Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3778.269ON56256229000.0
Suva_2.2768.269ON56555724150.0
YDR117C (TMA64)8.269ON56555723370.0
Smik_4.3618.269ON56555722310.0
NCAS0B038008.269ON56556216800.0
TDEL0F039608.269ON55855516600.0
ZYRO0C01496g8.269ON56755715760.0
TPHA0J007808.269ON58357115160.0
Kpol_392.28.269ON56656915140.0
NDAI0J013108.269ON57957115150.0
CAGL0B01837g8.269ON56957114890.0
KAFR0B054708.269ON56257014820.0
SAKL0H16874g8.269ON56355814660.0
KLTH0G13530g8.269ON57456414530.0
Kwal_56.237718.269ON56255814260.0
TBLA0I032008.269ON56356812361e-164
KNAG0H032008.269ON56156512131e-161
KLLA0F19294g8.269ON57056212131e-160
Ecym_43018.269ON56457311251e-147
AGR079W8.269ON54256610621e-138
TBLA0E022107.60ON42666741.9
CAGL0B03927g5.144ON19674703.7
SAKL0A01496g6.331ON619104723.9
Kpol_1050.295.144ON20696704.0
NDAI0C049508.441ON21969704.2
NCAS0D017705.144ON19796687.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.377
         (562 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...  1121   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   934   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   904   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   863   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   651   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   644   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   611   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   588   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   587   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   588   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   578   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   575   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   569   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   564   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   553   0.0  
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   480   e-164
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   471   e-161
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   471   e-160
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   437   e-147
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   413   e-138
TBLA0E02210 Chr5 complement(545350..546630) [1281 bp, 426 aa] {O...    33   1.9  
CAGL0B03927g Chr2 (386875..387465) [591 bp, 196 aa] {ON} highly ...    32   3.7  
SAKL0A01496g Chr1 complement(142658..144517) [1860 bp, 619 aa] {...    32   3.9  
Kpol_1050.29 s1050 (69445..70065) [621 bp, 206 aa] {ON} (69445.....    32   4.0  
NDAI0C04950 Chr3 (1146017..1146676) [660 bp, 219 aa] {ON} Anc_8....    32   4.2  
NCAS0D01770 Chr4 complement(331343..331936) [594 bp, 197 aa] {ON...    31   7.2  

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score = 1121 bits (2900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/562 (97%), Positives = 546/562 (97%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVDYFI 240
           LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVDYFI
Sbjct: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVDYFI 240

Query: 241 TRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHXXXX 300
           TRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKH    
Sbjct: 241 TRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHFEKE 300

Query: 301 XXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMTL 360
                       TIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMTL
Sbjct: 301 GFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMTL 360

Query: 361 YKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNMVN 420
           YKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNMVN
Sbjct: 361 YKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNMVN 420

Query: 421 KKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEMKI 480
           KKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEMKI
Sbjct: 421 KKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEMKI 480

Query: 481 GRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLIIDHL 540
           GRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLIIDHL
Sbjct: 481 GRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLIIDHL 540

Query: 541 NNLGVPNKWIDFENKLKKKKRT 562
           NNLGVPNKWIDFENKLKKKKRT
Sbjct: 541 NNLGVPNKWIDFENKLKKKKRT 562

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/557 (80%), Positives = 491/557 (88%), Gaps = 3/557 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTCKKQTNN+EYTFPTSTIKQTNF  QKS+G VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKHNEQLFPTVYSCWEN TLLPI+LTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R K+GTLCGVASR+APK+VLA+GIVEMDLPSY RV+GETGVAVK++HHFNDGLSKA KVK
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LDPPIA---KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237
           L+PP A    S DEDI++ Q++  E  K  E  +EN+Q+A +++EE+AEVLDH SVSDVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHX 297
           YFITRALYYTLTQDKSL LPIS SNFISNHIMRNLPPIDHNEVNVK+TSW+KSAKFLKH 
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 298 XXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357
                          TIVGK  DKDELKNFVPYK+G + SA+E GE+ NSKEKT GMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417
           +TLYKPF++AKD +KEANL F+TYYTSQDIRSA++QYIS  NL D KDKGKVVMDDLL+N
Sbjct: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420

Query: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477
           MVNKKKK+ + AR++PRAQILDPLLANNFTEFYQI+KNDD+LL + P+KGSPPRIKI TE
Sbjct: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480

Query: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 537
           MKIGRKVIT+VSNFE  QIDPE LA DLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII
Sbjct: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540

Query: 538 DHLNNLGVPNKWIDFEN 554
           DHLN  GVPNKWIDFEN
Sbjct: 541 DHLNKSGVPNKWIDFEN 557

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/557 (78%), Positives = 481/557 (86%), Gaps = 3/557 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQT +KQTNN+EY+F TSTIKQTNF  QKSVG VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKH EQLFPTVYSCWE P LLPI+LTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R K+GTLCG+AS++AP+ VLAIGIVE+DLPS+D+V+GETGVAVK+IHHFNDGLSK  K+K
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LDPPIA---KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237
           L+PP     +S D +I+SKQ++  E+ K VE  QE++++A V VEE+AEVLDHF+VSDVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHX 297
           YFITRALYYTLTQDK L LPIS SNFISNHIMRNLPPIDHNEVNVKKTSW+KSAKFLKH 
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 298 XXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357
                          TIVGK  DKDELKNFVPYK+G S SA ES E   SKEKT GMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417
           +TLYKPF++AKD LKE NL   TYYTSQDIRSA+SQYIS  NLADTKDKGKV+MDDLLF+
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420

Query: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477
           MVNKKKK LNA+RI+ R +IL PLL NNFTEFYQIFK+DD+LLFKAP+KGS P IKI TE
Sbjct: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480

Query: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 537
           MKIGRKVITRVSNFEVFQ+DPESLA DLRKICSGSTTI ESQTFK AEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540

Query: 538 DHLNNLGVPNKWIDFEN 554
           DHLN LG+P+KWIDFEN
Sbjct: 541 DHLNKLGIPSKWIDFEN 557

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/557 (75%), Positives = 479/557 (85%), Gaps = 3/557 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTC KQTNN+EYTFPTS IKQTNF  QKSVG VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PILFKEKH EQL+PTVYSCW+NP+LLPI+LTHGFVIEEHLFNGANLMISGSIPPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R  VGTLCGVA +++PKVVLAIG+VE+DLPSYDRV+GETGVAVKVIHHFNDGL KA KVK
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LDPPIA---KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237
           L+PP+    +S DE+INSKQ + PE+ K  + +QE+++K    +EE+AEVLDH +VSDVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHX 297
           YFITRALYY+LTQDK L+LPIS S FISNHIMRNLPPIDHNEVNVKK+SW+KSAKFLKH 
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 298 XXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357
                          TIVGK  DKDELKNFVPYK+G S+ ++ SGE+A SK++T GMM+S
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417
           +TLYKPFS+AKD L+EA LG  TYYTSQD+R+A+S+YIS  NLAD KDK KVVMDDLLFN
Sbjct: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLFN 420

Query: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477
           MVNKKKK  +  RI+ R++IL PLL+NNFTEFYQIF+NDD+LLF+ P+KG PPRIKI TE
Sbjct: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480

Query: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 537
           MKIGRKVIT+VSNFEVF IDPE LA DLRKICSGSTTIGESQTFKSAEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540

Query: 538 DHLNNLGVPNKWIDFEN 554
           D+LN  G+P+KWIDFEN
Sbjct: 541 DYLNKSGIPSKWIDFEN 557

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/562 (58%), Positives = 413/562 (73%), Gaps = 14/562 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MF+KEPHIKALSNLKNS+RKKL QT   QT ND+YT P S +KQTNF +  ++G +YTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH+ +L+ TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RSKVGTLCGVASREAP-KVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKV 179
           + KVGTLCGVAS + P +VV AIGIV MDLP +++V+GE+GVAV++IHHF D L K+ K+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQK---AQVHVEELAEVLDHFSVSDV 236
            L PP+       +N ++ +  E+ +   N ++   K      +VE+LAEVLDH SV DV
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 237 DYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKH 296
           DYFITRALYYT+T D  L LPIS SNFIS HI +NLP +DHNEVN+KK+SW+K+AKFLKH
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299

Query: 297 XXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSK---EKTPG 353
                           T+VG    KDELKNFVPYK+GSS     +GE+  +K   +   G
Sbjct: 300 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSS-----NGENKGAKKEGDSQSG 354

Query: 354 MMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413
           MMYS+T YKP ++AKD +KE+ +  +  Y   +IR  ++ YI+  NL D K+K  V++DD
Sbjct: 355 MMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDD 414

Query: 414 LLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIK 473
           LLF MVNKK+ +   +R + RAQIL+P L NNFTE +QI+ +  + LFK+P++GSPPRIK
Sbjct: 415 LLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIK 474

Query: 474 ITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPH 532
           I TEMKIGRKVIT+VSNFE F I+PE+LA DLRK+CSGSTTIGE+ T  K+AEVQVQGPH
Sbjct: 475 ILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPH 534

Query: 533 GQLIIDHLNNLGVPNKWIDFEN 554
           GQ+IIDHLN LGVP KWID+EN
Sbjct: 535 GQIIIDHLNKLGVPTKWIDYEN 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/555 (56%), Positives = 409/555 (73%), Gaps = 8/555 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQ+CK+QT   +Y F TS +KQTN+  Q S G VYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PI FKEKH E LFPTVYSCW  P LLPI+LTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R     +CG+ASR  PKV+LAIG+V+++LPSY  V+G+ G+AVKV+H+F DGL +A K+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVDYFI 240
           ++P +  S   +   ++     + K+ E+ +      ++ +E++A+VLD  SV DVD+F 
Sbjct: 181 IEPAVLSSEPVEEEEEEEG---KEKLTESPKRETFHTEISIEDVAQVLDELSVEDVDHFF 237

Query: 241 TRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHXXXX 300
           TRALYYT T D  L +PI+ SNFISNHI+ NLPP+D ++VN+KKTSW+K+AKFLKH    
Sbjct: 238 TRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHFEKV 297

Query: 301 XXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMTL 360
                        IVG   +KDELKNFVPYK    TS Q + +  ++K+ +PGMMYS  L
Sbjct: 298 GFLQLKGKGDDLVIVGVNKNKDELKNFVPYK----TSGQTASKKNSNKDSSPGMMYSEKL 353

Query: 361 YKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNMVN 420
           YKP ++ KDF++ ++L  +  YT  +++ +++QYI+   L D+K+K  V++DDLLF+M  
Sbjct: 354 YKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFDMFY 413

Query: 421 KKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEMKI 480
           +KKK     R + RAQI+DP +ANNFTEFYQ+FK++D+ LFK PI+G  PR+KI TEMKI
Sbjct: 414 RKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTEMKI 473

Query: 481 GRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLIIDH 539
           GRKV+TRVS+FE F++DPE LA +LRK+CSGSTTIGE+ T  K AEVQVQG HG LIID+
Sbjct: 474 GRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLIIDY 533

Query: 540 LNNLGVPNKWIDFEN 554
           LN  G+P KWIDFE+
Sbjct: 534 LNKQGIPTKWIDFES 548

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/557 (54%), Positives = 409/557 (73%), Gaps = 4/557 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKK+PH+KALSNLKNSE KKLL TC+ QT N EY+FPT  IKQTNF +Q  +G VYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           +N PI FKEKH   L+PTV++CW +P LLP++LTHGFV+EE LFNGANLM++G++ PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R K GT+CG+AS+ AP VV+A+G+V++DLPSYD VLG+TGVAV+++H+  DGLSK  KV 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQE-NMQKAQVHVEELAEVLDHFSVSDVDYF 239
            +PP++    ++   ++ +  EE+    ++QE   Q+  V ++++AEVLD F + DVD F
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLEDVDQF 240

Query: 240 ITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHXXX 299
           +TRALYYTLT D  L LPIS SNFISNHI  NLP +DH +VNVKK+SW+K+AKFLK+   
Sbjct: 241 LTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNFEK 300

Query: 300 XXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYSMT 359
                        TI+G    K EL+NF PY++   +    +    N+K+     +   T
Sbjct: 301 EGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLRCET 360

Query: 360 LYKPFSIAKDFLKEANLGFR-TYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFNM 418
           LYKP ++AKDF+++ +L  +   YT+Q++++AL+ YI++NNLAD+K+K  V++DDLL+++
Sbjct: 361 LYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLYHL 420

Query: 419 VNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTEM 478
           VNKK+K+  A R++ RA I++PLLAN+FT  +QI+K D   LFK P +G+ P I+I TEM
Sbjct: 421 VNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIP-LFKNPSRGNLPNIEIVTEM 479

Query: 479 KIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLII 537
           KIGRKVITRVS FE+F ID + LA  LR++CSGSTTIGE+ T  K  EV VQGPHG LII
Sbjct: 480 KIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPLII 539

Query: 538 DHLNNLGVPNKWIDFEN 554
           DHLN+LG+P KWI F+N
Sbjct: 540 DHLNSLGIPTKWIKFDN 556

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/571 (51%), Positives = 405/571 (70%), Gaps = 14/571 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+CK+Q N+ +Y FP+S IKQ N+  Q S G VYTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH++ LFP+VY+CW+NP LLPII+T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R   G LCG+AS + P VV+AIGIV++DL SY +V+GETGVAV V+H+  DGLS + K+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQK-----AQVHVEELAEVLDHFSVSD 235
           L+PP  ++G E   + ++   ++ + V N   N  K     A+ + ++LAEVL+   V  
Sbjct: 181 LEPP--ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPN-DDLAEVLETLPVDI 237

Query: 236 VDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLK 295
           +D FIT++LYY+LT D  L  PIS SNFISN+IM NLPP+D++ VN+KK+SW+K+AKFL+
Sbjct: 238 IDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLR 297

Query: 296 HXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMM 355
           H                 I G   +K ELK+FVPY+ G+  S +   +  N       MM
Sbjct: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMM 357

Query: 356 YSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLL 415
            S++ YKP S+ KD ++E+    ++ YT+ ++R  +++YI+  NL D+K+K  ++MDDL+
Sbjct: 358 QSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLM 417

Query: 416 FNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSL----LFKAPIKGSPPR 471
           +++V  KKKN    R++ RA +++P+  NNF E +QI+K  D+     LFK PI+GS P+
Sbjct: 418 YSLV-YKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPK 476

Query: 472 IKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQG 530
           ++I TEMKIGRKVITRVSNFEVF ID E+LA DLRK+C+G+TTIGE+ T  K+AEVQVQG
Sbjct: 477 VEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQG 536

Query: 531 PHGQLIIDHLNNLGVPNKWIDFENKLKKKKR 561
           PH Q+II HLN+L +P KWIDF+N +K K++
Sbjct: 537 PHSQVIIKHLNSLSIPTKWIDFKNSVKPKRK 567

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/569 (53%), Positives = 408/569 (71%), Gaps = 15/569 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+CK QT + +Y FPTS IKQTNF +Q SVGV+YTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
             +P+ FKEKH+E LFPTVY+CWE+PTLLPI+LTH  VI EH+FNGANLMISG++PPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R    T+CG+A+R  P  ++A+G+V++D+PSY  V+G+TGVAV V+H++ DG+S A K+K
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LD-PPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQV------HVEELAEVLDHFSV 233
            D P I    D+ +++ +    +++ ++   +E  +   +       V ELA+     +V
Sbjct: 181 RDIPTIVGGKDKSVDATE---NDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTV 237

Query: 234 SDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKF 293
            D+D+FITR+LYYTLT D  L  PI  S+FISNHIMRNLPP+DHN VN+KKTSW+KS+KF
Sbjct: 238 EDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKF 297

Query: 294 LKHXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANS-KEKTP 352
           LKH                TIVG   +K+ELK F PY++  S S+  SG+  NS ++++ 
Sbjct: 298 LKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRI--SNSSSNSGKKINSNRQESE 355

Query: 353 GMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMD 412
            MMYS+  Y P   AK F+    L ++ +YT+ ++++A+++YI    L D K+     +D
Sbjct: 356 NMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLD 415

Query: 413 DLLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRI 472
           D L++M    KK+ N  R + RA +++    NNFTE YQ+FKNDD+ L K P++GSPPRI
Sbjct: 416 DRLYDMC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRI 474

Query: 473 KITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGP 531
           KI TEMKIGRK++TRVSNFE F ID ++LAGDLR++CSGSTTIGE+ T  K+ EVQVQGP
Sbjct: 475 KIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGP 534

Query: 532 HGQLIIDHLNNLGVPNKWIDFENKLKKKK 560
           H ++IIDHLN+L +P KWIDFENKLK KK
Sbjct: 535 HSKIIIDHLNSLSIPTKWIDFENKLKPKK 563

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/571 (55%), Positives = 396/571 (69%), Gaps = 22/571 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTI-KQTNFCSQK--SVGVVY 57
           MFKKEPHIKALSNLKNS+RKKLLQT K QTN + Y F  S I KQTNF +    S+G ++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDENNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPP 117
           T+++N PI FK KHN+ L+PTV++CW N  +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDPRSKVGTLCGVASREAPK-VVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKA 176
           FD R   GTLCG+AS + PK +V AIG+V+M++PS+D+V+GETGVAV+VIHHF D L K 
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 LKVKLDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDV 236
            K     P  +   E +N++  Q  + A   E+     ++ +   E   EVLDHF   DV
Sbjct: 181 FKCNDLKP-DEFVKEQLNTEHPQDNDVAD--EDTTRKKEENRESNEPDFEVLDHFKTEDV 237

Query: 237 DYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKH 296
           DYFITR+LYYT+TQD  + LPIS SNFIS HI +NLP I HNEVN+KKTSW+K+AKFLKH
Sbjct: 238 DYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTAKFLKH 297

Query: 297 XXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSST--SAQESGEHANSKEKTPGM 354
                           T+VG    KDELKNFVPYK+G ST  S   S  + N K  T GM
Sbjct: 298 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKSDTKGM 357

Query: 355 MYSMTLYKPFSIAKDFLKEA-NLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413
           MYS T YKP + AKD LK    +  +  YT Q+IR  ++ YI++ NL D K+K  +++DD
Sbjct: 358 MYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKMILLDD 417

Query: 414 LLFNMVNKKKKNLNAA-RIMPRAQILDPLLANNFTEFYQIFK---------NDDSLLFKA 463
           LLFNMV+K++   NAA R M R  IL+P+LANNFTE YQI++          D   LFK+
Sbjct: 418 LLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVEPLFKS 477

Query: 464 PIKGSPPRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-K 522
           P +G  P+I I TEMKIGRKVIT+VSNFE+F I  + LA DLRK+CSGSTTIGE+ T  K
Sbjct: 478 PQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGETMTSPK 537

Query: 523 SAEVQVQGPHGQLIIDHLN-NLGVPNKWIDF 552
           + EVQVQGPHGQ+IIDHLN   GVP KWI++
Sbjct: 538 TPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/571 (51%), Positives = 396/571 (69%), Gaps = 30/571 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEPHIKALSNLKNSERKKL + C+ QT+N+EY+F ++TIKQTNF    ++G +YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH+E+L+PTV +CW  P L+P++LTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R  VGT+CG+A +  P +++A+GIV+M+LPS+ RV+GETGVAV+++HH  D L K  KVK
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LDPP-----------IAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLD 229
            +PP                + DI+       +E K+  N+  + +K + +++++AEVLD
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHE------DETKVESNS--DTEKEKSNLDDMAEVLD 232

Query: 230 HFSVSDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPP-IDHNEVNVKKTSWR 288
              + D+DYFITRALYYT++QD  L  P S SNF+SNHI  NLP   +  EVN+KK+SW+
Sbjct: 233 ELRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWK 292

Query: 289 KSAKFLKHXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSK 348
           K+AKFLKH                TIV    DKDE+K F+PY V  +  +    E  N+K
Sbjct: 293 KTAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAK 352

Query: 349 EKTPGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGK 408
                 +  +TLYKP ++AKDF+    +  +  Y   +I+  +++YI+  +L D KDK  
Sbjct: 353 T----TIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKC 408

Query: 409 VVMDDLLFNMVNKKKKN-LNAARIMPRAQILDPLLANNFTEFYQIFK---NDDSLLFKAP 464
           V++DD+L  M+ KKK++    +R++PRA IL P+L NNF + Y +F+   N+ + L K P
Sbjct: 409 VLVDDMLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTP 468

Query: 465 IKGSPPRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGE--SQTFK 522
           +KG PP+I I TEMKIGRKVIT+VSNFEVFQIDPE  A D+RK CSGSTTIGE  S   K
Sbjct: 469 LKGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKK 528

Query: 523 SAEVQVQGPHGQLIIDHLNNLGVPNKWIDFE 553
           +AEVQVQGPHGQLI+ +LN+LG+PNKWIDFE
Sbjct: 529 TAEVQVQGPHGQLIMSYLNDLGIPNKWIDFE 559

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/570 (50%), Positives = 389/570 (68%), Gaps = 33/570 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDE-YTFPTSTIKQTNFCSQKSVGVVYTD 59
           MFKKEP IKALS LKNS+RKKL+Q+ K Q  +DE  +    +I QTNF S  + G +YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  ENNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFD 119
            N+ PI+FK KH++ L+PT +  W N  LL  + TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 PRSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKV 179
               +GT+C VA++EAP V +A+GIV+++LP Y +VLG+TGVAV+++HHF D L    K 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLDPP--------------IAKSGDEDINSKQV-QPPEEAKIVENAQENMQKAQVHVEEL 224
           KL+ P              +AK  D +  S+ V +PP  ++                +++
Sbjct: 181 KLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSE--------------GPDDI 226

Query: 225 AEVLDHFSVSDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKK 284
           AEVLD  +V DVDYFI RALY+T+ QD +L LP+  S F+SNHIMRNLP +DH +VN+K+
Sbjct: 227 AEVLDELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKR 286

Query: 285 TSWRKSAKFLKHXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEH 344
           TSW+K+AKFLK+                 IVG   DKDELKNFVPYK+G++  A+++   
Sbjct: 287 TSWKKTAKFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNT--AKKAASK 344

Query: 345 ANSKEKTPGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTK 404
           ++S +     + S+ LYKP ++ + F+KE+N+     YTS +IR+ ++ YI   NL D K
Sbjct: 345 SDSTQTQGVSVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEK 404

Query: 405 DKGKVVMDDLLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAP 464
           DK  V++DDLLF MVN+K +N    RI+PRA IL+PL+ANNF E++Q++K D++ LFK P
Sbjct: 405 DKKMVMLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNP 464

Query: 465 IKGSPPRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSA 524
           IKG  P+I I TEMKIGRKV+TRVSNFE F+I PE LA DLRK+CSGSTTI E+   K +
Sbjct: 465 IKGQTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVS 523

Query: 525 EVQVQGPHGQLIIDHLNNLGVPNKWIDFEN 554
           EVQVQGPHGQLIIDH N  G+P+K+I FEN
Sbjct: 524 EVQVQGPHGQLIIDHFNKSGIPSKFIQFEN 553

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/558 (51%), Positives = 382/558 (68%), Gaps = 12/558 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL + ++Q    +Y FPT  +KQT F  Q S G VYTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH   +FPTV++CW NP +LP++ TH  V+EE L  GA+LM+ G +PPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           +   G+L GVAS  +P+V+ AIGIV++DLPSY RV+GETGVAV +IH F+DGL KA K+K
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LDPPIA----KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDV 236
           L+PP A     S  E+   + V   +EAK +       Q   V+ E+ +E L+  S  D+
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATT---TQARMVNTEDASEQLNELSAEDI 237

Query: 237 DYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKH 296
           D+F+TR+LYYTLTQD  L LP++ SNF+SNHI+ NLPP+DHN++N+KK+SW+KSAKFLKH
Sbjct: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297

Query: 297 XXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMY 356
                            +VG   DKDELK FVPY++GS     ++   A   ++   MM 
Sbjct: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA---QENSNMMQ 354

Query: 357 SMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLF 416
           +++LYKP S AK+F K  +L     +T+Q++++AL  YI   NL +  DK  V++DD LF
Sbjct: 355 AVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLF 414

Query: 417 NMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITT 476
            M+N+  K  NA R + RAQI+ P LANNFTE +QI K D   LFK  +KG+ P I+I T
Sbjct: 415 PMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVP-LFKTALKGAIPEIQIVT 473

Query: 477 EMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPHGQL 535
           EMKIGRKV+T+VSNFE FQ+D E+LA +LRK CSGSTTIGE+ +  K+ EV VQGPHG +
Sbjct: 474 EMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAI 533

Query: 536 IIDHLNNLGVPNKWIDFE 553
           +I  LN  G+P KWI+F+
Sbjct: 534 VIGMLNEYGIPTKWINFQ 551

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/564 (50%), Positives = 375/564 (66%), Gaps = 13/564 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEP IKALSNLKNSERK +   CK+QT + EY FP+  IKQT F +  + G V+TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEK ++ L+PTV++CW N  LLPI+L H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R     +  VAS  AP VV AIGIV+++LP Y RV+GE+GVAV+++H F D L K  KVK
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LDPPIAKSGDEDINSKQVQPPEEAKIVENAQENM---------QKAQVHVEELAEVLDHF 231
           L PP   +   D  S++    E+   V +A E++         Q+  V+VE+++E L   
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 232 SVSDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSA 291
            V DVD+F TR+LYY+L  D  L  PIS SNF+SNHI+RNLPPIDH +VN+KKTSW+K+A
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 292 KFLKHXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEH--ANSKE 349
           KFLK+                TI+G    K ELKNF PY++G   S+ E G    AN KE
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 350 KTPGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKV 409
           +   +M +++LY+P S  K FL   +L     +T QDI+SA+ +YIS  NL    +K  V
Sbjct: 361 QA-SVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAV 419

Query: 410 VMDDLLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSP 469
            +DDLL+++VN+  K  NA R + RAQI+ P+L  NF+E + I K D + LFK P+KGS 
Sbjct: 420 RLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSI 479

Query: 470 PRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQV 528
           P+++I TEMKIGRKV+T+VSNFE FQ+D + LA  LRK CSGSTTIGE+ T  K+ EV V
Sbjct: 480 PQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTV 539

Query: 529 QGPHGQLIIDHLNNLGVPNKWIDF 552
           QGPHG  +I+ LN  G+P KWI+F
Sbjct: 540 QGPHGPAVIELLNESGIPTKWINF 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/558 (50%), Positives = 372/558 (66%), Gaps = 9/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEP IKALSNLKNSERKKL   C++Q    +Y+FP+  IKQT F +  + G VYTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEK ++ L+PTV+SCW N  L+PI+L H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R     + GVAS  +P VV AIGIV+++LP Y RV+GE+GVAV+++H F+D L KA KVK
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LDPPIAKSGDEDINSKQVQPPEEA---KIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237
           L PP    G  + +S++    E +   KI       +Q+  V++++ AE L   SV DVD
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHX 297
           +F TRALYYTLTQD  L +P S SNF+SNHI+RNLPP+DH +VN+KKTSW+K+AKFLKH 
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 298 XXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357
                          TIVG    KDELK+FVPY+ G ++      E   +      MM +
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQN-----SMMKA 355

Query: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417
           + +YKP S AK FL   +L   + ++ Q+++ A+  YI++  L    +K  V +DDLLF+
Sbjct: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415

Query: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477
           +VN+  K  NA R + RAQI+ P+L  NF E + + K D + LFK P+KG  P+I+I TE
Sbjct: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475

Query: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTF-KSAEVQVQGPHGQLI 536
           MKIGRKV+T+VSNFE FQ+D + LA  LRK CSGSTTIGE+ T  K+ EV VQGPHG  +
Sbjct: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAV 535

Query: 537 IDHLNNLGVPNKWIDFEN 554
           I+ LN L +P KWI+F N
Sbjct: 536 IELLNQLAIPTKWINFVN 553

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  480 bits (1236), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 251/568 (44%), Positives = 356/568 (62%), Gaps = 14/568 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKK   I  LSNLKNSE + + QTC+   +N+EY FP S +KQT F S  + GV+YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PI FK+K++  + PTVY+ WE P  +PII TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
           R K G +CG+AS + P  +LAIG+   D+ + D  LG+TGVAV+V+H ++D L+   K+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LDPP-IAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQV------HVEELAEVLDHFSV 233
           L+PP I  + +        Q     +I E   E    A        + ++LAE L+   V
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 234 SDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKF 293
            D+D F+T++LYYT+TQ+ SL LPI  S F+S ++M+NLP +DHN+VN+KK+SW+K+AKF
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300

Query: 294 LKHXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPG 353
           LKH                TI G   +K +LK FVPY++G    A  S +  ++K     
Sbjct: 301 LKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDNK----N 356

Query: 354 MMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413
            +  +TLY P            L  ++Y+TS +I SA+  YI+  NLA+ KDK K+ MDD
Sbjct: 357 FLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDD 416

Query: 414 LLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIK 473
           +LF++V    K  NA R + R+Q+++P+L NNF  ++Q+F +D+  L K P KGSPP +K
Sbjct: 417 VLFDLVITNNK-ANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVK 475

Query: 474 ITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHG 533
           + TE     KVITRVSNFEVF ID + ++ +L+ +CSGST+I E      +EVQVQGPHG
Sbjct: 476 MVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELP--NGSEVQVQGPHG 533

Query: 534 QLIIDHLNNLGVPNKWIDFENKLKKKKR 561
            +++++    G+P KW D+ NK+K KKR
Sbjct: 534 DIVMEYFEKHGIPRKWFDYTNKVKPKKR 561

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  471 bits (1213), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 266/565 (47%), Positives = 357/565 (63%), Gaps = 24/565 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKK PHIK LSNLKNSE++KL Q  +KQ   DE+ F  +T+KQTNF S  SVG +Y ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  NNTPI--LFKEKHNEQ-LFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPP 117
              P+   FKEKH    L+P+VY+CW +P LLPIILTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-PRSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKV--IHHFNDGLS 174
           FD      G  CG+A+ ++P V++A+G ++MDL  ++         V V   HHF DGL+
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KALKVKLDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVS 234
            A ++KLD P      + + S   Q   E   VE    +     V V++LAEVL+  SV 
Sbjct: 181 DAFRLKLDIP------DKLESATTQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLETLSVE 234

Query: 235 DVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPP-IDHNEVNVKKTSWRKSAKF 293
           DVDYF+TRALYYTLTQ+  L LPI+ SNF+S H+M+ LP  ID  EVNVKK+SW+K+AK+
Sbjct: 235 DVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKY 294

Query: 294 LKHXXXXXXXXXXXXXXXXTIVGKTIDKDE--LKNFVPYKVGSSTSAQESGEHANSKEKT 351
           LKH                 +VG T  K    LK+FVPY VG+S +  ESG    S+   
Sbjct: 295 LKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIA--ESG--PKSQTTN 350

Query: 352 PGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVM 411
             +M+++T ++P S A+  L    LG + Y++  +IR  L++YI+ N LA   +   V++
Sbjct: 351 GPVMFAVTSFQPDSTAQTALP---LGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLL 407

Query: 412 DDLLFNMVNK-KKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPP 470
           +D LF MV K  ++     RIM R +IL+ ++  +F   YQ+FK+ D+ L K P KG PP
Sbjct: 408 NDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPP 467

Query: 471 RIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGES-QTFKSAEVQVQ 529
           ++ I TEMKIGRKV+TRV NF+   I     A DLRK+CS STTIG++  T   +E+QVQ
Sbjct: 468 KVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQ 527

Query: 530 GPHGQLIIDHLNNLGVPNKWIDFEN 554
           G HG LIIDHL  LGVP+ W+ FEN
Sbjct: 528 GAHGPLIIDHLRELGVPSSWVVFEN 552

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  471 bits (1213), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 250/562 (44%), Positives = 350/562 (62%), Gaps = 10/562 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MF KEPHIK LSNLKNS+RKKL  T K+Q N +EY  PT+ IKQT+F      G +YTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  NNTPILFKEKHNEQLFPTVYSCWE-NPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFD 119
           +N PI FK K  +QL+PT++S W     LLPIILTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 PRSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKV 179
              K G++ G+AS + P +V AIGI EMDL     V+G  G+AV+V+H+ +DGL KA K+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLDPPIAKSGDEDINSKQV--QPPEEAKIVENAQENMQKA--QVHVEELAEVLDHFSVSD 235
           +L+PP      E I +  +  Q  +  + ++    +++++  Q  V E+A+ L+  S+ D
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239

Query: 236 VDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLK 295
           VD+ + RA+ Y++  D  + LPI  S FISNH+M+NLP +D N VN+KK+SW+K+ K LK
Sbjct: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299

Query: 296 HXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMM 355
           +                T++    +  +L N   YK  ++ + + SG+  N   K     
Sbjct: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359

Query: 356 YS-MTLYKPFSIAKDFLKEANLGF-RTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413
           YS   LYKP S  + F+        ++YYT Q+++  L  Y++ NNL D ++K  V  DD
Sbjct: 360 YSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDD 419

Query: 414 LLFNMVNKKKKNLNAARIMPRAQILDP-LLANNFTEFYQIFKNDDSLLFKAPIKGSPPRI 472
            L+ M N+  +N    +I  R  I+ P  L+ NF  ++QI+K +   L K P KG  P +
Sbjct: 420 TLYQMSNRAPQNGGIQKIA-RGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPTL 478

Query: 473 KITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPH 532
           +I TE KIGRKVITRV+NFE F+ID E LA  LRK CSGSTTIGES++ K+AEVQVQGPH
Sbjct: 479 EIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGPH 538

Query: 533 GQLIIDHLNNLGVPNKWIDFEN 554
           G ++I  LN+ G+P KWI FEN
Sbjct: 539 GSIVISILNDYGIPTKWISFEN 560

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  437 bits (1125), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 234/573 (40%), Positives = 355/573 (61%), Gaps = 21/573 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKK+P IK+ SNLKNSERKKLL   + Q  N E+ F T+ +KQ  F +  + G ++TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           +N PI FKEKH+E L PT+ +CW+ P LL ++LTH  V++  L NGA+LM+ G+IPPF  
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
               G L GVAS E P VV AIG+ +++L    +V+GETGVAVKV+H  NDGL +  K+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LDPP--IAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQV---------HVEELAEVLD 229
           ++PP  +  S   ++  + +   ++A  ++   E++  A+           + E+AE L+
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQE-DEDLPTAKTASGPLEEPNSLSEVAEQLE 239

Query: 230 HFSVSDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRK 289
             S+  VD+F+T+A+YYTL  D +L LPI  SNFI+NH+M+NLP I   +V++K++SW +
Sbjct: 240 ELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWAR 299

Query: 290 SAKFLKHXXXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKE 349
           ++KFLK+                T+V    DK E+K+F PY+    + +  S    N K 
Sbjct: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN--NDKH 357

Query: 350 KTPGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKV 409
               ++Y    Y+P + AK  L            ++DI++ L++Y++   L +  D+  +
Sbjct: 358 DVEVVVY----YQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERII 413

Query: 410 VMDDLLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSP 469
           ++DD LF++  KK  + ++ R + RA++ D +L+ +FTE + IFK D   L   P+K   
Sbjct: 414 LLDDTLFSLAYKKSAS-DSTRKVLRAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLKSKN 471

Query: 470 PRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKS-AEVQV 528
             + + TEMKI RK++TR+SNFE++ +DPE L+ +LRK CSGS+T+ E  T +S  EVQV
Sbjct: 472 RNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQV 531

Query: 529 QGPHGQLIIDHLNNLGVPNKWIDFENKLKKKKR 561
           QGPHG   I+ LN  G+P+K+IDF+NKL KKK+
Sbjct: 532 QGPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  413 bits (1062), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/566 (39%), Positives = 330/566 (58%), Gaps = 30/566 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60
           MFKKEP++   SN KNSERK+L  + ++Q   + Y F ++ IK   F +Q +VG VYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN P+ F+ KH++   PTVYSCW++P LLP++ TH  V+E  L  GA+LM+ G++PPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180
            ++ G + G+AS  AP VV A+GI EMDL     V   TGVAV+V+H + DGL +  KV+
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LDPP---IAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237
            + P    AK    +    + +PP+ A                 E LAE L+  ++ DVD
Sbjct: 181 REAPEASEAKGASPEAREPEAEPPKTAP---------------GEGLAEELERLTMEDVD 225

Query: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHX 297
           + +TRA+YYT+  D  L LP++ S FI+ H+++NLPP+D ++V VK++SW K+AK LKH 
Sbjct: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHF 285

Query: 298 XXXXXXXXXXXXXXXTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357
                          T+V      + LK+F PY+  S  ++  +G   +S  ++  ++Y 
Sbjct: 286 EAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKAS--TGSKNSSTTQSLEIVYH 343

Query: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417
              Y P       L    +      +++DIR  L QY++     D  DK  + +DD L  
Sbjct: 344 ---YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQ 400

Query: 418 MVNKKKKNLNA--ARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKIT 475
           +++   KN+NA   R +PR + L  LL+ +F+E++ + + D  L    P KG  P IK+T
Sbjct: 401 LLH---KNVNADTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPPIKVT 455

Query: 476 TEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQL 535
            E KI +KV+T+VSNFEV+ +DPE LA +LR  CSGSTTI +    K+ EVQVQGPH   
Sbjct: 456 NERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEAT 515

Query: 536 IIDHLNNLGVPNKWIDFENKLKKKKR 561
           I+  LN  G+P+K+I  + K++ KK+
Sbjct: 516 IVSILNKHGIPSKYITLDCKVQPKKK 541

>TBLA0E02210 Chr5 complement(545350..546630) [1281 bp, 426 aa] {ON}
           Anc_7.60 YAL032C
          Length = 426

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 44  QTNFCSQKSVGVVYTDENNTPILFKEKHNEQLF-----------PTVYSCWENPTLLPII 92
           Q N   QK   ++ TDE++ PIL K   +++L            P+  S W+NP    I 
Sbjct: 146 QPNMIKQKKNQLLQTDESDIPILHKTGESDRLLLSKEEKAAWNIPSAISNWKNPNGFAID 205

Query: 93  LTHGFV 98
           L    V
Sbjct: 206 LDKRLV 211

>CAGL0B03927g Chr2 (386875..387465) [591 bp, 196 aa] {ON} highly
           similar to uniprot|P47089 Saccharomyces cerevisiae
           YJR014w
          Length = 196

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 471 RIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDL-RKICSGSTTIGESQTFKSAEVQVQ 529
           ++ +  E +  RK I  +S  EVF+ID + LA     K  +G +    ++  K  EV VQ
Sbjct: 96  KVIVKREARTKRKYIVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAE--KKEEVVVQ 153

Query: 530 GPHGQLIIDHLNNL 543
           G     ++ ++++L
Sbjct: 154 GDVLDEVVAYIHSL 167

>SAKL0A01496g Chr1 complement(142658..144517) [1860 bp, 619 aa] {ON}
           some similarities with uniprot|P25364 Saccharomyces
           cerevisiae YCR065W HCM1 Forkhead transcription factor
           involved in cell cycle specific transcription of SPC110
           encoding a spindle pole body (SPB) calmodulin binding
           protein dosage-dependent suppressor of calmodulin
           mutants with specific defects in SPB assembly
          Length = 619

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 7/104 (6%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGV-VYTD 59
           MFK EP  K L+ L  +++++      + T     T P STI++ N  + K++ V   + 
Sbjct: 14  MFKTEPERKPLNELSVNKKRRSSDLADEHT----LTPPRSTIRKANTPNDKTINVHPLSP 69

Query: 60  ENNTPILFKEKHNEQLFPTVY--SCWENPTLLPIILTHGFVIEE 101
           E ++PI   +   +++ P+    S   NP+L+    T+   +EE
Sbjct: 70  ELSSPIQQSKAKKQKVIPSSNDGSNSRNPSLITTRSTNSNTLEE 113

>Kpol_1050.29 s1050 (69445..70065) [621 bp, 206 aa] {ON}
           (69445..70065) [621 nt, 207 aa]
          Length = 206

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 471 RIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDL-RKICSGSTTIGESQTFKSAEVQVQ 529
           ++ I  E +  RK I  +S  EVF+ID + LA     K  +G +    ++  K  E+ +Q
Sbjct: 97  KVVIKREARTKRKFIVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAE--KKDEIVIQ 154

Query: 530 GPHGQLIIDHLNNL----GVPNKWIDFENKLKKKKR 561
           G   + +  ++++L    G+ N  ++  +  KKKK+
Sbjct: 155 GDVLEEVEKYIHSLLEEKGLKNVKLEIIDSQKKKKK 190

>NDAI0C04950 Chr3 (1146017..1146676) [660 bp, 219 aa] {ON} Anc_8.441
          Length = 219

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 12/69 (17%)

Query: 405 DKGKVVMDDLLFNMVNKKKKNLNAA----------RIMPRAQILDPLLANNFTEFYQI-- 452
           DKG +V D+++ NM+  +  N  A           R +P+A+ LD +LA   T   +   
Sbjct: 59  DKGGLVSDEIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLAEQGTPLQRAVE 118

Query: 453 FKNDDSLLF 461
            K DD LL 
Sbjct: 119 LKVDDDLLV 127

>NCAS0D01770 Chr4 complement(331343..331936) [594 bp, 197 aa] {ON}
           Anc_5.144 YJR014W
          Length = 197

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 471 RIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDL-RKICSGSTTIGESQTFKSAEVQVQ 529
           ++ I  E +  RK I  +S  EVF+ID + LA     K  +G +    ++  K  E+ +Q
Sbjct: 97  KVIIKREARTKRKFIIAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAE--KKEEIVIQ 154

Query: 530 GPHGQLIIDHLNNL----GVPNKWID-FENKLKKKK 560
           G   + +  ++++L    G+ +  ++  + K+KKKK
Sbjct: 155 GDVLEAVEAYIHSLLKEKGLKDVKVETIDTKMKKKK 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,822,047
Number of extensions: 2761069
Number of successful extensions: 9353
Number of sequences better than 10.0: 46
Number of HSP's gapped: 9576
Number of HSP's successfully gapped: 46
Length of query: 562
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 447
Effective length of database: 40,294,809
Effective search space: 18011779623
Effective search space used: 18011779623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)