Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.373singletonON1861869181e-127
YDR112W (IRC2)singletonOFF102812572e-28
AFR517C8.50ON871145710.84
Ecym_30316.27ON32865681.6
KLLA0E07085g3.25ON45255672.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.373
         (186 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W (...   358   e-127
YDR112W Chr4 (679544..679852) [309 bp, 102 aa] {OFF}  IRC2Dubiou...   103   2e-28
AFR517C Chr6 complement(1361712..1364281,1364349..1364394) [2616...    32   0.84 
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...    31   1.6  
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    30   2.8  

>Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W
           (REAL)
          Length = 186

 Score =  358 bits (918), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/186 (94%), Positives = 176/186 (94%)

Query: 1   MFALIISSKGNKPGXXXXXXXXXXALVGIEPLTAYSALVTLPFKSFLVILAAGLKSKSLA 60
           MFALIISSKGNKPG          ALVGIEPLTAYSALVTLPFKSFLVILAAGLKSKSLA
Sbjct: 1   MFALIISSKGNKPGFFFSSSFSSSALVGIEPLTAYSALVTLPFKSFLVILAAGLKSKSLA 60

Query: 61  INTLFKSCWCVIVMCSYYYVLPLCKYKVTVVAFSLDSYIFFAFTINSPRGERKYWGIYEM 120
           INTLFKSCWCVIVMCSYYYVLPLCKYKVTVVAFSLDSYIFFAFTINSPRGERKYWGIYEM
Sbjct: 61  INTLFKSCWCVIVMCSYYYVLPLCKYKVTVVAFSLDSYIFFAFTINSPRGERKYWGIYEM 120

Query: 121 AKGYYHSPNGQRKTEKKIANFKQTLSIYRQTKVFKRLYVLKKPGKDAFTCIETAREPQMH 180
           AKGYYHSPNGQRKTEKKIANFKQTLSIYRQTKVFKRLYVLKKPGKDAFTCIETAREPQMH
Sbjct: 121 AKGYYHSPNGQRKTEKKIANFKQTLSIYRQTKVFKRLYVLKKPGKDAFTCIETAREPQMH 180

Query: 181 IASTRK 186
           IASTRK
Sbjct: 181 IASTRK 186

>YDR112W Chr4 (679544..679852) [309 bp, 102 aa] {OFF}  IRC2Dubious
          open reading frame, unlikely to encode a protein, based
          on available experimental and comparative sequence
          data; partially overlaps YDR111C; null mutant displays
          increased levels of spontaneous Rad52p foci
          Length = 102

 Score =  103 bits (257), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 61/81 (75%)

Query: 1  MFALIISSKGNKPGXXXXXXXXXXALVGIEPLTAYSALVTLPFKSFLVILAAGLKSKSLA 60
          MFALIISSKG   G          ALVGI PLTAYSALVT  FKSFLVIL AGLKSKS A
Sbjct: 1  MFALIISSKGKTSGFFFNSSFSSSALVGIAPLTAYSALVTPVFKSFLVILPAGLKSKSFA 60

Query: 61 INTLFKSCWCVIVMCSYYYVL 81
          +NT FKSCWCVIVMCSY++ +
Sbjct: 61 VNTPFKSCWCVIVMCSYFFCV 81

>AFR517C Chr6 complement(1361712..1364281,1364349..1364394) [2616
           bp, 871 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YLR054C (OSW2); 1-intron
          Length = 871

 Score = 32.0 bits (71), Expect = 0.84,   Method: Composition-based stats.
 Identities = 38/145 (26%), Positives = 60/145 (41%), Gaps = 39/145 (26%)

Query: 44  KSFLVILAAGLKSKSLAINT--LFKSCW--CVIVMCSYYYV---------LP---LCKYK 87
           + F +I+ + +  K L I    +FK C    VI++ S + V          P   L K+K
Sbjct: 79  RKFDIIVMSAISMKELQITCELIFKFCHNKTVIIVDSNFAVELDHFIVSQFPSDDLLKHK 138

Query: 88  VTVVA----------------FSLDSYIF-FAFTINSPRGERKYWGIYEMAKGYYHSPNG 130
            TVVA                 + DSY + F  +  + + E KYW   E+ K  +  PN 
Sbjct: 139 PTVVAMICDAEVRMVSATSYYLASDSYKYVFGLSYKTNQAELKYWQNLELVKEQFKDPN- 197

Query: 131 QRKTEKKIANFKQTLSIYRQTKVFK 155
                 K+  F Q LS  + +++ K
Sbjct: 198 -----SKLNKFLQQLSSDKVSRLIK 217

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 61  INTLFKSCWCVIVMCSYYYVLPLCKYKVTVVAFSLDSYIFFAFTINSPRGERKYWGIYEM 120
           I+T F   +  +VM   Y+ L    Y V++V   LD YI     I++      Y+G Y  
Sbjct: 127 IDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLD-YIGIVILISTSMFSLLYYGFYNS 185

Query: 121 AKGYY 125
           +K +Y
Sbjct: 186 SKMFY 190

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 127 SPNGQRKTEKKIANFKQTLSIYRQTKVFKRLYVLKKPGKDAFTCIETAREPQMHI 181
            PN +  T KK  + ++T+ I   +  + RLY LKK G++  + IE       HI
Sbjct: 2   DPNTEGTTTKKYTSQRRTIDI---SASYDRLYFLKKHGQENSSYIEAETSYNAHI 53

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,003,318
Number of extensions: 653657
Number of successful extensions: 1848
Number of sequences better than 10.0: 7
Number of HSP's gapped: 1874
Number of HSP's successfully gapped: 7
Length of query: 186
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 83
Effective length of database: 41,670,801
Effective search space: 3458676483
Effective search space used: 3458676483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)