sbjct: 64  MFNDGSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMP 123

Query: 122 KLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDP-ESGEILDVHVIFNEGNDKITIFFNGDY 180
             I+FV ++ ++ +VPY      WR  D+  P E  +I+D+H+  N   D+  +  NG Y
Sbjct: 124 SPIKFVNNAGQLEVVPYVVTQTQWRNVDK--PLEVNDIIDIHMAHNSNTDEYLLMINGVY 181

Query: 181 TILL-PMDDIEN-ERILESVVKVQD-GFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIM 237
            + + P    EN    L  ++ ++    +HCFY D    T++L  L+ S P V LL+ + 
Sbjct: 182 KLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLT 241

Query: 238 VIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLED 297
            +K+L  Y++ H+++I+ +L  P  DF++           L   L+   L G ++  L  
Sbjct: 242 EMKQLHRYIVDHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNH 299

Query: 298 WLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKS 357
           WLCN VGEKNLKKWK L    YQK  QI++L  +P  E++ +   +    + A ++   S
Sbjct: 300 WLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALP-AS 358

Query: 358 NNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKF 417
            +  +L   + L + +  L N  L         E     F +W  D I E +DEDY  K 
Sbjct: 359 GHMQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKL 418

Query: 418 EFEDDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQ 477
              +D      L+   D+     +T+  S     L + L+ ++SD  ++I  + V   + 
Sbjct: 419 NICEDGSVVPTLMEIIDQFFQ-DTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLL 477

Query: 478 QQLLINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLY 537
           + + I      +++ +    V +LD        ++VYL+E  K  NT++V +       Y
Sbjct: 478 KTMKIRGTARSFTENF-DEDVTILDIFYCAKYPFLVYLVE--KRSNTQDVKASVK----Y 530

Query: 538 VGTLKXXXXXXXXXXXXXXXPEAFKNYSFSNARF 571
           +GT                 P +  + S    +F
Sbjct: 531 IGTANSINLRTISAAKKVNYPLSIDSASIQKVKF 564

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  227 bits (579), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 143/426 (33%), Positives = 233/426 (54%), Gaps = 29/426 (6%)

Query: 7   DYFIDYNPRFPIFA-TRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIF 65
           D F+ YNP++ +F        L I R SD+  I  I VRNI L+ +Y WD   GK+L++F
Sbjct: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67

Query: 66  FKDGTVRIHDIFKDGRLVSFLRVPSTKISRG-------IWDRIPLKREYDSETFAYN--V 116
            KDG+VRI+DIF  G+L+SFLRV    +          +WDRI + +   SE    N  +
Sbjct: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDL 127

Query: 117 IDILPKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFF 176
            + +P L++FV+D+K++ I+P      LWR    ++    +++DVH+ ++  + ++TI  
Sbjct: 128 TESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEK---KVVDVHLGYSCSSAQVTILI 184

Query: 177 NGDYTILLPMDDIE--NERILESVVKVQ--DGFYHCFYNDGSVRTLNLQPLLRSKPSVDL 232
           NG+Y I   + DI    ++I  S+ K +  +  Y   ++D S   ++L  +L +   +DL
Sbjct: 185 NGEYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDL 244

Query: 233 LHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVS 292
           +   + +      +  H  LI + ++ PY +F++ I     G N L   LE LFL+GE+ 
Sbjct: 245 IETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIG----GINDLDV-LERLFLIGELD 299

Query: 293 CDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFS 352
             L +W   ++ EKNLKKW  LG E Y    Q+L +VFVP CER+++   ++ G ++   
Sbjct: 300 TKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGID 359

Query: 353 VQNKSNNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFI-WFNDRIHEGLDE 411
           +Q +S  TS L   EL     Q  LN  LK +  L  +ET F++ F+ W  D+++E ++ 
Sbjct: 360 LQ-ESQETSLLDISEL-----QSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESINN 413

Query: 412 DYKLKF 417
           +YK  F
Sbjct: 414 EYKSVF 419

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  205 bits (522), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 116/403 (28%), Positives = 212/403 (52%), Gaps = 8/403 (1%)

Query: 13  NPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTVR 72
           NP  P+   +   GL + R +D + I    +RN   +  Y W+   G +++IFF+ GTV 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 73  IHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDILPKLIRFVKDSKR 132
           I+D  K  RL++ L      +  GIWDR     + + + F  ++   +P LI+ ++D ++
Sbjct: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132

Query: 133 VSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLPMDDIENE 192
           +    Y PP+  WR   E+  ++ E LD+H++ +  +D  T   NG+  +  P +     
Sbjct: 133 ICPGTYFPPHSTWRAKKEESLKN-EFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTSGR 191

Query: 193 RILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGYLLAHVEL 252
            I   ++K ++  + CFY D +VR ++   LL+ K +  L+ + + I  L+ YL  H+  
Sbjct: 192 AI--GIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249

Query: 253 INRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVGEKNLKKWK 312
           I   + TP+ +F+  +  EA     +   L  + + G +S +LE+W+ N++G KNL +W 
Sbjct: 250 IKDNMSTPFNEFLTSVKGEAT-QEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWA 308

Query: 313 FLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTS---DLTAVELL 369
            LG   Y+K   I+TL+ +P CER +I V +L+G +E   V+N+ +N     + + +E +
Sbjct: 309 TLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLNSSYIENV 368

Query: 370 LKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDED 412
              ++  +   L+ +  L   + LFEKF  WF++ +  G+ +D
Sbjct: 369 KHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVR-GVVQD 410

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  179 bits (455), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 120/415 (28%), Positives = 200/415 (48%), Gaps = 25/415 (6%)

Query: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTV 71
           +NPR  ++     K ++++R  D  RIA + +R    +    W+   GK  ++FF +G V
Sbjct: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80

Query: 72  RIHDIFKDGRL------VSFLRVPSTKISRGIWDRIP---LKREYDSETFAYNVIDILPK 122
           RI+D    G L      V   +     +   +W        ++EY  +     +   LP 
Sbjct: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEY--KGLNIEITKQLPG 138

Query: 123 LIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTI 182
           ++R V+D+K++S+VP       W      DP  G+   + +  +E +    +  +G  ++
Sbjct: 139 MVRLVRDAKQLSVVPLETGKLRWLA----DP--GKDAAIFLGHDEKSGDYLMTVDGLLSV 192

Query: 183 LLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKEL 242
            +P    +  +IL    + +DG +     DG+V+ + L+  L S    +L+ Y   I+ L
Sbjct: 193 RVPSGIKKMHKILR---QGEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRYSGQIRFL 248

Query: 243 IGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNS 302
             YL  ++ +   +LI PY  F+ RI D AY   +L S    + L G +  DLEDWLCNS
Sbjct: 249 CSYLTENINMCKTDLIEPYRQFLTRIAD-AYEGGELASRFRDIILSGYIPEDLEDWLCNS 307

Query: 303 VGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQN---KSNN 359
           +G+KN K+WK L    Y     +L L  +P CER+I+  E+L+G  +   +Q     S  
Sbjct: 308 IGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASPQ 367

Query: 360 TSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYK 414
             +   V  L+   Q LL+ +L+ ++ L R+  L   F  WF D + E +DEDYK
Sbjct: 368 EFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  177 bits (448), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 117/431 (27%), Positives = 210/431 (48%), Gaps = 25/431 (5%)

Query: 10  IDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDG 69
           I +NP   +F     KG+A++R  D  RIA + V++   + +Y W+++ G+  ++   +G
Sbjct: 18  IVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNG 77

Query: 70  TVRIHDIFKDGRLVS--FLRVPSTKISRGIW--DRIPLKREYDSETFAYNVIDILPKLIR 125
            +R++D    G+ V    L      + +  W  D      ++ S  F + +  ++P+L++
Sbjct: 78  IIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKF-SNVFDHEITSLMPRLVK 136

Query: 126 FVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLP 185
           FVKDS++++++P    +G+ R    D  +S   L     ++    KI +  +G + +   
Sbjct: 137 FVKDSRQLTMLPTDVGDGVPRWSKLDGNKSFIFLG----YDSKRQKILMAIDGAFKLSFS 192

Query: 186 MDDI--ENERILES---------VVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLH 234
           +  +    ER+ E          ++K  +G Y    +D  ++ +     L    + +++ 
Sbjct: 193 VAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTREMIS 251

Query: 235 YIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCD 294
               I+ L   L   V L+  EL+ PY  F++R+     G   L  +L  L   G V  +
Sbjct: 252 CCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEG--DLIGDLTELLFTGSVPPE 309

Query: 295 LEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQ 354
           LEDWL N++G+KNL++WK L    Y+   +I+ L  VP CER+I+  E+L G ++   + 
Sbjct: 310 LEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIKGLKLI 369

Query: 355 NKSNNTSDLTAVEL--LLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDED 412
                  +L  +E   L+  SQE L N + SI  +  +  L E F  WF+D + E +DED
Sbjct: 370 GLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDED 429

Query: 413 YKLKFEFEDDP 423
           YK K  +  DP
Sbjct: 430 YKRKTSYNCDP 440

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  172 bits (435), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/446 (28%), Positives = 215/446 (48%), Gaps = 26/446 (5%)

Query: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTV 71
           +NPR  ++     K +A++RV D  +IA + +R+   +    W++   K  ++F  +G V
Sbjct: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80

Query: 72  RIHDIFKDGRLVSFL------RVPSTKISRGIWDRIPLKREYDS-ETFAYNVIDILPKLI 124
           RI+D    G L   +      +    K+   +W  +   +  +S     +++  ++P ++
Sbjct: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140

Query: 125 RFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILL 184
           R V+DSK++S+ P       W      D + G+   + +  +  + +  +  +G  ++  
Sbjct: 141 RLVRDSKQLSLAPLDLGKLSWL-----DGKYGDAA-IFLAHDCESTEYMVAIDGQLSLRF 194

Query: 185 PMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIG 244
           P       +IL    +   G +     DG+++ + L+  L      +L+     I+ L  
Sbjct: 195 PSGIRNVHKILP---QGGSGSFLAVGKDGTLQWVTLK-FLECALMRELVKSSGQIRFLCR 250

Query: 245 YLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVG 304
           YL  +V L + ELI PY  F+ R+   AY  + L + L  + L G +  DLE+WLCNSVG
Sbjct: 251 YLAENVSLCHTELIEPYRVFLTRLMG-AYEGDDLATRLRDILLTGYIPDDLEEWLCNSVG 309

Query: 305 EKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNN-TSDL 363
           +KN K+WK L    Y     +LTL  VP CER+I+  E+++G  ++  +Q    +   +L
Sbjct: 310 DKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGEL 369

Query: 364 TAVEL--LLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFED 421
           T VEL  L+   Q LL  TL  I  L R+  L + F  WF D + E +DEDYK +   + 
Sbjct: 370 TTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDYK-RPSRDG 428

Query: 422 DPYFGYDLLTYFDKILSYRSTESSSV 447
            P   Y L    D+ LSY    S ++
Sbjct: 429 IPLDSYGL----DQYLSYCWQSSETI 450

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 92/436 (21%), Positives = 178/436 (40%), Gaps = 54/436 (12%)

Query: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVR---NIALVANYSWDRTSGKFLSIFFKD 68
           +N R  ++     + L+I R  D  R+  IP+R   N  L+    W+   G+  ++  + 
Sbjct: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL-RCQWEPDDGELFAVALRS 78

Query: 69  GTVRIHDIFKDGRL----------------VSFLRVPSTKISRGIWDRIPLK-REYDSET 111
           G+V+I+     GRL                V   R  + ++ + +W+RI  + RE     
Sbjct: 79  GSVKIYR----GRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGE 134

Query: 112 FAYNVIDILPKLIRF-VKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGND 170
           F   ++  LP+L    +    ++   P       + GP+ +   + +  ++ + F+    
Sbjct: 135 FDSPLVQWLPRLTEMSISAQGKLLCTPLG-----YEGPEWNAGLAADESNMFLTFDNNTR 189

Query: 171 KITIFFNGDYTILLPMDDIENERILESVVKVQDGF--YHCFYNDGSVRTLNLQPLLRSKP 228
           K+ +  +G +         E  +    V  +  G   ++ F ND       LQ +     
Sbjct: 190 KVVLSIDGTFNFRYG----EKSKFPTKVTSILPGNENHYVFIND---EDWQLQVIRLEFT 242

Query: 229 SVDLLHYIMVIKELIGYLLAHVE----LINRELITPYLDFVKRICDEAYGYNKLKSELEC 284
               +H +M     I +LL ++     LI  +L+ P+  F   +  E   + K    L+ 
Sbjct: 243 EYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ-FTKFMKGLKD 301

Query: 285 LFLLGEVSCD--LEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVE 342
           +F LG  S D  +E+W    +G      WK      +  +  +L    +P CER+I+  +
Sbjct: 302 VFYLG-YSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360

Query: 343 KLRGTLEAFSVQNKS-NNTSDLTAVEL--LLKNSQELLNNTLKSIIALGRNETLFEKFFI 399
           +L G +++  +     ++ ++LTAVE+  LL+ S  LL   ++ +      E + +    
Sbjct: 361 RLLGLVKSLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLA 420

Query: 400 WFN---DRIHEGLDED 412
           W     D +    DED
Sbjct: 421 WIEYMMDSLLHNEDED 436

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/362 (18%), Positives = 144/362 (39%), Gaps = 30/362 (8%)

Query: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVR--NIALVANYSWDRTSGKFLSIFFKDG 69
           +N R  ++       + I R  D  ++  IP+R  +   +     +   G   ++  + G
Sbjct: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79

Query: 70  TVRIH----DIFKDGRLVSFLRVPSTKISRG--------IWDRIPLK-REYDSETFAYNV 116
           +V+++    D+           V +  + RG        +W+RI  K R      F   +
Sbjct: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRGAFKGDFDTVL 139

Query: 117 IDILPKLIRF-VKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIF 175
              LPKL    V    +++  P       + GP+ +   S    ++ + ++    K+ + 
Sbjct: 140 TQWLPKLTEMNVSPQGKLTCTPLE-----FEGPEWNASLSENESNMFLTYDNATRKVMVS 194

Query: 176 FNGDYTILLPMDDIENERILESVVKVQDGFY--HCFYND--GSVRTLNLQPLLRSKPSVD 231
            +G +         E  +    V  +  G    + F ND    ++ + L+    S    +
Sbjct: 195 IDGTFNFRYG----EKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE-FTESHQMHE 249

Query: 232 LLHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEV 291
           L+     I+ L+ YL  + ++I  +L+ P+  F+  +  +      LK   +  +L    
Sbjct: 250 LMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSA 309

Query: 292 SCDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAF 351
             ++E+W    +G   +  WK      +  +  IL    +P CER+I+ V++L+G +++ 
Sbjct: 310 EKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSL 369

Query: 352 SV 353
            +
Sbjct: 370 KL 371

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 85/196 (43%), Gaps = 10/196 (5%)

Query: 159 LDVHVIFNEGNDKITIFFNGDYTILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTL 218
           +D+ +  +   +K+ +   G   I +  + ++  + ++ ++KV  G Y C   D S + L
Sbjct: 157 IDIFMAIDSKTNKLILSIEGTLNIKVG-EKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVL 215

Query: 219 NLQPLLRSKPSV-DLLHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNK 277
           +L  L    P++  L+        L+ YL      +  +L  PY +FV+ +  E +    
Sbjct: 216 DLTFL--QDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH---- 269

Query: 278 LKSELECLFLLGEVSCDLEDWLCN-SVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCER 336
            K+ L+ LF +G    ++ + L    +    L KW  L  +    +  ++    +P  ER
Sbjct: 270 -KNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLER 328

Query: 337 IIIFVEKLRGTLEAFS 352
           +I+    +    EA +
Sbjct: 329 MIVLAASIEALCEAIT 344

>Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON}
            complement(32164..36762) [4599 nt, 1533 aa]
          Length = 1532

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 47/108 (43%), Gaps = 3/108 (2%)

Query: 1    MSPPINDYFIDYNP-RFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSG 59
            ++P  +   ID+   R  + AT   K + I           IP +  +LV + + D+ +G
Sbjct: 1280 LTPRSSGLLIDWQQIRGSLLATGDVKVIRIWDAHSETVEIDIPAKTSSLVTSITSDQLAG 1339

Query: 60   KFLSIFFKDGTVRIHDIFKDGR--LVSFLRVPSTKISRGIWDRIPLKR 105
                  F DGT+R +D   D R  +V   R  S + SR     + L+R
Sbjct: 1340 DIFVCGFADGTLRAYDRRLDPRDAMVRLWRTSSNRNSRSAITNVHLQR 1387

>NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1558

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 41   IPVRNIALVANYSWDRTSGKFLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIW-D 99
            IP +  +L+ + + D+ +G   +  F DGT+R++D   D R     R  +   S+G W +
Sbjct: 1350 IPAKTSSLITSLTSDQLAGDIFTAGFADGTLRVYDRRMDPRDSMVRRWRAGDGSQGAWIN 1409

Query: 100  RIPLKR 105
             + L+R
Sbjct: 1410 NVQLQR 1415

>CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 aa]
            {ON} similar to uniprot|P38873 Saccharomyces cerevisiae
            YHR186c
          Length = 1527

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 23   ITKGLAIHRVSDHARIAI---IPVRNIALVANYSWDRTSGKFLSIFFKDGTVRIHDIFKD 79
            +T  + I RV D    ++   IP +  +L  + + D+ +G      F DGT+R++D   D
Sbjct: 1291 VTGDVKIIRVWDALSESLEVDIPAKTSSLFTSLTSDQVAGNIFVAGFSDGTIRVYDRRTD 1350

Query: 80   GRLVSFLRVPSTKISRGIW 98
             RL    R        G W
Sbjct: 1351 PRLAMVRRWRGGGGKPGAW 1369

>YML055W Chr13 (164790..165326) [537 bp, 178 aa] {ON}  SPC2Subunit
           of signal peptidase complex (Spc1p, Spc2p, Spc3p,
           Sec11p), which catalyzes cleavage of N-terminal signal
           sequences of proteins targeted to the secretory pathway;
           homologous to mammalian SPC25
          Length = 178

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 325 ILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLTAVELLLKNSQELLNNTLKSI 384
           +L   F    E+  ++V K RGT E   V+ K      L  VEL+ K   E     LK+ 
Sbjct: 84  LLFWYFSRFIEKGTVYVGKRRGTKEEIYVKTKFEKNEPLYLVELVQKKKGENSKKELKAK 143

Query: 385 IALGR--NETLF---EKFFIWFNDRIHEGLD 410
           + + +  NE+ +   + +F WF+++ H  LD
Sbjct: 144 LEVNKVFNESGYLQNDAYFKWFSEQ-HNVLD 173

>KLLA0C11407g Chr3 complement(980649..983006) [2358 bp, 785 aa] {ON}
           some similarities with uniprot|P38928 Saccharomyces
           cerevisiae YIL140W AXL2 Integral plasma membrane protein
           required for axial budding in haploid cells localizes to
           the incipient bud site and bud neck glycosylated by
           Pmt4p potential Cdc28p substrate
          Length = 785

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 561 FKNYSFSNARFALKMVPNFIREVELSRSNYTVSRN 595
            KNY ++N + ALK+ P  I  V   R N+ VS N
Sbjct: 140 LKNYGYTNGKDALKLSPGDIFNVTFERDNFDVSSN 174

>KLTH0A07260g Chr1 (602127..604328) [2202 bp, 733 aa] {ON} weakly
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222c
          Length = 733

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 201 VQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVI-KELIGYLLAHVELINRELIT 259
           V  G   C Y +   R ++ + LL S P+VDLL+ I  + KEL  Y   H  L   E   
Sbjct: 57  VTRGLGECIYVEQFGRDVSARELLNSAPNVDLLNKIKALEKELDSY--KHTSLTKGEGFN 114

Query: 260 PYLD 263
           P  D
Sbjct: 115 PLRD 118

>ZYRO0F02530g Chr6 (199554..202718) [3165 bp, 1054 aa] {ON} similar
           to uniprot|P19263 Saccharomyces cerevisiae YLR071C RGR1
           Component of RNA polymerase II holoenzyme/mediator
           complex affects chromatin structure and transcriptional
           regulation of diverse genes required for glucose
           repression HO repression RME1 repression and sporulation
          Length = 1054

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 534 PKLYVGTLKXXXXXXXXXXXXXXXPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVS 593
           PK+ +  LK               P+AF+NYSF N R  +  VP+   E++L+ ++Y  S
Sbjct: 228 PKVVLQKLKDMNLSISIKIALMDVPDAFRNYSFKNGRIYI-FVPDE-YEIQLATTDYRAS 285

>ZYRO0B13002g Chr2 (1048390..1051782) [3393 bp, 1130 aa] {ON} highly
           similar to uniprot|Q06685 Saccharomyces cerevisiae
           YLR410W VIP1
          Length = 1130

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 90/233 (38%), Gaps = 46/233 (19%)

Query: 264 FVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVGEKNLKKWKFLGC-----EA 318
           FVK   D +  YN   S L   F+  + + D ++ L  ++ E+  +KW F G       A
Sbjct: 492 FVK---DNSSYYNSCASILRETFIQAKKAMDKQNRLLPAIQEEKTQKWVFKGLVTVIRHA 548

Query: 319 YQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSDLTAVELLLKNSQE--- 375
            +   Q     F        IF+  L+G  E   ++    N +DL  V   LK +QE   
Sbjct: 549 DRTPKQKFKHSFTSP-----IFISLLKGHKEEVVIR----NVNDLEIVVQALKIAQEENA 599

Query: 376 -------LLNNTLKSIIAL------------GRNETLFEKFFI-WFNDRIHEGLDEDYKL 415
                  +L+N L+  + L              NE    +F + W  +  H    +   L
Sbjct: 600 EDPAKLSVLSNALEKKLTLPGTKIQLKPIVNSENEVEKVQFILKWGGEPTHSARYQATDL 659

Query: 416 KFEFEDDPYFGYDLL--TYFDKILSYRSTESSSVINMKLYRELINNMSDMEKD 466
             +   D    +DLL       I  Y S+E   +++ +L++E +    ++  D
Sbjct: 660 GEQMRQD----FDLLNKNILKNIRIYSSSERRVLLSAQLWKEALFGEDELSSD 708

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,066,265
Number of extensions: 3298746
Number of successful extensions: 9577
Number of sequences better than 10.0: 49
Number of HSP's gapped: 9849
Number of HSP's successfully gapped: 49
Length of query: 652
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 536
Effective length of database: 40,180,143
Effective search space: 21536556648
Effective search space used: 21536556648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)