Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3768.268ON28528514400.0
Smik_4.3608.268ON28528513410.0
YDR116C (MRPL1)8.268ON28528512821e-180
Suva_2.2758.268ON28528512491e-175
NCAS0B038108.268ON3142778741e-117
KLLA0F19272g8.268ON2662638541e-115
SAKL0H16896g8.268ON2852738351e-112
ZYRO0C01518g8.268ON2772848321e-111
TDEL0F039508.268ON2762768101e-108
Kpol_392.38.268ON2812728091e-108
KLTH0G13552g8.268ON2812648081e-108
Kwal_56.237758.268ON2812648051e-107
TPHA0J007708.268ON2782707921e-105
NDAI0J013308.268ON3142707441e-97
Ecym_43028.268ON2752817401e-97
CAGL0B01815g8.268ON2902487193e-94
AGR080W8.268ON2752707095e-93
KAFR0B054808.268ON2802666828e-89
KNAG0H032108.268ON2852446802e-88
TBLA0I031908.268ON2412144521e-54
KAFR0H015508.480ON74674702.4
SAKL0E04928g2.392ON336130675.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.376
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   559   0.0  
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   521   0.0  
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   498   e-180
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   485   e-175
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   341   e-117
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   333   e-115
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   326   e-112
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   325   e-111
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   316   e-108
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   316   e-108
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   315   e-108
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   314   e-107
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   309   e-105
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   291   1e-97
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   289   1e-97
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   281   3e-94
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   277   5e-93
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   267   8e-89
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   266   2e-88
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   178   1e-54
KAFR0H01550 Chr8 (286740..288980) [2241 bp, 746 aa] {ON} Anc_8.4...    32   2.4  
SAKL0E04928g Chr5 (399919..400929) [1011 bp, 336 aa] {ON} simila...    30   5.7  

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/285 (96%), Positives = 276/285 (96%)

Query: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60
           MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR
Sbjct: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60

Query: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120
           RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP
Sbjct: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120

Query: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180
           KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA
Sbjct: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240

Query: 241 VLQNIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           VLQNII         VSDQKSKKPNILSKTTLSSTHGPGIVIDFA
Sbjct: 241 VLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/285 (87%), Positives = 267/285 (93%)

Query: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60
           MLSV+A PKIC+ SSTRRCLSHTA KLYAEEYK TAMSSNAPSLTK+QAKKRELKRLAQR
Sbjct: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120
           +AEAKRPAATNPLYMPVT+ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSV FP
Sbjct: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180
           KPLRYIKVA FTNDENKL+ELR+KYPNHLIGGADLV+RIK+GEIPVDFDKA+AT DIVP 
Sbjct: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPS+KKGTVSDDI SLL+ESLGSMPFRQRGNSISLG+GKCYF+DRE
Sbjct: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240

Query: 241 VLQNIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           +LQNII         V++QKSKKPN+LSKTTLSSTHGPGIVIDFA
Sbjct: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  498 bits (1282), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 239/285 (83%), Positives = 257/285 (90%)

Query: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60
           MLSV+A PKICV    RRC  HTA KLYA++YK  AMSSNAPSLTK+QAKKRELKRL QR
Sbjct: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60

Query: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120
           +AEAKRPA  +PLYMPVT ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSV FP
Sbjct: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180
           KPLRYIK+A FTNDE+KL+ELREKYPNHLIGGADLV++IK+GEI VDFDKA+AT DIVPA
Sbjct: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDI+SLLQESLGSMPFRQRGNSIS+G+GKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240

Query: 241 VLQNIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           +LQNII         V +QKSKKPNILSKTTLSSTHGPGIVIDFA
Sbjct: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  485 bits (1249), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 256/285 (89%)

Query: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60
           ML   A PKIC+ S  RR LSHTA +LYAEEYK+ AMSSNAPSLTK+QAKKRELKRLAQR
Sbjct: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120
           RAEAKRPAAT+PL+MPVT+ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAP+SG+V F 
Sbjct: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120

Query: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180
           KPLRY+KVAVFTNDE KLKELREKYPN ++GG DLV++IKN E PVDFDKA+AT DIVP 
Sbjct: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGN+ISLGIGKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240

Query: 241 VLQNIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           +LQNII         V +QK+KKP++LSKTTLSSTHGPGIVIDFA
Sbjct: 241 LLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  341 bits (874), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 161/277 (58%), Positives = 212/277 (76%), Gaps = 4/277 (1%)

Query: 11  CVVSSTRRCLSHTASKLYAEEYKSTAMSSN---APSLTKEQAKKRELKRLAQRRAEAKRP 67
           C  SS  R + H+ S + AEE  ST  S+     P+L+KEQ KKREL+RL+QR+ EAKRP
Sbjct: 38  CTSSSQSRGI-HSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRP 96

Query: 68  AATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIK 127
           A+ +PLYMPV  ALRY+RAAEVGRP  QQTI LT+LVV E+G APL+G ++ P+PL+ +K
Sbjct: 97  ASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALK 156

Query: 128 VAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVAR 187
           VAVF+ +E  L  ++EKY  HL+GG +L+++IKNGE+  DFDKA+A++D+   L +Q+ +
Sbjct: 157 VAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGK 216

Query: 188 ILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIX 247
            LG RG+LP+ KKGTVSDD+ SLL + +GS+PFRQ GN IS+GIGKC+F+D E+L+NII 
Sbjct: 217 TLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIA 276

Query: 248 XXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284
                   +S+QKSKKP+IL KTTLSSTHGPGIVIDF
Sbjct: 277 ARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  333 bits (854), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 154/263 (58%), Positives = 209/263 (79%), Gaps = 3/263 (1%)

Query: 26  KLYAEEYKSTAM---SSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVALR 82
           +++  +++ T+          LTKEQ +KREL+++ QRR +AK PA+ +PLYMPV+ ALR
Sbjct: 4   RIFTRQFQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALR 63

Query: 83  YLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKELR 142
           YLRA EVG+P SQQTI LTTLVV ERG  PL+G+V+F KPL+ +KVAVFTNDE +   ++
Sbjct: 64  YLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMK 123

Query: 143 EKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKGT 202
           +KY  HL+GG+DLVS+IK GE+ +DFDKA+AT DIVP L SQV RILGPRG+LP+ KKGT
Sbjct: 124 DKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGT 183

Query: 203 VSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXXXVSDQKSK 262
           V++D+  L+++S+ S+PFRQRGNSISLG+ K +FTD+EVL+N++         +++Q++K
Sbjct: 184 VAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTK 243

Query: 263 KPNILSKTTLSSTHGPGIVIDFA 285
           KP+ILS+TTL+STHGPGIVIDFA
Sbjct: 244 KPSILSQTTLTSTHGPGIVIDFA 266

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  326 bits (835), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 158/273 (57%), Positives = 220/273 (80%), Gaps = 5/273 (1%)

Query: 13  VSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNP 72
           +S TR  L HT + L +EE      S+ A  L+K+Q K+REL+RL QR+A A++PAA +P
Sbjct: 18  ISCTRTSLFHTFTALKSEEP-----STIATKLSKDQLKRRELRRLVQRKAAARKPAADHP 72

Query: 73  LYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFT 132
           LYMPVT ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   L+G+++FPKPL+ +K+AVFT
Sbjct: 73  LYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFT 132

Query: 133 NDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPR 192
           NDE+KLK  R+++  HL+GG++L+ +IK GE+P+DFDKA+AT DI  +L SQ+ RILGPR
Sbjct: 133 NDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPR 192

Query: 193 GVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXX 252
           G+LP+ KKGTV++DI+SL+++S+G++PFRQRGN IS+ + KC FTD +VL+NI+      
Sbjct: 193 GLLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSF 252

Query: 253 XXXVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
              +++QK+KKP+IL +TTL++THGPG+VIDFA
Sbjct: 253 KLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  325 bits (832), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 155/284 (54%), Positives = 211/284 (74%), Gaps = 8/284 (2%)

Query: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60
           M+ +I + +  ++ ST RCL HTA+ L AEE  S         LTKEQ +KRE++R A+R
Sbjct: 1   MIGLIPSLRSQLLGSTSRCLFHTAALLRAEEAGS--------KLTKEQLRKREVRRAARR 52

Query: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120
           + EAK+PA T+PLYMP  +ALRYLRA EVG P SQQ I +TT VV +RG  P++G+V+ P
Sbjct: 53  KVEAKKPAHTHPLYMPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLP 112

Query: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180
            PL+ + VAVF+NDE +L   R+K+  HL+GG+D++++IK GEIPVDFDKA+AT DI   
Sbjct: 113 SPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQE 172

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240
           L SQVARILGP+ VLP  K+GTV+ D+  L+++S GS+PFRQ+GNSISL + KC F+DR+
Sbjct: 173 LTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQ 232

Query: 241 VLQNIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284
           VL+N++         VS+QK+K+P+IL +TTL++THGPGIVID 
Sbjct: 233 VLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  316 bits (810), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/276 (58%), Positives = 215/276 (77%), Gaps = 6/276 (2%)

Query: 11  CVVSST-RRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAA 69
           C+  S  RR   HT + L AEE      ++N   L+K+Q KKRE++RLAQR+A AK+  +
Sbjct: 6   CIGRSVLRRSFLHTGNVLRAEE-----AAANVSKLSKDQLKKREIRRLAQRKAAAKKSPS 60

Query: 70  TNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVA 129
            +PLYM + +ALR+LRAAEVG+PQ+QQTI LTT VV ERG   L+GSV+FPKPL+ +K+A
Sbjct: 61  DHPLYMSIPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIA 120

Query: 130 VFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARIL 189
           VF+ DE++LK  REK+  HL+GG +++ +IK+GEIPVDFDKA+AT DI PAL SQ+ARIL
Sbjct: 121 VFSGDEDQLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARIL 180

Query: 190 GPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXX 249
           GPRGVLP+VKKGTV+ D++ L+Q+S+GSMPFRQRGN+IS+ +GK  F+DR++L+N I   
Sbjct: 181 GPRGVLPTVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATH 240

Query: 250 XXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
                 +++Q SKK ++L KTTLSSTHGPGIVIDFA
Sbjct: 241 DAVKEALANQVSKKTSLLGKTTLSSTHGPGIVIDFA 276

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  316 bits (809), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 210/272 (77%), Gaps = 2/272 (0%)

Query: 16  TRRCLSHTASKLYAEEYKSTAMSSNAP--SLTKEQAKKRELKRLAQRRAEAKRPAATNPL 73
           +RRC  H+   L AE   ++  +S  P     K++ K+REL+R ++R+A+A++PA++ PL
Sbjct: 10  SRRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPL 69

Query: 74  YMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTN 133
           YMP++ ALRYLRAAEVG+P SQQ I +TT VV ERG   L+G++++  P++ +K+AVF+N
Sbjct: 70  YMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSN 129

Query: 134 DENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRG 193
           D  KL +++E++  HLIGG DLV +IK+G+ PVDFDKA+AT DI P L SQ+AR+LGPRG
Sbjct: 130 DPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRG 189

Query: 194 VLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXX 253
           VLP++KKGTVS+D++SL++ S+G MPFRQ GNSIS+ +G+C F+D+++L+NII       
Sbjct: 190 VLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYN 249

Query: 254 XXVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
             +S QKSKKP++L KTT++STHGPGI IDFA
Sbjct: 250 TTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  315 bits (808), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 209/264 (79%), Gaps = 4/264 (1%)

Query: 22  HTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVAL 81
           H ++ L AEE    A S     L+K+Q KKRE++R AQ++A A+RPA+ +PLYMPV  AL
Sbjct: 22  HVSASLRAEEPVGNATSK----LSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKAL 77

Query: 82  RYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKEL 141
           R+LRAAEVG+PQSQQT+++TT+V+ ERG   LSG+V+FP  L+ +K+AVFTNDE + +  
Sbjct: 78  RFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIA 137

Query: 142 REKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKG 201
           REK+  H++GG++LV +IK G++P+DFDK++AT +I   L SQ+ RILGPRG+LP+ KKG
Sbjct: 138 REKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKG 197

Query: 202 TVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXXXVSDQKS 261
           TVS+++ SL+++S+G++PFRQRGN+IS+ +G+C FTD+++L+NI+         +++QK+
Sbjct: 198 TVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKA 257

Query: 262 KKPNILSKTTLSSTHGPGIVIDFA 285
           KKP++L +TTL+ST GPGIVIDFA
Sbjct: 258 KKPSLLGQTTLTSTRGPGIVIDFA 281

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  314 bits (805), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 144/264 (54%), Positives = 205/264 (77%), Gaps = 4/264 (1%)

Query: 22  HTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVAL 81
           H  S L AEE  S  +S     L+K+Q +KRE+++LAQ++A A+RPA  +PLYMPV  AL
Sbjct: 22  HAFSALRAEETPSPVVSK----LSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKAL 77

Query: 82  RYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKEL 141
           R+LRAAE G+P SQQT+++TT+V+ ERG  PLSG+++FPKPL+ +K+AVFTNDE + +  
Sbjct: 78  RFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIA 137

Query: 142 REKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKG 201
           REK+  HL+GG+DLV +IK G + +DFDK++AT +I   L SQ+ RILGPRG+LP+ KKG
Sbjct: 138 REKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKG 197

Query: 202 TVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXXXVSDQKS 261
           TV++++  LL+ S+G++PFRQRGN +S+ +GKC FTD+++L+NI+         ++ QK+
Sbjct: 198 TVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKT 257

Query: 262 KKPNILSKTTLSSTHGPGIVIDFA 285
           KKP++L +TTL+STHGPGIVIDFA
Sbjct: 258 KKPSLLGQTTLTSTHGPGIVIDFA 281

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  309 bits (792), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 151/270 (55%), Positives = 202/270 (74%), Gaps = 1/270 (0%)

Query: 16  TRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYM 75
           TR+   H +  +  E   +    +    L+K+Q KKREL+R   R+ EAK PA ++PLYM
Sbjct: 10  TRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYM 69

Query: 76  PVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDE 135
            V  ALR+LRAAEVG+P SQQTINLTTLVV E+G+  L+G +AF  PL+ +K+A+FTNDE
Sbjct: 70  QVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDE 129

Query: 136 NKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVL 195
            ++K  +EK+  +++GG++L+S+IKNGEI VDFDKA+AT DIV  L S VARILGPRGV 
Sbjct: 130 TQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVF 188

Query: 196 PSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXXX 255
           PS+KKGTVS+++  L++ +LGS+PFRQ GN IS+ IGKC F+DR++L+N+I         
Sbjct: 189 PSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDS 248

Query: 256 VSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           VS QK+KKP+IL KT LS+THGPGIVIDF+
Sbjct: 249 VSTQKTKKPSILGKTILSTTHGPGIVIDFS 278

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  291 bits (744), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 201/270 (74%), Gaps = 5/270 (1%)

Query: 20  LSHTASKLYAEEYKSTAMSSNAP-----SLTKEQAKKRELKRLAQRRAEAKRPAATNPLY 74
           L+  A+   A E KST   +N P      L+KEQ KKRE++RL+QR+ +A++PA ++PLY
Sbjct: 44  LAAVAATEDASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLY 103

Query: 75  MPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTND 134
           M V  ALR++RAAEVGRP+ QQTI LTTL+V E+GT+ L+G++   +PL+ +K+AVF+ D
Sbjct: 104 MEVVDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTD 163

Query: 135 ENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGV 194
           +  L+E++ ++   L+GG + V  IK+G I  +FD A+AT +IVP + SQ+ + LG RG+
Sbjct: 164 KELLEEVKSQFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGI 223

Query: 195 LPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXX 254
           LP+ KKGTVSDD+ +L+   +G++PF+Q GN+IS+ IGKCYF+D+++L NII        
Sbjct: 224 LPNTKKGTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKE 283

Query: 255 XVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284
            +++QK+K+P+ILSKTTLSSTHGPGIVIDF
Sbjct: 284 ALANQKAKRPSILSKTTLSSTHGPGIVIDF 313

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  289 bits (740), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 142/281 (50%), Positives = 204/281 (72%), Gaps = 13/281 (4%)

Query: 8   PKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPS----LTKEQAKKRELKRLAQRRAE 63
           P+   + + RR L+ T+ +  A         +N+PS    L+KEQ KK+EL+ L Q+RA 
Sbjct: 3   PRCLKLVTVRRGLNFTSVRCAA---------NNSPSSTTKLSKEQMKKKELRALLQKRAA 53

Query: 64  AKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPL 123
           AK+    +PLYMPV  A R+LRAAEVG+P SQQTI+LTT+VV ++G   LSG++ FP PL
Sbjct: 54  AKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPL 113

Query: 124 RYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQS 183
           R +KVAVFTN++ + +  RE++  HL+GG +L+  IKNG+ P+DFDKA AT D+V  L S
Sbjct: 114 RDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTS 173

Query: 184 QVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQ 243
           Q+A +LGPR +LP+VKKGTVS++I +L++E++ ++PFRQRG  +S+ +GKC F+D+++LQ
Sbjct: 174 QLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQ 233

Query: 244 NIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284
           NI+         ++DQ+ KK +IL KTT++STHGPGIVIDF
Sbjct: 234 NIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  281 bits (719), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 191/248 (77%), Gaps = 6/248 (2%)

Query: 43  SLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTT 102
           +LTKEQAKKRE+KRLA ++AEAK+PA  +PLYMP+ +ALRYLR+AEVGRP   QTI +TT
Sbjct: 42  TLTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTT 101

Query: 103 LVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKELREKYPNH--LIGGADLVSRIK 160
           LVV ++G A L+G++ FP PL+ +K+A+F++++ KL EL+ KY     + GG D+++ IK
Sbjct: 102 LVVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIK 161

Query: 161 NGEIPVD-FDKAYATADIVPALQSQVARILGPRGVLPSVKK---GTVSDDITSLLQESLG 216
           +G+I VD  +K +AT +I P + SQ+ R+LGP+G++P++KK    TV +D+ SL++E+LG
Sbjct: 162 SGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLG 221

Query: 217 SMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTH 276
            + FRQRGNS+S+ +G+C F+DR++L+NII         VS Q +KKP+IL KTT+S+T 
Sbjct: 222 QVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTA 281

Query: 277 GPGIVIDF 284
           GPGIVIDF
Sbjct: 282 GPGIVIDF 289

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  277 bits (709), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 145/270 (53%), Positives = 202/270 (74%), Gaps = 6/270 (2%)

Query: 15  STRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLY 74
           S RR L  TA +L  E   + A SS    L+K+Q KKREL+RLAQR+A A+RPA+ +PLY
Sbjct: 10  SFRRGLHLTAVQLSQE---AAATSSK---LSKDQLKKRELRRLAQRKAAARRPASASPLY 63

Query: 75  MPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTND 134
           MPV  ALR+LRAAEVG+P +QQTI++ T+V+G++G A LSG+V  P P+R  KVAVFTND
Sbjct: 64  MPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTND 123

Query: 135 ENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGV 194
             + +  R KY  +L+GGA+LV ++K+GE+ VDFDKA+AT DI P + +++ R+LGP+G+
Sbjct: 124 PEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGL 183

Query: 195 LPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXX 254
           LPSVKKGTV+ D++ LL + + S PF+QR N ISL IGKC+F+DR++++N++        
Sbjct: 184 LPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRA 243

Query: 255 XVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284
            ++ QK+KK ++   TTL+STHGPGIVIDF
Sbjct: 244 AMTSQKTKKTSLFGTTTLTSTHGPGIVIDF 273

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  267 bits (682), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 187/266 (70%), Gaps = 8/266 (3%)

Query: 21  SHTASKLYAEEYKSTAMSSNAPSLT-KEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTV 79
           S   S+L+ EE      +S APS T K+QAKK+ L+   + R +A+ PA+ +PLYM V  
Sbjct: 20  SLQTSRLWLEE------ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPD 73

Query: 80  ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLK 139
           ALR+LRA EVG+P+SQQTI LTTLV+ E+G  P+ G+V  P PLR  KV V ++D  KL+
Sbjct: 74  ALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLE 133

Query: 140 ELREKYPN-HLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSV 198
           E+++ + N HL+GG +LV + KN +I +DFDK  AT DI+      + ++ GP+G+LP+V
Sbjct: 134 EVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNV 193

Query: 199 KKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXXXXXXXVSD 258
           KKGTVS+++  L+ E++ SMPFRQR   ISLGIGK  F+D+++L+NII         +S+
Sbjct: 194 KKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSN 253

Query: 259 QKSKKPNILSKTTLSSTHGPGIVIDF 284
           QK+KK + L KTTL+STHGPGIVIDF
Sbjct: 254 QKTKKQSTLGKTTLTSTHGPGIVIDF 279

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  266 bits (680), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 178/244 (72%)

Query: 42  PSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLT 101
           P LTKEQ ++REL+++ + +  AKRPA+ + +Y+ V  A+R LRA EVG+P SQQTI LT
Sbjct: 42  PKLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLT 101

Query: 102 TLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKN 161
           T+VV E+G  PL G V  P PL+ +++A F+ D   LK L+E+    ++GGA+L+ ++K+
Sbjct: 102 TMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKS 161

Query: 162 GEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFR 221
           GE+PV FDKA+AT DI P L S++  +LG RG+LP++KKGTV  D+ ++++  +G+MPFR
Sbjct: 162 GEVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFR 221

Query: 222 QRGNSISLGIGKCYFTDREVLQNIIXXXXXXXXXVSDQKSKKPNILSKTTLSSTHGPGIV 281
           QR  +++ GI KC+F+DR+VL N+I         + +QKSKK +IL ++TLSSTHGPGIV
Sbjct: 222 QRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIV 281

Query: 282 IDFA 285
           ID A
Sbjct: 282 IDLA 285

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  178 bits (452), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 136/214 (63%), Gaps = 2/214 (0%)

Query: 71  NPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAV 130
           +PL M V +ALRYLRA E GR  S+QT+ L T+V   RG  PL G + F   +R   +AV
Sbjct: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88

Query: 131 FTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILG 190
           FT D  + K  +E   + +IGG++L+ +I +GE  + F  A+AT D+V  L ++VA+ LG
Sbjct: 89  FTEDPEQHKIAKEMGID-IIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146

Query: 191 PRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIXXXX 250
            + VLP +KK TV D+I  LLQ+ L  +PF ++ + IS  +GKC FTD E+L+N+I    
Sbjct: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206

Query: 251 XXXXXVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284
                + +Q +KKP+ + K TL+STHGPGI ID 
Sbjct: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>KAFR0H01550 Chr8 (286740..288980) [2241 bp, 746 aa] {ON} Anc_8.480
           YPL029W
          Length = 746

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 167 DFDKAYATADIVPALQSQVARILGPRGVLPSVKKGT--VSDDITSLLQESLGSMPFRQR- 223
           D D+ +A ++ +  ++++   + G + VLP +KK T    D +T    E LG +    R 
Sbjct: 324 DEDRGWAWSNALLGVKAKEIHLCGEKSVLPVIKKITALTGDKLTINEYERLGELSVESRS 383

Query: 224 ---GNSISLGIGKC 234
              GN  +L  G C
Sbjct: 384 LKNGNMRNLRKGDC 397

>SAKL0E04928g Chr5 (399919..400929) [1011 bp, 336 aa] {ON} similar
           to uniprot|P32419 Saccharomyces cerevisiae YDL078C MDH3
           Cytoplasmic malate dehydrogenase catalyzes
           interconversion of malate and oxaloacetate involved in
           the glyoxylate cycle
          Length = 336

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 20/130 (15%)

Query: 51  KRELKRLAQRRAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTT--LVVGER 108
           K+ + ++ Q   EA+    +NP+   V +A+  L+  ++G+ Q+ + + +TT  LV  E 
Sbjct: 98  KQLISQVGQYAPEARILIISNPVNSTVPIAVETLK--QLGKFQAGKVMGVTTLDLVRAET 155

Query: 109 GTAPLSGSVAFPKPLRYIKVAV-----------FTNDENKLKELR-----EKYPNHLIGG 152
             A + GS  + K     KV V              D+  L+ LR     E+Y   +  G
Sbjct: 156 FLAEVLGSSHYSKEKMKGKVTVVGGHSGNTIVPLVRDKKYLRHLRDKHAWERYVKRVQFG 215

Query: 153 ADLVSRIKNG 162
            D V + K+G
Sbjct: 216 GDEVVKAKDG 225

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,177,052
Number of extensions: 1087623
Number of successful extensions: 3932
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4011
Number of HSP's successfully gapped: 31
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)