Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3748.265ON37335516960.0
Smik_4.3588.265ON37135412781e-176
Suva_2.2738.265ON37633912481e-172
YDR113C (PDS1)8.265ON37335512451e-171
TDEL0F039208.265ON3222973963e-44
NCAS0B038308.265ON3253553021e-30
SAKL0H16962g8.265ON3363452853e-28
ZYRO0C01584g8.265ON2823002534e-24
Kpol_543.418.265ON3063102193e-19
TPHA0A017808.265ON3523541957e-16
NDAI0J013508.265ON4223691895e-15
KLTH0G13618g8.265ON3023031629e-12
KLLA0F19206g8.265ON2632371547e-11
Ecym_43058.265ON3112981503e-10
AGR083W8.265ON2952961451e-09
KNAG0H032308.265ON2812941414e-09
KAFR0B055108.265ON2752281157e-06
Kwal_56.237818.265ON2933021122e-05
CAGL0L12298g8.265ON286288998e-04
NOTE: 1 genes in the same pillar as Skud_4.374 were not hit in these BLAST results
LIST: TBLA0E04460

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.374
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...   657   0.0  
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...   496   e-176
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   485   e-172
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...   484   e-171
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...   157   3e-44
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...   120   1e-30
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...   114   3e-28
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...   102   4e-24
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    89   3e-19
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    80   7e-16
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    77   5e-15
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    67   9e-12
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    64   7e-11
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    62   3e-10
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    60   1e-09
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    59   4e-09
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    49   7e-06
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    48   2e-05
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    43   8e-04

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/355 (92%), Positives = 328/355 (92%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180
           LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180

Query: 181 AKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240
           AKNQ              KLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT
Sbjct: 181 AKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240

Query: 241 TKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLED 300
           TKGKQGSK             APQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLED
Sbjct: 241 TKGKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLED 300

Query: 301 HGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACAAPPLLSKRLKEGTASPTIN 355
           HGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACAAPPLLSKRLKEGTASPTIN
Sbjct: 301 HGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACAAPPLLSKRLKEGTASPTIN 355

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score =  496 bits (1278), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 251/354 (70%), Positives = 281/354 (79%), Gaps = 2/354 (0%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           MPANEDKENNIVY+GN SS +NFPQTPAHLLKRSHSNVLKPP RLDQLKKD+NSNN   L
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNR+KSF+F+ E +N SKD++ IPQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180
           LSIRKNDQLR+LSQISRNR R N+++LLNN+RKLQKYGSVLGYNALPKMKSLVLKDL  P
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180

Query: 181 AKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240
            KN+              KL  KLQNA LQQHSSDDEHE +GDIGLFNNQGGLQQLIKN+
Sbjct: 181 GKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240

Query: 241 TKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLED 300
            + +  SK             APQR +PLPYVPDGY  F++EDI+KL++FNSPYELDLED
Sbjct: 241 VQNE--SKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLED 298

Query: 301 HGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACAAPPLLSKRLKEGTASPTI 354
            G S D+V LL LE I+EE+EQD   H  GD E     PLLSK L++ TA PTI
Sbjct: 299 DGGSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTI 352

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  485 bits (1248), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 249/339 (73%), Positives = 272/339 (80%), Gaps = 5/339 (1%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           MPANEDKENNIVYTGNESS  +FPQTPAHLLKRSHSNVLKPPVRLDQLKKD+NSN+GK L
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
           KYIQGGKEVSPTKRLHTH Q QGRLPLAAKDNNRSKSFVF  ET N +KD+E +PQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180
           LS RKNDQLR+LSQ+SRNR R NYN +LNNSRKLQKYGSVLGYNALPKMKSLVLKDLA P
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180

Query: 181 AKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240
           AKNQ              KL  KLQ+AF QQHSS+DEHE +G IGLFNNQGGLQQLIKNT
Sbjct: 181 AKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240

Query: 241 TKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLE- 299
            KGK+G               APQRQEPLPYVPDGYP FQ+EDI KL+TFNSPY LDLE 
Sbjct: 241 AKGKEGP--GKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEG 298

Query: 300 --DHGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACA 336
             ++ +S D+VGLLSL  ++EE E+D T HT GD +  A
Sbjct: 299 NSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPA 337

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score =  484 bits (1245), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/355 (71%), Positives = 284/355 (80%), Gaps = 3/355 (0%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSN+LKPPVRLDQLK+D NSNNG  L
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSF+F  ET+N SKD++ +PQ QNT
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIF-PETSNQSKDAD-LPQLQNT 119

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180
           LSIRKNDQLR+LSQISR+R+RAN+N+LL+NSRKLQKYGSVLGYNALPKMKSLVLKDLA  
Sbjct: 120 LSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADS 179

Query: 181 AKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240
            KN+              KLG KLQ+A L+Q SSD E+E NG +GLFN QGGLQQLIKN+
Sbjct: 180 GKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNS 239

Query: 241 TKGKQGSKXXXXXXXXX-XXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLE 299
           TK +Q +K              APQRQEPLPYVP+GY  FQ++DIEKL+TFNSPY+LDLE
Sbjct: 240 TKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLE 299

Query: 300 DHGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACAAPPLLSKRLKEGTASPTI 354
           D  D+ D+V LL LE IDEE E+D T   T + E  AA PLLSK  KE  A PT+
Sbjct: 300 DEDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTM 354

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score =  157 bits (396), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 148/297 (49%), Gaps = 51/297 (17%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           MP NE+KEN++V    ES G++FPQTPAHLLKRS S ++KP              N   L
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPS----------GEENPSNL 50

Query: 61  KYIQGG---KEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQ 117
            Y       K  SP++R+     QQGR PLA+KDNNRS  F+   +        +     
Sbjct: 51  TYRDCDAPVKRASPSRRV-----QQGRPPLASKDNNRSTGFLPQLQKLQQQPSLK----- 100

Query: 118 QNTLSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDL 177
                       R LSQ  +        +LL N R+L+KYGSVLGYNALPKMKSLVLKD+
Sbjct: 101 ------------RNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKDV 148

Query: 178 AGPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLI 237
               +                 L +KL NA      SD+E E  G  GLF ++ GL  L+
Sbjct: 149 DQVGEQGEDENDDEDEDHI---LRLKLHNAI---DRSDEEGEEVG--GLF-DKSGLLHLV 199

Query: 238 KNTTKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPY 294
           ++       SK              PQR EPLPY+P+G+ S  +ED +KL+TF SPY
Sbjct: 200 RD-------SKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPY 249

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score =  120 bits (302), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 124/355 (34%), Positives = 160/355 (45%), Gaps = 107/355 (30%)

Query: 1   MPANEDKENNIVYTGNESSGIN---FPQTPAHLL-KRSHSNVLKPPVRLDQLKKDLNSNN 56
           +  NEDKEN   Y  +  S       P+TPAHLL KRS S VLKP          +N+ +
Sbjct: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP--------NSVNATD 54

Query: 57  GKGLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQ 116
             G         +SP +R     Q Q RLPLA KDNN S                     
Sbjct: 55  ELG--------NISPRRR--QLLQLQNRLPLAKKDNNNS--------------------- 83

Query: 117 QQNTLSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKD 176
              + S RKN                     LNN +KL+KYGSVLG +ALP+ KSL+LKD
Sbjct: 84  ---SFSSRKNG--------------------LNNIKKLKKYGSVLGMDALPRTKSLILKD 120

Query: 177 LAGPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNG----DIGLFNNQ-- 230
           +     +                 G+KL+NA  Q  ++ +E E+ G     IGLF++   
Sbjct: 121 VDDKPDDDEEDEDDNA-------FGLKLRNAMKQHENNSNEEENEGMSGLGIGLFHDNED 173

Query: 231 ------GGLQQLIKNTTKGKQGSKXXX-------XXXXXXXXXXAPQRQEPLPYVPDGYP 277
                 GGLQQLI+  TK +  SK                    AP R+EPLP+VP GY 
Sbjct: 174 NSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYT 233

Query: 278 SFQREDIEKLRTFNSPYELD-----LEDHGDSVDRVGLLSLEVI----DEEAEQD 323
            F  EDI KL+TF+S Y+LD     +ED     D+  LL+LE I    D+EAE +
Sbjct: 234 PFTPEDINKLKTFHSSYKLDSPVSTVED----ADK--LLALETIETSVDDEAEWE 282

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score =  114 bits (285), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 111/345 (32%), Positives = 156/345 (45%), Gaps = 84/345 (24%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           M  +E+KEN I       S  N P TP+HLLKRS S  +KP          L SN     
Sbjct: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQS-FMKP----------LASN----- 38

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
                    SPTK+         RLPLA+KDNN+S + +   + + L             
Sbjct: 39  ---------SPTKK------SGKRLPLASKDNNKSNTLINNGQKSAL------------- 70

Query: 121 LSIRKNDQLRQLSQISRNR-TRANYNELLNNS-----------RKLQKYGSVLGYNALPK 168
           +++  N+ L    ++ RNR   +N    +N +            +L+KYGSVLGYN LP+
Sbjct: 71  VNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPR 130

Query: 169 MKSLVLKD-----LAGPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGD 223
           +KSLVLKD     +    + +               L  KL  A L  H+ DD+ E  G 
Sbjct: 131 VKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKA-LNNHNEDDKEE--GS 187

Query: 224 IGLFNNQGGLQQLIK--NTTKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQR 281
           IGL  +  GLQQL+K  N  +G+                  P   E LP+VP+GY  F+ 
Sbjct: 188 IGLLGSNTGLQQLLKHRNVEEGENSD---------FEIEIVPPHSEELPHVPNGYSPFKE 238

Query: 282 EDIEKLRTFNSPYELDLEDHG--DSVDRVGLLSLEVI-DEEAEQD 323
            D+ KL TF SP+ +  ED    +  D  GLL++ ++  E+ EQD
Sbjct: 239 SDVIKLNTFTSPFSMHKEDSDCEECDDYDGLLTISMVKSEDEEQD 283

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score =  102 bits (253), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 133/300 (44%), Gaps = 94/300 (31%)

Query: 5   EDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGLKYIQ 64
           ++KENN+V    E+  +  PQTP HLLKRS  NVLKP         + N+        ++
Sbjct: 7   DNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP---------EENT-------PVK 50

Query: 65  GGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIR 124
             + VSP +        Q RLPLA+KD+N+S +             +  + ++Q TL   
Sbjct: 51  KSRSVSPVR-------GQRRLPLASKDHNKSSA-------------AGPVKKRQPTLQ-- 88

Query: 125 KNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGPAKNQ 184
                                ELL+N RKLQKYGSVLGY  LP+ KSLVLKD        
Sbjct: 89  --------------------GELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD-------- 120

Query: 185 XXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGK 244
                         +L  KLQ+A  ++  S++        GL    GGL +L+++T    
Sbjct: 121 -GDDEDDDEEEENSELQKKLQDAMNRREDSNE--------GL----GGLAKLVRDTKDDI 167

Query: 245 QGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLEDHGDS 304
           +                AP R  PL Y PDG+  ++ EDI KL+  +     D +DH D+
Sbjct: 168 E---------------YAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDN 212

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 89.0 bits (219), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 97/310 (31%), Positives = 139/310 (44%), Gaps = 63/310 (20%)

Query: 4   NEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGLKYI 63
           +++KENNI      +   + PQTP +LLKR+HS  LK  +  D                I
Sbjct: 2   DQNKENNIFR---HAMLKDMPQTPNNLLKRTHSK-LKTGIAKD----------------I 41

Query: 64  QGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSI 123
           QGG  ++ +         Q RLPLA+KDNNRS SF+  S        +       N ++ 
Sbjct: 42  QGGNVINTS--------PQKRLPLASKDNNRSNSFLNNSNVNLNFNINNNNNNNNNNINN 93

Query: 124 RKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGPAKN 183
               +     Q        N + +L + RKL+KYGSVLGYNALPK+KSLVLKD++    +
Sbjct: 94  NNIKKQHIFQQ--------NKSGILADDRKLKKYGSVLGYNALPKVKSLVLKDISDNEDD 145

Query: 184 QXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKG 243
                          K              S + ++SN  IGL +  G LQQLI++  + 
Sbjct: 146 DDDLLSLKLRDSMNKK--------------SINTNKSNSGIGLLSG-GNLQQLIRDANED 190

Query: 244 KQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLEDHGD 303
            +                 P ++    Y+PD +  F   DI KL+TFNSP++L+  +  D
Sbjct: 191 VR--------EIEHKSNAFPDKE----YIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDD 238

Query: 304 SVDRVGLLSL 313
             D   LL L
Sbjct: 239 EEDSSELLLL 248

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 105/354 (29%), Positives = 139/354 (39%), Gaps = 102/354 (28%)

Query: 1   MPANEDKENNIVYTGNES-------SGINFPQTPA-HLLKRSHSNVLKPPVRLDQLKKDL 52
           +  N DKEN+I Y  N+        S    PQTP   LLKR+HS  L   V         
Sbjct: 7   LNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAV--------- 57

Query: 53  NSNNGKGLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RSKSFVFVSETTNLSK 109
                         K+   +K  + +  +  RLPLA+KDNN   RS SF+          
Sbjct: 58  -------------FKDAQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFIL--------- 95

Query: 110 DSEAIPQQQNTLSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPK- 168
                  Q N L + K     QLS ++ N+T          S KL+KYGS+LG N     
Sbjct: 96  -------QNNKLVLNK-----QLSLLNNNQT----------SNKLRKYGSILGVNNNGNN 133

Query: 169 -------MKSLVLKDLAGPAKNQXXXXXXXXXXXXXXKLGVK-------------LQNAF 208
                  +KSL+LKD+  P                   L +K             L+NA 
Sbjct: 134 TNKTLNPVKSLILKDI--PDNGNENDDDDDDDDDNIITLNLKNALQSKKEPLLNQLKNAK 191

Query: 209 LQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGKQGSKXXXXXXXXXXXXXAPQRQEP 268
              +S  +E E    IGLF    GLQ+LI  +   K   +              P     
Sbjct: 192 KNSYSDSEEEE----IGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPD---- 243

Query: 269 LPYVPDGYPSFQREDIEKLRTFNSPY------ELDLEDHGDSVDRVGLLSLEVI 316
           L Y P+GY  F  EDI+KL TF SPY      +  L DH ++ +  GLL LE +
Sbjct: 244 LSYSPEGYIPFNNEDIKKLNTFKSPYSNLNVNDSLLADHNNN-NNSGLLELENV 296

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 107/369 (28%), Positives = 163/369 (44%), Gaps = 58/369 (15%)

Query: 4   NEDKENNIVYTGNES---SG--INFPQTPAHLLKRSHSNVL---KPPVRLDQLKKDLNSN 55
           +EDKEN   +  +     SG  I FPQTPAHLLKRS S++L   KP ++   L+  L S+
Sbjct: 13  DEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRS-SSILSKQKPDIKPGNLELQLQSD 71

Query: 56  NGKGLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIP 115
            G G         +SP ++L    Q Q R PL+ KDNN S    F+ +      D + + 
Sbjct: 72  AGAGAV----PPNISPRRQL---LQLQNRFPLSKKDNNNS----FILKQQQQQFDHKRLK 120

Query: 116 QQQNTLSI-----RKNDQLRQLSQISRN-RTRANYNELLNNSRKLQKYGSVLGYNALPKM 169
           +  + L +       N+  R  S + ++     N     +NS      GS L Y+A+P +
Sbjct: 121 KYGSVLGLGTDGNNHNNLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGS-LNYSAIPNL 179

Query: 170 KSLVLKDLAGPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNN 229
              +  D     +                  G+KL++A    ++++    S+G   LF++
Sbjct: 180 DFNI--DTIQERRKGSDDDSEDDDTGADDLFGLKLKHAMNNNNNNN---NSDGSGLLFHD 234

Query: 230 QG-GLQQLIKNTTKG-----------KQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYP 277
              GL QLI    K            K  +K             AP R++ LPY+P GY 
Sbjct: 235 SNHGLHQLINFNKKNMPEKNSISQSVKLDNKKEDTYDEEDDIEYAPIREDSLPYIPQGYT 294

Query: 278 SFQREDIEKLRTFNSPYEL--DLEDHGDSVDRVG----LLSLEVIDEEAEQDGTAHTTGD 331
            F  EDI KL+ ++SP+ +  D  D+  S   +G    LLSL+  D +     TA T+  
Sbjct: 295 PFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLSLQSFDTQ-----TATTSS- 348

Query: 332 PEACAAPPL 340
             +CA+P L
Sbjct: 349 --SCASPSL 355

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 109/303 (35%), Gaps = 88/303 (29%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           M  +EDKEN+I       S  N P TP HLL RS S +                      
Sbjct: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
                 K  SP +        + R PLA+KDNNRS S++   E                 
Sbjct: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLGTKEPL--------------- 64

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNE---LLNNSRKLQKYGSVLGYNALPKMKSLVLKD- 176
                           R RTR   N     + N+R        L  +  PK+KSLVLKD 
Sbjct: 65  ----------------RKRTRPGVNHAGSFVGNAR--LGPAPTLNASGAPKIKSLVLKDG 106

Query: 177 LAGPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQL 236
           +                     +L  KL+   L    S D        GL    GGLQ L
Sbjct: 107 IEEEGSQSEGAEVDEDDDDDSNRLAAKLRTKLL----SRDRDAEGEQTGLLGATGGLQSL 162

Query: 237 IKNTTKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFN-SPYE 295
           +     G + S+              P R EPLP+VP+GY  F  ++I KL+  + SP++
Sbjct: 163 L-----GPKLSQRAEESDSDQEVEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQ 217

Query: 296 LDL 298
           L+ 
Sbjct: 218 LNF 220

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 92/237 (38%), Gaps = 59/237 (24%)

Query: 84  RLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRKNDQLRQLSQISRNRTRAN 143
           R PLA+KDNNR++S + V     L K     P ++   S  KN        +  N     
Sbjct: 39  RRPLASKDNNRTQSILSVKNNAALGKSDH--PLKRPASSFMKN--------MPEN----- 83

Query: 144 YNELLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLAGPAKNQXXXXXXXXXXXXXXKLGV 202
                    KL+KYGSVLG N  +P+ KSLVLKD     KN                 G 
Sbjct: 84  ---------KLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLPIFPSGK 134

Query: 203 KLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGKQGSKXXXXXXXXXXXXXA 262
            L   F                       GL+ LI+                       A
Sbjct: 135 SLNLGF---------------------GNGLKALIR-------------EKEDELNIEYA 160

Query: 263 PQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLEDHGDSVDRVGLLSLEVIDEE 319
           P+RQ+ LPY+P+GY  F +E IEKL+   SP++++            L+SL   DE+
Sbjct: 161 PKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDED 217

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 112/298 (37%), Gaps = 73/298 (24%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           M  +EDKEN  + TG+E SG   P+TP H LKRS SNV                      
Sbjct: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
                            H +   RLPLA+KD NRS+S   + +          +   QN 
Sbjct: 37  -----------------HLKNNSRLPLASKDRNRSQSGFNLKQQLVQGHVGGGVMVGQN- 78

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNN--SRKLQKYGSVLGYNA--LPKMKSLVLKD 176
                               R   N  + N    KL+KYGSVLG N   L K KSLVLKD
Sbjct: 79  -----------------KSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKD 121

Query: 177 LAGPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQL 236
            A                     L  KL++        +DE+E +G  GL    G  + +
Sbjct: 122 -ASDGSQDNGEESDDYDDEEGNPLAAKLRSRLTS--GVEDENEDDGSSGLLLGGGLKKLI 178

Query: 237 IKNTTKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPY 294
                  K                 AP++   L ++P+GY  F+ E+I KL T+ SP+
Sbjct: 179 -------KLHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF 229

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 113/296 (38%), Gaps = 83/296 (28%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           M  +EDKEN +   G    G   P+TP H LKRS SN+                      
Sbjct: 1   MKKHEDKENLVTSAGR---GAMMPRTPIHQLKRSSSNL---------------------- 35

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
                              +   R+PLA+KD N+S+  VF  +T+       A  Q +  
Sbjct: 36  -----------------AGRNSTRMPLASKDRNQSQG-VFGLKTSGAGGAGGAQAQSKRP 77

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLG--YNALPKMKSLVLKDLA 178
            S          S I++N   +          KL+KYGSVLG  Y +L K KSLVLKD  
Sbjct: 78  AS----------SSIAKNMPDS----------KLKKYGSVLGVGYGSLAKAKSLVLKD-- 115

Query: 179 GPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIK 238
               +                L  KL++      + +  +E +G  GL   +  L QL  
Sbjct: 116 ---TSDCESANEESEEEEGNPLAAKLKSRLCS--AEEGGNEDDGSSGLLLGE-ALSQL-- 167

Query: 239 NTTKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPY 294
                   +              AP++   LP+VP+GY S +  D+ KL  ++SP+
Sbjct: 168 --------AAAGETQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 111/294 (37%), Gaps = 96/294 (32%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           M  NEDKEN           +  PQTPA  +      VLKP                +G 
Sbjct: 1   MQDNEDKEN----------AVAVPQTPASNILDGSGVVLKPV-------------GSRGK 37

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
           +     K  SPT+         GRLPLA+KDNN S   V                     
Sbjct: 38  QSFSVRK--SPTR--------GGRLPLASKDNNASGLVV------------------SGK 69

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYN--ALPKMKSLVLKDLA 178
           L  +  DQ+R+                 N+SRKL++YGS+LGY+   L + KSL+LKD  
Sbjct: 70  LGRQPADQVREA----------------NSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113

Query: 179 GPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQ--GGLQQL 236
            P ++                  + L     +  S  D+   + DI    +Q  GGL +L
Sbjct: 114 APNESSKSVTKR-----------LLLDEEIAKNSSDGDDDGDDTDILKIRSQLGGGLDRL 162

Query: 237 IKNTTKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTF 290
           ++ +                      PQ Q+ LPY+PDG+      DI KLR +
Sbjct: 163 VRQSQN--------------RELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 85/228 (37%), Gaps = 79/228 (34%)

Query: 69  VSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRKNDQ 128
           +SP KRL    QQQG+LPL +K+ N+S S +   +                         
Sbjct: 36  ISPLKRL----QQQGKLPLQSKNGNKSNSILISHKG------------------------ 67

Query: 129 LRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYN-----ALPKMKSLVLKDLAGPAKN 183
                               NN+R ++KYGS+LG        LPK KSL+LKD       
Sbjct: 68  --------------------NNTR-IKKYGSILGLENPGNFKLPKTKSLILKD------- 99

Query: 184 QXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKG 243
                           L  KL+ A L +  +D++ E +G +GLF  +   Q  I N    
Sbjct: 100 ----NESSESEEEDGLLNRKLKEA-LSRSQNDEDREGDGSVGLFAKEA-FQNHISNDDDS 153

Query: 244 KQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFN 291
           +                   ++   L Y+PD Y     ++IEKL+  N
Sbjct: 154 E------------IDIINGKEKDVELSYIPDHYEVIAADEIEKLKQVN 189

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 103/302 (34%), Gaps = 89/302 (29%)

Query: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60
           M A E+KEN I       S  + P TP HLL RS S +                      
Sbjct: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120
                 K +SP +     A+Q  R PLA+KDNN+S  F+   E                 
Sbjct: 33  ------KNISPKR-----AEQ--RKPLASKDNNKSTGFLGAKEPL--------------- 64

Query: 121 LSIRKNDQLRQLSQISRNRTRANYNE---LLNNSRKLQKYGSVLGYNALPKMKSLVLKDL 177
                           R RTR   N     + N+R       +L  N  P++KSLVLKD 
Sbjct: 65  ----------------RKRTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKDD 106

Query: 178 AGPAKNQXXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLI 237
               + Q               L  KL+     +   D   +          QG     +
Sbjct: 107 I--EEEQSQSDGGEAEDDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANTKL 164

Query: 238 KNTTKGKQGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLR-TFNSPYEL 296
            + T                     P R EPLP++P GY  F  EDI KL+ T  SP++L
Sbjct: 165 HSET---------LDSDSDLEVEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQL 215

Query: 297 DL 298
           + 
Sbjct: 216 NF 217

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 105/288 (36%), Gaps = 101/288 (35%)

Query: 6   DKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGLKYIQG 65
           DKENN+V T  E      P TP  LLKR+ S +L                          
Sbjct: 7   DKENNVVGTLREKG----PATPTQLLKRTRSTLL-------------------------- 36

Query: 66  GKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRK 125
                P K    + Q+Q   PLA+KD N ++S  +                    LS+++
Sbjct: 37  -----PKK----NGQRQ---PLASKDKNYNRSSSY--------------------LSLKR 64

Query: 126 NDQLRQLS-QISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGPAKNQ 184
           N   ++L   ++R  + AN                    NA  ++ SL+LKD+A   + +
Sbjct: 65  NSNQKKLKPAVTRAGSTAN--------------------NANRRVTSLILKDIASGDEKE 104

Query: 185 XXXXXXXXXXXXXXKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGK 244
                          L +K++ A     +S     + G  GL N + GL+++  +    +
Sbjct: 105 SASESDSEDDEESNPLALKIKQALTHSIAS-----AEGKTGLLNGKSGLRKIFNDRDLDR 159

Query: 245 QGSKXXXXXXXXXXXXXAPQRQEPLPYVPDGYPSFQREDIEKLRTFNS 292
           +                A  R+   PY P+GY      D+EKL+  N+
Sbjct: 160 E-------------IEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNA 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,350,461
Number of extensions: 1748044
Number of successful extensions: 4929
Number of sequences better than 10.0: 67
Number of HSP's gapped: 5054
Number of HSP's successfully gapped: 76
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)