Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3758.267ON1051054453e-58
Suva_2.2748.267ON1051053975e-51
Smik_4.3598.267ON1051053812e-48
YDR115W8.267ON1051053648e-46
KAFR0B054908.267ON85772316e-26
ZYRO0C01540g8.267ON97692292e-25
Kpol_543.428.267ON112682275e-25
TPHA0A017708.267ON104612241e-24
KLTH0G13574g8.267ON112552242e-24
NCAS0B038208.267ON115762223e-24
NDAI0J013408.267ON141522243e-24
Kwal_56.237768.267ON130552201e-23
Ecym_43038.267ON109612153e-23
SAKL0H16918g8.267ON111522154e-23
TBLA0E044708.267ON94522082e-22
TDEL0F039408.267ON110662093e-22
CAGL0B01793g8.267ON98502041e-21
AGR081C8.267ON130522043e-21
KNAG0H032208.267ON86491994e-21
KLLA0F19250g8.267ON116521981e-20
Skud_7.5735.86ON28655641.6
TDEL0A019302.419ON63532605.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.375
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...   176   3e-58
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...   157   5e-51
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...   151   2e-48
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...   144   8e-46
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    94   6e-26
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    93   2e-25
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    92   5e-25
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    91   1e-24
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    91   2e-24
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    90   3e-24
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    91   3e-24
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    89   1e-23
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    87   3e-23
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    87   4e-23
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    85   2e-22
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    85   3e-22
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    83   1e-21
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    83   3e-21
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    81   4e-21
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    81   1e-20
Skud_7.573 Chr7 complement(943947..944807) [861 bp, 286 aa] {ON}...    29   1.6  
TDEL0A01930 Chr1 complement(352916..354823) [1908 bp, 635 aa] {O...    28   5.4  

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  176 bits (445), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 92/105 (87%), Positives = 92/105 (87%)

Query: 1   MTLLTSLYQLQSKRMXXXXXXXXXXXXXRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60
           MTLLTSLYQLQSKRM             RPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK
Sbjct: 1   MTLLTSLYQLQSKRMLSSISSFSALSVLRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  157 bits (397), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 85/105 (80%)

Query: 1   MTLLTSLYQLQSKRMXXXXXXXXXXXXXRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60
           M+L   LYQ QS+RM             RPQ+SMLLNS P+KTMSLT  GFGFIGQRRWK
Sbjct: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  151 bits (381), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 85/105 (80%)

Query: 1   MTLLTSLYQLQSKRMXXXXXXXXXXXXXRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60
           MTL   LYQLQS+RM             RPQ+SM++NS P+KTMSLT  GFGFI QRRWK
Sbjct: 1   MTLFARLYQLQSRRMISSISSFSALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score =  144 bits (364), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 80/105 (76%)

Query: 1   MTLLTSLYQLQSKRMXXXXXXXXXXXXXRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60
           M L   L Q QS+RM             RPQ+ MLLNS P+KT S T LGFG IGQRRWK
Sbjct: 1   MPLFARLCQPQSRRMFSSISSFSALSVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 93.6 bits (231), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 2/77 (2%)

Query: 31  QSSMLLNSPPMKTMSLTALGF--GFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQG 88
           +++ +  S  + T+  T + F   F GQ+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ 
Sbjct: 9   RNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQK 68

Query: 89  SKILKRRKLKGRWFLSH 105
           SKILK RK KGRW+LSH
Sbjct: 69  SKILKDRKEKGRWYLSH 85

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (82%), Gaps = 1/69 (1%)

Query: 38  SPPMKTMSLTALGFGF-IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRK 96
           SP  + +  + L  GF +GQRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+RRK
Sbjct: 29  SPLQRLLGPSPLSSGFGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRK 88

Query: 97  LKGRWFLSH 105
            KGRWFL+H
Sbjct: 89  HKGRWFLTH 97

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 92.0 bits (227), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 1/68 (1%)

Query: 39  PPMKTMSLTALGFGFIG-QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKL 97
           P   T +  +   G +G QRRWKSRGNTYQPSTLKRKR FGFLARA+S+ GSKIL+RRK 
Sbjct: 45  PGTATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKA 104

Query: 98  KGRWFLSH 105
           KGRW+LSH
Sbjct: 105 KGRWYLSH 112

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 90.9 bits (224), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (81%)

Query: 45  SLTALGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLS 104
           S+  L      QRRWKSRGNTYQPSTLKRKR  GFLARA+SKQG+KIL+RRK KGRW+L+
Sbjct: 44  SILGLNLDLGLQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLT 103

Query: 105 H 105
           H
Sbjct: 104 H 104

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 90.9 bits (224), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 51  FGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           FGF  QRRWKSRGNTYQPSTLKRKR  GFLARAKSKQG K+LKRR+ KGRW+L+H
Sbjct: 59  FGFT-QRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 90.1 bits (222), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 4/76 (5%)

Query: 30  PQSSMLLNSPPMKTMSLTALGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89
           P  S +L+  PM     + L FG + QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 44  PMGSNVLSQSPMMG---SLLPFGIL-QRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99

Query: 90  KILKRRKLKGRWFLSH 105
           KILKRR+LKGRW+L+H
Sbjct: 100 KILKRRRLKGRWYLTH 115

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 90.9 bits (224), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 47/52 (90%)

Query: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           I Q+RWKSRGNTYQPSTLKRKR +GFL+R + +Q SKILKRRKLKGRWFLSH
Sbjct: 90  INQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 89.4 bits (220), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 51  FGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           FG + Q+RWKSRGNTYQPSTLKRKR  GFLAR KSKQGSKILKRR+ KGRW+L+H
Sbjct: 77  FG-LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 87.4 bits (215), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 1/61 (1%)

Query: 45  SLTALGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLS 104
           S+ +L FG + QRRWKSRGNT+QPSTLKRKR  GFLARA+SK G KILKRRK KGRW+L+
Sbjct: 50  SVISLVFG-LNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLT 108

Query: 105 H 105
           +
Sbjct: 109 Y 109

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 87.4 bits (215), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 46/52 (88%)

Query: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + QRRWKSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 84.7 bits (208), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 44/52 (84%)

Query: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           I  RRWKSRGNTYQPSTLKRKR  GFL+RAKS   +KILKRRK KGRWFLSH
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 85.1 bits (209), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 44/66 (66%), Positives = 55/66 (83%), Gaps = 2/66 (3%)

Query: 40  PMKTMSLTALGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKG 99
           P+ ++SL    FG I QRRWKSRGNT+QPSTLKRKR  GFLARA+SK GS++L+RRK KG
Sbjct: 47  PLSSISLL-FPFG-IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKG 104

Query: 100 RWFLSH 105
           RW+L++
Sbjct: 105 RWYLTY 110

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 83.2 bits (204), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%)

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 83.2 bits (204), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (86%)

Query: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L+H
Sbjct: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 81.3 bits (199), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 43/49 (87%)

Query: 57  RRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRRK KGRW+LSH
Sbjct: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 80.9 bits (198), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%)

Query: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 65  LTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>Skud_7.573 Chr7 complement(943947..944807) [861 bp, 286 aa] {ON}
           YGR239C (REAL)
          Length = 286

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 30  PQ-SSMLLNSPPMKTMSLTALGFGFIGQRRWKSRGNTYQ-PSTLKRKRTFGFLAR 82
           PQ SSM +N P   T     L F F  Q+R  S G+ Y   S++ RK T  F  R
Sbjct: 91  PQFSSMNINDPLEFTSEYKKLYFEFESQQRQNSSGHHYPIASSIVRKTTSNFQPR 145

>TDEL0A01930 Chr1 complement(352916..354823) [1908 bp, 635 aa] {ON}
           Anc_2.419 YNL008C
          Length = 635

 Score = 27.7 bits (60), Expect = 5.4,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 43  TMSLTALGFGFIGQRRWKSRGNTYQPSTLKRK 74
           T SL   GF F  +R+W+ +G   Q S   RK
Sbjct: 408 TWSLLVAGFTFFVKRKWQIKGPKDQESQASRK 439

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.132    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,498,443
Number of extensions: 266045
Number of successful extensions: 573
Number of sequences better than 10.0: 23
Number of HSP's gapped: 573
Number of HSP's successfully gapped: 23
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)