Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3728.263ON50750726380.0
YDR111C (ALT2)8.263ON50750723520.0
Smik_4.3578.263ON50750723220.0
Suva_2.2718.263ON50750722960.0
NDAI0B019908.263ON58850517690.0
TDEL0F039008.263ON55948917630.0
NCAS0B050208.263ON56848917580.0
KNAG0G020408.263ON59149017210.0
KLLA0F19162g8.263ON52848717130.0
SAKL0H17006g8.263ON53148917090.0
YLR089C (ALT1)8.263ON59248917120.0
KNAG0M012108.263ON52149117030.0
Suva_10.1738.263ON59248917060.0
Skud_12.1578.263ON59248917060.0
ZYRO0C01628g8.263ON53448616990.0
Smik_12.1488.263ON59248916900.0
KAFR0B05520singletonON51049016600.0
CAGL0L12254g8.263ON57449116590.0
NCAS0B038408.263ON49748916490.0
Kpol_392.58.263ON51248616480.0
KAFR0B055308.263ON51449016280.0
KAFR0B027308.263ON53948916080.0
KLTH0G13662g8.263ON51951516000.0
Kwal_56.237918.263ON51849515900.0
TPHA0A018008.263ON49849115760.0
NDAI0J013608.263ON50149515710.0
Ecym_43078.263ON53449115690.0
Kpol_543.398.263ON49249115600.0
TBLA0E044408.263ON56248515440.0
TPHA0J007508.263ON52249215240.0
AGR085W8.263ON52148814980.0
TBLA0F030608.263ON50049414830.0
TBLA0G01630singletonON50049714660.0
CAGL0J05126g1.321ON4332571152e-05
Kwal_34.160181.472ON3791071124e-05
TDEL0D019001.321ON4432561124e-05
Kwal_14.25741.321ON443681107e-05
KLTH0G09614g2.252ON3892331081e-04
KNAG0B053201.321ON433811081e-04
AEL170C1.321ON4582621072e-04
TPHA0O014501.321ON443701062e-04
Kpol_1039.222.252ON3862471035e-04
YJL060W (BNA3)1.321ON444701035e-04
KAFR0A017101.321ON4352551028e-04
Smik_10.1801.321ON444591028e-04
Suva_6.1361.321ON444701019e-04
Kpol_480.11.472ON3802891010.001
KNAG0E018502.252ON3841861000.001
Skud_10.1561.321ON46070990.002
KLLA0F01617g1.321ON44470990.002
KNAG0G005501.472ON387103960.004
KLTH0H10648g1.321ON44372960.004
NCAS0G040501.472ON384103950.004
SAKL0F02156g3.511ON49891950.005
ZYRO0G20636g1.321ON45374950.005
NDAI0G057601.321ON44850950.006
Kpol_1035.231.321ON444256940.006
ZYRO0A01672g2.252ON386264930.008
SAKL0D11528g1.472ON38391920.012
NCAS0A092001.321ON44576920.013
TPHA0F012602.252ON392161910.014
SAKL0D06886g1.321ON44768910.014
Kwal_23.48882.252ON389288900.019
KLLA0F03509g2.252ON387158900.020
TBLA0B009902.102ON54644900.023
KLLA0F10021g3.511ON497292880.035
Ecym_6319singletonON35468870.047
KLTH0G19646g1.472ON37990860.055
KLTH0G19624gsingletonON46852860.060
TDEL0C040902.252ON383145860.061
Kwal_47.189823.511ON49691840.12
Smik_5.3198.204ON44363830.13
KNAG0B006603.511ON49659830.15
KAFR0J015802.252ON383157820.17
Ecym_32902.252ON386165820.17
Skud_9.552.252ON385221820.19
SAKL0E08492g2.252ON384275810.22
Suva_9.782.252ON386239810.25
KLTH0G02002g3.511ON49691810.28
CAGL0C01243g2.252ON383156800.29
KLTH0B00176g8.204ON44852800.30
Ecym_55428.204ON446110800.31
TDEL0D057903.511ON49759800.32
NDAI0B037302.252ON386156800.33
Kpol_278.23.511ON49884800.37
YIL116W (HIS5)2.252ON385251790.39
CAGL0G01254g3.511ON50459800.39
AGR141C8.204ON43892790.40
ABL038W2.475ON443131790.41
TPHA0D033703.511ON49759780.57
Ecym_62921.321ON43068780.60
NCAS0B064402.252ON385155770.66
Smik_9.532.252ON388259770.67
ADL249W2.252ON387148770.74
TDEL0A016008.204ON47567761.0
Smik_9.1547.213ON656130761.2
Kwal_47.17462na 1ON492192741.8
KLTH0E07678gna 1ON492179741.8
KLLA0A04906gna 1ON48059741.9
Kwal_8.5858.204ON44650741.9
YGL202W (ARO8)3.511ON50059741.9
TPHA0D016202.268ON744107742.0
KLLA0E00969g8.204ON445131732.0
ZYRO0B11088g8.204ON45033732.2
TDEL0E010304.267ON105249723.1
KLLA0F03377g2.246ON476132723.2
Suva_5.2818.204ON45033723.4
KLTH0H06666g6.112ON67679723.4
NCAS0E006703.511ON49779723.5
KLTH0D03322g1.265ON65051723.7
YER152C8.204ON44333705.2
NDAI0I028303.511ON50059706.1
KAFR0D014203.511ON49267696.2
Kpol_1032.398.204ON45348697.4
TBLA0B080808.204ON44474688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.372
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...  1020   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   910   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   899   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   889   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   686   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   683   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   681   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   667   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   664   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   662   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   664   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   660   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   661   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   661   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   659   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   655   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   644   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   643   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   639   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   639   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            631   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   624   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   620   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   617   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   611   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   609   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   608   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   605   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   599   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   591   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   581   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   575   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              569   0.0  
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    49   2e-05
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    48   4e-05
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    48   4e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    47   7e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    46   1e-04
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    46   1e-04
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    46   2e-04
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    45   2e-04
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    44   5e-04
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    44   5e-04
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    44   8e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    44   8e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    44   9e-04
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    44   0.001
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    43   0.001
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    43   0.002
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    43   0.002
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       42   0.004
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    42   0.004
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    41   0.004
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    41   0.005
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    41   0.005
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    41   0.006
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    41   0.006
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    40   0.008
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    40   0.012
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    40   0.013
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    40   0.014
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    40   0.014
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    39   0.019
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    39   0.020
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    39   0.023
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    39   0.035
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    38   0.047
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    38   0.055
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    38   0.060
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    38   0.061
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    37   0.12 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    37   0.13 
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    37   0.15 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    36   0.17 
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    36   0.17 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    36   0.19 
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    36   0.22 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    36   0.25 
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    36   0.28 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    35   0.29 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    35   0.30 
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    35   0.31 
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    35   0.32 
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    35   0.33 
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    35   0.37 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    35   0.39 
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    35   0.39 
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    35   0.40 
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    35   0.41 
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    35   0.57 
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    35   0.60 
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    34   0.66 
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    34   0.67 
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    34   0.74 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    34   1.0  
Smik_9.154 Chr9 complement(257229..259199) [1971 bp, 656 aa] {ON...    34   1.2  
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    33   1.8  
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    33   1.8  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    33   1.9  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    33   1.9  
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    33   1.9  
TPHA0D01620 Chr4 complement(337644..339878) [2235 bp, 744 aa] {O...    33   2.0  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    33   2.0  
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    33   2.2  
TDEL0E01030 Chr5 (210699..213857) [3159 bp, 1052 aa] {ON} Anc_4....    32   3.1  
KLLA0F03377g Chr6 complement(317185..318615) [1431 bp, 476 aa] {...    32   3.2  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    32   3.4  
KLTH0H06666g Chr8 (586283..588313) [2031 bp, 676 aa] {ON} simila...    32   3.4  
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     32   3.5  
KLTH0D03322g Chr4 complement(314732..316684) [1953 bp, 650 aa] {...    32   3.7  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    32   5.2  
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    32   6.1  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    31   6.2  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    31   7.4  
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    31   8.9  

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/507 (96%), Positives = 491/507 (96%)

Query: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60
           MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN
Sbjct: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60

Query: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120
           PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK
Sbjct: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120

Query: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXX 180
           RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIY            
Sbjct: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240
               CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE
Sbjct: 181 LSLLCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240

Query: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300
           KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK
Sbjct: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300

Query: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS
Sbjct: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420
           ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN
Sbjct: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420

Query: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480
           PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR
Sbjct: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480

Query: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507
           TTFLAPGTQWIQNWKNFHQSFFNEYRD
Sbjct: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/507 (85%), Positives = 460/507 (90%)

Query: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60
           MTMTHQQDLK VF AKDLDFKPA KITKKDLN  VTKAEYAVRG+IPTRADELKEELKKN
Sbjct: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60

Query: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120
           P +LPFDDIINANIGNPQQLDQKPLTFTRQVL+ILEYPEIL+V H +LASLNLFS+DAL+
Sbjct: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120

Query: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXX 180
           RAE LL DIGGS+GAYSHSQGVPGIRQTVADFIT RDGGEPATPEDIY            
Sbjct: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240
               CKD++TGLLIPIPQYPLYTASASLFNAQVLPYYLDEE NWST SDEIEKVVQDAL+
Sbjct: 181 LSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240

Query: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300
           K IRPSVLIVINPGNPTGAVL+EETIARICLIAAKYGI +ISDEVYQEN+FND KFHSMK
Sbjct: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300

Query: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           KVLRKLQH YPGKFDNVQLASLHSISKGFM ECGQRGGYMEI+GFSQ+IRDALFKLMSIS
Sbjct: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360

Query: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420
           ICSVVTGQA+VDLMV PPQPGDESYEQD  ER KIF+EMRTRANLLYETF  LEGIECQ 
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420

Query: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480
           PQGAMYLFPRL+LP KA  ESERLG+EPDEFYC SLLESTGICTVPGSGFGQ+PGTYHVR
Sbjct: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480

Query: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507
           TTFLAPGT+WIQ+WK FHQ FF++YR+
Sbjct: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/507 (84%), Positives = 459/507 (90%)

Query: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60
           M MTHQQDLKSVF  KDL+FKPAAKITKKDLN  VTKAEYAVRG+IPTRADELKEELK+ 
Sbjct: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60

Query: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120
           PG+LPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEIL+V  +KLASLNLF KDAL 
Sbjct: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120

Query: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXX 180
           RAE LL+DIGGS+GAYSHSQGVPGIRQ+VA+FIT RD GEPA PE+IY            
Sbjct: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSL 180

Query: 181 XXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240
               CKD +TGLLIPIPQYPLYTASASLFNAQVLPYYLDE  NWST+SDEIEKVV+DALE
Sbjct: 181 LSLLCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240

Query: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300
           KGI+PSVLIVINPGNPTGAVL+E+TIA+ICLIAAKYGIA+ISDEVYQENVFN  KFHSMK
Sbjct: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300

Query: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           KVLRKLQ  YPGKFDNVQLASLHSISKGFMGECGQRGGYME+VGFS+DIRDALFKLMSIS
Sbjct: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420
           ICSVVTGQA+VDLMV PPQPGDESY+QD  ER KIF+EM TRA LL+ETFN LEGIECQ 
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420

Query: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480
           PQGAMYLFPRL+LP+KA RESERLG+EPDEFYC SLLESTGICTVPGSGFGQ+PGTYHVR
Sbjct: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480

Query: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507
           TTFLAPGTQWIQ+WK+FHQ FFN+YRD
Sbjct: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/507 (82%), Positives = 456/507 (89%)

Query: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60
           MTMT Q+DLKSVF  KDLDFKPAAK+TKKDLN SVTKAEYAVRG+IPTRA+ELKEELK++
Sbjct: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60

Query: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120
              LPF+ IINANIGNPQQLDQKPLTFTRQVLSILEYPEIL+VDH+KLASLNLF+KDALK
Sbjct: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120

Query: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXX 180
           RA+ LL DIGGSVGAYSHSQGVPGIRQTVADFIT RDGGEPA PEDIY            
Sbjct: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240
               CKD++TGLL+PIPQYPLYTASASL+NAQVLPYYLDEE +WSTESDEIE+VV DAL+
Sbjct: 181 LSLLCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240

Query: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300
           KGIRPSVL+VINPGNPTGAVLTE TIA+ICLIAAKYGI +ISDEVYQEN+F D KFHSMK
Sbjct: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300

Query: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360
           K+LRKLQ+ +PGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS
Sbjct: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420
           ICSV TGQAI+DLMV PPQPGDESY+QDR+ER KI+NEM TRANLLYETFN LEGI+CQ 
Sbjct: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420

Query: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480
           PQGAMYLFP+L LP+KA RESERL +EPD  YC SLLESTGICTVPGSGFGQK GTYHVR
Sbjct: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480

Query: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507
           TTFL PGTQWIQ+W+ FHQ FFN+YRD
Sbjct: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/505 (64%), Positives = 396/505 (78%)

Query: 3   MTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPG 62
           MT      S+ +AK  DF PA ++T  DLN +V KA+YAVRGSIP RA+ELK +L+ NP 
Sbjct: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143

Query: 63  LLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRA 122
            LPF  I+NANIGNPQQL QKPL+F RQVLSIL+YP+IL+ + + L    ++ +DA+ RA
Sbjct: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203

Query: 123 ECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXX 182
           + LL +IGGSVGAYS SQGV GIR+TVA+FIT RDGGEPA PEDI+              
Sbjct: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263

Query: 183 XXCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKG 242
             C+  +TG+LIPIPQYPLYTA+ +L N+  LPYYLDE+  WST   EIE+VVQDA+E+ 
Sbjct: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323

Query: 243 IRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKV 302
           I PSVL+VINPGNPTGAVLTEE+I  I  IAAKYGI VI+DEVYQEN+ +  KF+SMKKV
Sbjct: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383

Query: 303 LRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISIC 362
           LRKLQ  +PGKFDNVQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C
Sbjct: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443

Query: 363 SVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQ 422
            VVTGQA+VDLMV+PP+ GD SYEQD+ ER  I +E+  RA+ LYETF GLEGIECQ PQ
Sbjct: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503

Query: 423 GAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTT 482
           GAMYLFP+L LP KA +E++ L + PDEFYC SLL++TGICTVPGSGFGQ+PGTYH+RTT
Sbjct: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563

Query: 483 FLAPGTQWIQNWKNFHQSFFNEYRD 507
           FLAPGT+WI+ W+ FH+ F++ YRD
Sbjct: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/489 (64%), Positives = 391/489 (79%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           DF PA  +T +DLN +V KA+YAVRGSIP RA+EL+E+LK++P  LPFD I+NANIGNPQ
Sbjct: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           QL+QKPL+F RQVLSIL+YPE+L+   E+L S  +F +DA++RA+ +L+D+GGSVGAYS 
Sbjct: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR+TVADFIT RD GEPA PEDI+                C+   TG+LIPIPQ
Sbjct: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+ VLPYYLDEE  WST + EIE VV +++E GIRPSVL+VINPGNPTG
Sbjct: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           +VL+ E I +I  +AAKYGI VI+DEVYQEN+F   +FHSMKKVLR+LQ  +PG +DNVQ
Sbjct: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           L SLHS SKG  GECGQRGGYME+ GF+ +IR  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
           +PGDESYEQDR+ER  I  E+  RA LL++TFN LEGIECQ P+GAMYLFP++ LP KA 
Sbjct: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
           + ++ L   PDEFYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W++FH
Sbjct: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550

Query: 499 QSFFNEYRD 507
           + F+++YRD
Sbjct: 551 KKFYDQYRD 559

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/489 (66%), Positives = 388/489 (79%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           +F PA ++T  +LN +V KA+YAVRG+IP RA+ELK +L+++P  LPFD I+NANIGNPQ
Sbjct: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           QL+QKPL+F RQVLS+L+YPEIL+ D  KL +  LF KDAL+RA+ LL +IGG+VGAYS 
Sbjct: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR+TVA+FIT RD GEPA PEDI+                CK   TG+LIPIPQ
Sbjct: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTAS +L N+  LPYYLDE+  WST   EIE+VV  A +K IRPSVL+VINPGNPTG
Sbjct: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           AVL+E++I  I  IAAKYGI VI+DEVYQENVFN+ KFHSMKKVLR LQ  +PG +D VQ
Sbjct: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           LASLHS SKG  GECGQRGGYME+ GF+ ++R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
           + GDES+EQD+ ER  I +E+ TRA  LY+ FN LEGIECQ PQGAMYLFPRL LP KA 
Sbjct: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
           ++++ L + PDEFYC SLLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ WK FH
Sbjct: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559

Query: 499 QSFFNEYRD 507
           Q F+N YRD
Sbjct: 560 QDFYNTYRD 568

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/490 (64%), Positives = 388/490 (79%), Gaps = 2/490 (0%)

Query: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79
           F PAA++   DLN +V KA+YAVRGSIP RA++L+ +L+++P  LPFD IINANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 80  LDQKPLTFTRQVLSILEYPEILQVDHEK-LASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           L+QKPL+F RQVLS+L++PE+L    E   A+ +L+  DA++RAE LL+DIGGSVGAYS 
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR+TVADFIT RD  EPA PEDI+                CK  +TG+LIPIPQ
Sbjct: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+  LPYYLDE+  WST + EI+ VV DA+++ I+PSVL+VINPGNPTG
Sbjct: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFN-DFKFHSMKKVLRKLQHCYPGKFDNV 317
           AVL+E+ IA I  IAAKYGI VI+DEVYQEN+F+ D KFHSMKKVLRKLQ  +PGKFD V
Sbjct: 342 AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 318 QLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNP 377
           QLASLHS SKG  GECGQRGG+ME+ GFS +IR  + KL SIS+C VVTGQA+VDLMV+P
Sbjct: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 378 PQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKA 437
           PQ G+ESYE D+ ERS I +E+  RAN L+ETFN LEGI+CQ PQGAMYLFPRL LP KA
Sbjct: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 438 FRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNF 497
            ++++ + +  DEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI  W+ F
Sbjct: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 498 HQSFFNEYRD 507
           H+ F+N+YRD
Sbjct: 582 HKEFYNKYRD 591

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/487 (64%), Positives = 390/487 (80%), Gaps = 2/487 (0%)

Query: 21  KPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQL 80
           KPA K++  D+N +V KA+YAVRG IP RA+EL+++LKK+P  LPF  II+ANIGNPQQL
Sbjct: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103

Query: 81  DQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHSQ 140
           DQKPLTF R+VLS+L++PE+L+   E L +L  +  D++KRA+ LL ++GGSVGAYS SQ
Sbjct: 104 DQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQSQ 161

Query: 141 GVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYP 200
           GV GIR+TVADFIT RD GE + PEDIY                CK   TG+LIPIPQYP
Sbjct: 162 GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 221

Query: 201 LYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAV 260
           LYTAS +L N++ LPYYL EE NWST+ +EIE+VV DA++KGI+P+ L+VINPGNPTGA+
Sbjct: 222 LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 281

Query: 261 LTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLA 320
           L+E++I +I  +AAKYGI VI+DEVYQENVF   KF+SMKKVLR LQ  Y G++DN+QLA
Sbjct: 282 LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 341

Query: 321 SLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQP 380
           SLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C VVTGQA+VDLMV+PPQP
Sbjct: 342 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 401

Query: 381 GDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRE 440
           GDESYEQD+QER  I + +  RA+ L+ETF+ LEGIEC+ PQGAMYL+P+L LP K  +E
Sbjct: 402 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 461

Query: 441 SERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQS 500
           ++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL PGT+W++ W+ FH++
Sbjct: 462 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 521

Query: 501 FFNEYRD 507
           FF++YRD
Sbjct: 522 FFDKYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/489 (64%), Positives = 385/489 (78%), Gaps = 3/489 (0%)

Query: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79
           F+PA K++ +DLN +V +A+YAVRG IP +A+ELK +L ++P  LPFD IINANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 80  LDQKPLTFTRQVLSILEYPEILQ-VDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           LDQKPLTF RQVLS+L+ P++L+ +  E+L+   ++  DA+ RA  LL +IGGSVGAYSH
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS--QIYKPDAIDRAARLLSNIGGSVGAYSH 162

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV G R+TVADFIT RDGGE A  EDI+                C+  +TG+LIPIPQ
Sbjct: 163 SQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQ 222

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTAS +L N+  LPYYLDEE NWST  +EIEKVV +++ KG+ P  L+VINPGNPTG
Sbjct: 223 YPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTG 282

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           A+L+ E+I +I  +AAKYGI VI+DEVYQENVFN  +FHSM+KVL+ LQ  + GKFDN+Q
Sbjct: 283 AILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQ 342

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           LASLHS SKG  GECGQRGGYME++GFS D+R    KL SIS+C VVTGQA+VDLMV PP
Sbjct: 343 LASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPP 402

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
           +PGD SYEQD++ERS+I + +  RA++LYETFN LEGIECQ PQGAMYLFPRL L  KA 
Sbjct: 403 KPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAV 462

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
           +++E L + PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT WI+ W+ FH
Sbjct: 463 QKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFH 522

Query: 499 QSFFNEYRD 507
           + F+NEYRD
Sbjct: 523 KKFYNEYRD 531

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 385/489 (78%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           +F PA ++T +D+N +V KA+YAVRG+IP RA+ELK +L+K+P  LPFD IINANIGNPQ
Sbjct: 104 EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L++DIGGSVGAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR++VA+FIT RD GE + PEDI+                C+   TG+LIPIPQ
Sbjct: 224 SQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE   WST  +EIE VV++A++  I+P+VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           AVL+ E+IA+I  +AAKYG  VI+DEVYQEN+F   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQ 403

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
             G+ES+E D+ ER+ I  ++ TRA  LYETFN LEGIECQ PQGAMYLFP++ LP KA 
Sbjct: 464 VEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
           +E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W++FH
Sbjct: 524 QEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFH 583

Query: 499 QSFFNEYRD 507
           + FF++YRD
Sbjct: 584 KEFFDQYRD 592

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/491 (62%), Positives = 392/491 (79%), Gaps = 2/491 (0%)

Query: 18  LDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNP 77
           L F+PA K+   DLN ++  AEYAVRG+IP +A+EL+ +L + P LLPF+ I  ANIGNP
Sbjct: 32  LAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNP 91

Query: 78  QQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYS 137
           QQLDQKPLTF+RQV+SIL+YP +L  + E+L +   + +DA KRA  LL+ IGGSVGAYS
Sbjct: 92  QQLDQKPLTFSRQVVSILQYPPLLDYE-EQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYS 150

Query: 138 HSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIP 197
            +QGV GIR++VADFIT RD GE A+P+DI+                C+D+ TG++IPIP
Sbjct: 151 LAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIP 210

Query: 198 QYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPT 257
           QYPLYTAS +++N+ +LPYYLDEE  WST+++EIE+ V D++++G+ P V++VINPGNPT
Sbjct: 211 QYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPT 270

Query: 258 GAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYP-GKFDN 316
           GAVL+ +TIA+I  IAAKYGI V++DEVYQ N++   KFHSMKKVLR LQ  +P G++DN
Sbjct: 271 GAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDN 330

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376
           VQLAS+HS SKG  GECGQRGGYME+VGFS ++R  + KL SISICSVVTGQA+VDLM+N
Sbjct: 331 VQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLN 390

Query: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436
           PP+ GD+SYE D +ER +I N M+TR  LLY+TF  LEGIECQ PQGAMYLFP+L+L  K
Sbjct: 391 PPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKK 450

Query: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496
           A  E++ LG++PDEFYC  LL++TGICTVPGSGFGQK GTYHVRTTFLAPGTQWI++W+ 
Sbjct: 451 AIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWET 510

Query: 497 FHQSFFNEYRD 507
           FH++F+++YRD
Sbjct: 511 FHKAFYDKYRD 521

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 383/489 (78%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           +F PA ++T  D+N +V KA YAVRG+IP RA+ELK +L+K+P  LPF+ IINANIGNPQ
Sbjct: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L+KDIGGSVGAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR++VADFIT RDGGE A PEDI+                C+   TG+LIPIPQ
Sbjct: 224 SQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE   WST  +EIE VV++A++  I+P+VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           AVL+ E+IA+I  +AAKYG  VI+DEVYQEN+F   +F+SMKKVLR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQ 403

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
             G+ES+E D+ ER+ I  ++ TRA  LYETFN LEGIECQ PQGAMYLFP++ +P KA 
Sbjct: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
           +E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +W++ W+ FH
Sbjct: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583

Query: 499 QSFFNEYRD 507
           + FF++YRD
Sbjct: 584 KEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 386/489 (78%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           DF PA ++T +D+N +V KA+YAVRG+IP RA+ELK +L+K+P  LPFD IINANIGNPQ
Sbjct: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L++DIGGSVGAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR++VA+FIT RD GE + PEDI+                C+   TG+LIPIPQ
Sbjct: 224 SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE+  WST  +EIE VV++A++  I+P+VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           AVL+ E++++I  +AAKYG  VI+DEVYQEN+F   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 403

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
             G+ES+E D+ ER+ I  ++ TRA  LY+TFN LEGIECQ PQGAMYLFP++ LP KA 
Sbjct: 464 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
           +E+  L + PDEFYC SLLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 524 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 583

Query: 499 QSFFNEYRD 507
           + FF++YRD
Sbjct: 584 KEFFDQYRD 592

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/486 (64%), Positives = 374/486 (76%)

Query: 22  PAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQLD 81
           PA K+   ++N +V KA+YAVRG+IP  A EL  +LKK+P  LPFD+I++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 82  QKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHSQG 141
           QKPLTF RQVLS+L+YP +L+ + + L    L+ KDA+ RA  LL DIG SVGAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 142 VPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYPL 201
           + GIR+TVA FIT RDGGE A  EDI+                CK   TG+LIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 202 YTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVL 261
           YTAS +L N+  LPYYLDE+  WST   EIE VV +A+E+ I+PSVL+VINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 262 TEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLAS 321
           +EE I++I  IAAKYGI VI+DEVYQENVF+  +FHSMKK+LRKLQ   PG FDNVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPG 381
           LHS SKG  GECGQRGGYMEI GF+ DIR  + KL SIS+C VVTGQA+VDLMV+PP+PG
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 382 DESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRES 441
           DESYE D+QER  I   +  RA  L+ TFN LEGIECQ P+GAMYLFPRL+LP KA + +
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 442 ERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQSF 501
           E  G+ PD FYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W+NFH++F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 502 FNEYRD 507
           + EYRD
Sbjct: 529 YEEYRD 534

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/489 (62%), Positives = 381/489 (77%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           +F PA ++T  D+N +V KA+YAVRG+IP RA+ELK +L+K+P  LPF+ IINANIGNPQ
Sbjct: 104 EFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           QL QKPLT+ RQVLS+L+YPE+L  + ++L    LF  DA+KRA+ L+++IGGSVGAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR++VA+FIT RD GE + PEDI+                C+   TG+LIPIPQ
Sbjct: 224 SQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE   WST  +EIE VV++A+E  I+ +VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTG 343

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           AVL+ E+IA+I  +AAKYG  VI+DEVYQEN+F   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQ 403

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           LASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
             G+ES+E D+ ER+ I  ++ TRA  LY+TFN LEGIECQ PQGAMYLFP++ LP +A 
Sbjct: 464 LEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAV 523

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
           +E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 524 QEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 583

Query: 499 QSFFNEYRD 507
           + FF+ YRD
Sbjct: 584 KEFFDHYRD 592

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/490 (63%), Positives = 381/490 (77%), Gaps = 4/490 (0%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEEL--KKNPGLLPFDDIINANIGN 76
           DF+PA KI+  DLN  +  AEYAVRGSI  RA+EL+ EL  K  P   PF+ II ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136
           PQQLDQKPLTF+RQV+SILEYP +L+   + L S  ++ KDAL+RAE L   IG SVGAY
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFK-DVLLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPI 196
           S +QGV GIR+T A FI+ RD  E A+ +DI+                C++  TG+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           PQYPLYTAS  + NA++LPYYLDEE  WST+ +EIE  V +A+E GI+PS ++VINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316
           TGAVL+ + I RI  +AAKYGI +I+DEVYQ+N+FN  +FHSMKK+LR+LQ  YPGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376
           VQLASLHS SKG  GECGQRGGYMEIVGFS ++R  L KL SI+ICSVVTGQA+VDLMV+
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436
           PP  GDESYE+D++ER++I + ++ RA+ LY+TF+ LEGIECQ PQGAMYLFPRLILPD+
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496
           A  E+++L +E DEFYC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL+PGT+WI +WK 
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 497 FHQSFFNEYR 506
           FH+ F  EY+
Sbjct: 501 FHEKFMKEYQ 510

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/491 (62%), Positives = 377/491 (76%), Gaps = 2/491 (0%)

Query: 17  DLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGN 76
           +L F PA + T KD+N  V  A+YAVRG+IP RA+ELK +L +NP  LPF+DIINANIGN
Sbjct: 86  NLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGN 145

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136
           PQQL QKPL+F RQVLS+L+YPE++        ++    +DA+ RA+ LL DIGGSVGAY
Sbjct: 146 PQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSVGAY 203

Query: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPI 196
           S SQGV GIR+TVADFIT RD G  A PEDI+                C+   TG+LIPI
Sbjct: 204 SSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPI 263

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           PQYPLYTA+ +L N+  LPYYL+EE  WST+ +E+E ++ D++E  I+PSVL+VINPGNP
Sbjct: 264 PQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNP 323

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316
           TGAVL+EE I +I  +AAKYGI VI+DEVYQENVF D KFHSMKKVLR+LQ   PG +DN
Sbjct: 324 TGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDN 383

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376
           VQLASLHS SKG  GECGQRGGYME+VGF+ DIR  + KL SIS+C VVTGQA+VDLMV 
Sbjct: 384 VQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVC 443

Query: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436
           PPQ G+ESYEQD++ER  I  E+  RA LL++ F  L+GI CQ PQGAMYLFP+L LP K
Sbjct: 444 PPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYK 503

Query: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496
           A +E+    + PDEFYC SLLE TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI++W +
Sbjct: 504 AIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVD 563

Query: 497 FHQSFFNEYRD 507
           FHQ F+N++++
Sbjct: 564 FHQEFYNKFKN 574

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/489 (60%), Positives = 380/489 (77%), Gaps = 1/489 (0%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           DF+PA K++ KD+N +V  A++A+RGSI  +A++L+ +L KNP  LPFD+I  ANIGNPQ
Sbjct: 10  DFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQ 69

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           +L+QKPLTF RQV+SIL+YPE+L  + + L    +F+ D+  RAE LL+DIGGSVGAYS 
Sbjct: 70  ELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128

Query: 139 SQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQ 198
           SQGV GIR+T A++IT RDGGEP+ PEDI+                C+  +TG+LIPIPQ
Sbjct: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188

Query: 199 YPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTG 258
           YPLYTA+ +L  + ++PYYLDEE  WST + EIEK+V D+++KGI+PSV++VINPGNPTG
Sbjct: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248

Query: 259 AVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQ 318
           AVL+E  IA+I  IAAKYGI V++DEVYQEN+F+  +FHS KKVLR LQ  YPGKFDN+Q
Sbjct: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQ 308

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPP 378
           LAS+HS SKG  GECGQRGGYME+VGF+ ++R  L KL  +++CSVVTGQA+VDLM+ PP
Sbjct: 309 LASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPP 368

Query: 379 QPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAF 438
           + GD SYE D++ER +IF+ M  RA  LY  F+ L+GIECQ PQGAMYL+P LIL  KA 
Sbjct: 369 KKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAI 428

Query: 439 RESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFH 498
            ++E L + PDEFYC  LL++TGICTVPGSGFGQK GTYH+RTTFLAPG +WI  W+ FH
Sbjct: 429 AKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFH 488

Query: 499 QSFFNEYRD 507
           + F+ +Y+D
Sbjct: 489 KHFYEKYQD 497

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/486 (61%), Positives = 378/486 (77%), Gaps = 8/486 (1%)

Query: 22  PAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQLD 81
           PA K+   DLN +V KA+YAVRGSIP RA+ELK  L+    L PFD +INANIGNPQQL 
Sbjct: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQKL-PFDTVINANIGNPQQLK 93

Query: 82  QKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHSQG 141
           QKPLTF RQVLSIL+YPE+L+      +  N+F KDA++RA  LLK+IG SVG+YS SQG
Sbjct: 94  QKPLTFYRQVLSILQYPELLE------SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQG 146

Query: 142 VPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYPL 201
           +P IR+TVA+FIT RD GE +TP DI+                CK+ ++G+LIPIPQYPL
Sbjct: 147 IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPL 206

Query: 202 YTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVL 261
           YTA+ +L NA  LPYYLDE   WST+ +EIE+V+ D+L+KGI+P+ L++INPGNPTG++L
Sbjct: 207 YTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSIL 266

Query: 262 TEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLAS 321
           + E++ +I  +AA +GI +I+DEVYQENVFN+ KFHSMKKVLR LQ  +PG++D VQLAS
Sbjct: 267 SVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLAS 326

Query: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPG 381
           LHS SKG  GECGQRGGYME+ GF+ +I+  + KL SIS+C VVTGQA+VDLMV+PPQ G
Sbjct: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386

Query: 382 DESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRES 441
           DESYEQD+ ERS I N++  RA LL+E FN +EG+ CQ P+GAMYLFP++ LP K  ++S
Sbjct: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446

Query: 442 ERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQSF 501
           + L + PDEFYC +LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI  W  FH  F
Sbjct: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506

Query: 502 FNEYRD 507
           +++YRD
Sbjct: 507 YDKYRD 512

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/490 (62%), Positives = 373/490 (76%), Gaps = 4/490 (0%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGL--LPFDDIINANIGN 76
           +FKPA KIT  DLN +V K+EYAVRGSIP RA+EL+ EL  N     L F++I++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136
           PQQLDQKPLTF+RQV+SIL+YPE+L      L S  +F  DA++RAE LL  IGGSVGAY
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPI 196
           S SQGV GIR+TVA++ITARD GE A+P+DI+                CKD  TG+LIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           PQYPLYTA+ +L +A++LPYYL+EE  WST ++EIEKVV DA+   ++PSV++VINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316
           TG+VL+++ I  I  I AKYGI +I+DEVYQEN+F D +FHSMKKVLR LQ  YPGK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDA 324

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376
           VQLASLHS SKG  GECGQRGGYME+VGF  +IR A+ KL SIS+CSV+TGQA+VDLMVN
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436
           PP+ GDESYE D  ER  I   ++ RA  LY  F  L+G+ECQ PQGAMYLFP+L  P  
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496
              E+    + PDEFYC +LLE+TGICTVPGSGFGQK GTYH+RTTFLAPG QW + WK 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 497 FHQSFFNEYR 506
           FH+ FF++Y+
Sbjct: 505 FHEEFFSKYQ 514

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/489 (61%), Positives = 373/489 (76%)

Query: 17  DLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGN 76
           +L+FKPA ++T  DLN +V KA+YAVRG IPTRA+ELK +L + P  LPFD IINANIGN
Sbjct: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136
           PQQL Q+PL+F RQVLS+L+YP +L     K  S  ++ KDA+ RA+ +LKDIGGSVGAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPI 196
           S SQGV GIR+TVA+FIT RDGGEPA PEDI+                CK  +TG+LIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           PQYPLYTA+ +L N+  LPY+LDE   WS    EIE V++ A++  I+P VL+VINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316
           TGAVL++E I  I  IAAKYGI VI+DEVYQEN+F+  KFHS+K VLR+LQ   PGKFDN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376
           VQLASLHS SKG  GECGQRGGYMEI+GF+ ++R  + KL SIS+C VVTGQA+VDLMV+
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436
           PP+ G+ES+  D+ +R  I +++  RA LL++TFN L+GIECQ P GAMYLFP+L LP +
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496
           A +E++RL + PDEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFLAPG +WI +WK 
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 497 FHQSFFNEY 505
           FH  F  +Y
Sbjct: 529 FHIEFMEKY 537

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/515 (58%), Positives = 375/515 (72%), Gaps = 14/515 (2%)

Query: 2   TMTHQQDLKSVFIAK-----DLDFKP-AAKITKKDLNGSVTKAEYAVRGSIPTRADELKE 55
           TM H + +     AK     DL  K   +K T +D+N  V  A+YAVRG IP RA+EL+ 
Sbjct: 10  TMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRH 69

Query: 56  ELKKNPGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLAS---LN 112
           +L + PG LPF+ IINANIGNPQQLDQKPLTF RQVLS+L+ P ++    E L +     
Sbjct: 70  KLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALI----ESLPTGELHK 125

Query: 113 LFSKDALKRAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXX 172
           LF  DA++RA+ +LK +GGSVGAYS SQGV G RQ+VA+FI  RDG EPA+  DI+    
Sbjct: 126 LFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAG 184

Query: 173 XXXXXXXXXXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIE 232
                       C  +  G LIPIPQYPLYTA+ +L +A  LPYYLDE   WS +++++E
Sbjct: 185 ASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVE 244

Query: 233 KVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFN 292
           +VV+DA+ KG+RP+ L+VINPGNPTGA+L+ E I +I  +AAKY + VI+DEVYQEN F+
Sbjct: 245 QVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD 304

Query: 293 DFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDA 352
           D  F SMKKVLR LQ   PGK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++  
Sbjct: 305 DADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQV 364

Query: 353 LFKLMSISICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNG 412
             KL SIS+C VVTGQA+VDLMV PP+ GD SYE DRQER+ I N +  ++ LLYETF  
Sbjct: 365 FLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQS 424

Query: 413 LEGIECQNPQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQ 472
           LEG+ CQ PQGAMYLFP+L L  KA R++E LG+ PDE+YC  LLE+TGICTVPGSGF Q
Sbjct: 425 LEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQ 484

Query: 473 KPGTYHVRTTFLAPGTQWIQNWKNFHQSFFNEYRD 507
            PGTYH+RTTFLAPGT+W+ +WK FHQ F +E+RD
Sbjct: 485 VPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/495 (59%), Positives = 370/495 (74%), Gaps = 3/495 (0%)

Query: 14  IAKDLDFKP-AAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINA 72
           + KD   KP  +K T +D+N  V  A+YAVRG IP RA+ELK++L + PG LPFD IINA
Sbjct: 26  LRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINA 85

Query: 73  NIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGS 132
           NIGNPQQLDQKPLTF RQVL++L+ P+++  D         F  DA++RA+ +LK +GGS
Sbjct: 86  NIGNPQQLDQKPLTFYRQVLALLQNPDLIS-DLSSGELHKFFKPDAVERAKKMLKQVGGS 144

Query: 133 VGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGL 192
           VGAYS+SQGV G R++VA+FI  RDG EPA+ +DI+                C     G 
Sbjct: 145 VGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGA 203

Query: 193 LIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVIN 252
           LIPIPQYPLYTAS +L N+  LPYYLDEE  WS ++++IEKVVQD+++KGIRP+ L+VIN
Sbjct: 204 LIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVIN 263

Query: 253 PGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPG 312
           PGNPTGA+L  +TI  +  +AAKY + +I+DEVYQEN FND +F SMKKVLR LQ   PG
Sbjct: 264 PGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPG 323

Query: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVD 372
           K+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C VVTGQA++D
Sbjct: 324 KYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALID 383

Query: 373 LMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLI 432
           LMV PP+ GD SYEQDRQER  I + +  R+ LLY+ F  +EG+ CQ PQGAMYLFP+L 
Sbjct: 384 LMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLE 443

Query: 433 LPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQ 492
           L +KA  ++E  G+ PDE+YC  LLE+TGICTVPGSGFGQ PGT+H+RTTFLAPGT+WI 
Sbjct: 444 LSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWID 503

Query: 493 NWKNFHQSFFNEYRD 507
           +WK FH+ F  ++RD
Sbjct: 504 SWKKFHEKFTEDHRD 518

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/491 (58%), Positives = 366/491 (74%), Gaps = 4/491 (0%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           DF P AK+T KDLN  + K +YAVRG IP RA+ELK +L+K+P  LPF+ IINANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASL---NLFSKDALKRAECLLKDIGGSVGA 135
           QL QKPL+F R+VLSIL+YP+IL+ D  KL +L    ++ KD ++RA  LL +IGGSVGA
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILE-DESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126

Query: 136 YSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIP 195
           YS SQGVPGI+QTVAD+IT RD GE A PEDI+                C    TG+LIP
Sbjct: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186

Query: 196 IPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGN 255
           IPQYPLYTA+ +L  A  + YYL+EE NWS  + E+E  +Q++++ GI+P+ +++INPGN
Sbjct: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246

Query: 256 PTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFD 315
           PTG++LTE+ IA I  I+AKYG+ +I+DEVYQENVF+  +FHS+KKVLRKLQ  Y G ++
Sbjct: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306

Query: 316 NVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMV 375
            VQLASLHS SKG +GECGQRGGYME++G + D+R  + KLMSISICSVVTGQA++D++V
Sbjct: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366

Query: 376 NPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPD 435
           +PP+PGDESYE D+ ER+ I N++ +R+  L++ F  LEG+EC  PQGAMYLFP+ I P 
Sbjct: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426

Query: 436 KAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWK 495
           K    +++L  E D  YC  LLE TGICTVPGSGFGQKP TYH+RTTFL PG  WI  W+
Sbjct: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486

Query: 496 NFHQSFFNEYR 506
            FH  F   YR
Sbjct: 487 KFHTEFCERYR 497

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/495 (57%), Positives = 374/495 (75%), Gaps = 3/495 (0%)

Query: 14  IAKDL-DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINA 72
           I  DL DF+PA K++ KDLN +V KAE+AVRG+IP +A EL+ +L KNP  LPF++I  A
Sbjct: 6   IQTDLHDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVA 65

Query: 73  NIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLN-LFSKDALKRAECLLKDIGG 131
           NIGNPQ+L QKPLTF RQV+SIL+YPE+L   +E  ++   +++ D+  RAE LL +IGG
Sbjct: 66  NIGNPQELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGG 125

Query: 132 SVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTG 191
           SVGAYS SQGV GIR+T+A++IT RD GE A+P DI+                    +TG
Sbjct: 126 SVGAYSASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTG 185

Query: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQ-DALEKGIRPSVLIV 250
           +L+PIPQYPLYTA  +L NA +LPYYL+EE  WS +++EIEK ++ +A+ KGI+P V+++
Sbjct: 186 VLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVI 245

Query: 251 INPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCY 310
           INPGNPTG++L+E+++ +I  IAAKYGI +I+DEVYQEN+FN  KFHS KKVLR LQ  +
Sbjct: 246 INPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQF 305

Query: 311 PGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAI 370
           P +++NVQLASLHS SKG  GECGQRGGYMEI+GF+ D+R+ + KL  I +C VVTGQA+
Sbjct: 306 PTQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAM 365

Query: 371 VDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPR 430
           +DLM+ PP+ GD+SY+ D  ER +I N+M  RA  LY+ F+ +EGI+CQ PQGAMYLFPR
Sbjct: 366 MDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPR 425

Query: 431 LILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQW 490
           L+L  K   E+++  +EPDEFYC  LL  TGICTVPGSGFGQKP TYH+RTTFLAPG QW
Sbjct: 426 LLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQW 485

Query: 491 IQNWKNFHQSFFNEY 505
           I  W+ FH++F   Y
Sbjct: 486 INKWEKFHKAFLKRY 500

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/491 (58%), Positives = 372/491 (75%), Gaps = 5/491 (1%)

Query: 18  LDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNP 77
           + F+P   +  +DLN +V +A+YAVRG IP RA EL+ +L ++P  LPF  II ANIGNP
Sbjct: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107

Query: 78  QQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSK-DALKRAECLLKDIGGSVGAY 136
           QQL QKPL+F+R+VLS+LE P +LQ+  E    LNL  K DA++RA+ +++D+  S+GAY
Sbjct: 108 QQLGQKPLSFSREVLSLLESPNLLQMPME---VLNLIYKPDAVRRAKRMMRDLQTSIGAY 164

Query: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPI 196
           SHSQGV G R+TVA+++++RDG EPA+ EDI+                CK   +G+LIPI
Sbjct: 165 SHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           PQYPLYTA+ +L N   LPYYLDEE  WS   D++E+++ +++EKG++P+ L+VINPGNP
Sbjct: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNP 283

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316
           TGA+L  E++ RI +IAAKY I VI+DEVYQENVF   KF+SMKKVLR LQ  Y   F N
Sbjct: 284 TGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN 343

Query: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376
           VQL SLHS SKG  GECGQRGGYME+VGFS DIR+ + K+ SI +CS V GQA+VDLM++
Sbjct: 344 VQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLS 403

Query: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436
            P+PGDESYE+D  ERS I N ++ R+  L+ETFN LEG+EC+ PQG+MYLFPRL+LP K
Sbjct: 404 RPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQK 463

Query: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496
           A + +E L ++PDEFYC  LL STGICTVPGSGFGQ P T H+RTTFL PGT+WI++W+ 
Sbjct: 464 AIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWEL 523

Query: 497 FHQSFFNEYRD 507
           FH+SF+++YRD
Sbjct: 524 FHKSFYDKYRD 534

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/491 (57%), Positives = 362/491 (73%), Gaps = 3/491 (0%)

Query: 18  LDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNP 77
           + F PA K++  DLN     A+YAVRGSIP RA++L  ++  +PG LPFD II ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 78  QQLDQKPLTFTRQVLSILEYPEILQVDH--EKLASLNLFSKDALKRAECLLKDIGGSVGA 135
           QQ+ QKPLTF RQVLSILEYP IL      EKL  L ++ +D ++RA  +L  IGGSVGA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 136 YSHSQGVPGIRQTVADFITARDG-GEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLI 194
           YS SQGV G RQTVADFI  RDG  + A+P DI+                C     G+LI
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 195 PIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG 254
           PIPQYPLYTA+ +L N+  +PYYL E  +WST + EIE  +++++  G++P  +++INPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 255 NPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKF 314
           NPTGA+L+E  +A I  I+AKYGIA+I+DEVYQEN+F  F+FHSM+KVL  LQ  +PG +
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLM 374
           DNVQLASLHS SKGF+GECGQRGGYME++GF  ++   + KL SISICSVVTGQA++DL+
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 375 VNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILP 434
             PPQPGD SY+ D++ER+KI  ++  RA+ LY  F  LEG+ECQ PQGAMYLFP+LILP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 435 DKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNW 494
           DKA  ++ +L + PDE+YC  LL++TGICTVPGSGFGQ PGTYH+RTTFL PGT+WI+ W
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 495 KNFHQSFFNEY 505
           + FHQ F+  +
Sbjct: 481 REFHQQFYERF 491

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/485 (58%), Positives = 363/485 (74%), Gaps = 4/485 (0%)

Query: 23  AAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQLDQ 82
           A ++  +DLN +V KA+YAVRG+IP+ AD+LK +L K+PG LPF+ +IN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 83  KPLTFTRQVLSILEYPEILQVDHEK-LASLNLFSKDALKRAECLLKDIGGSVGAYSHSQG 141
           KPL+F RQVLSILEYP +L  DHE+ L     ++ D+++RA+ LL DIG S+GAYS+SQG
Sbjct: 141 KPLSFGRQVLSILEYPALL--DHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQG 197

Query: 142 VPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYPL 201
           V GIRQTVADFIT RD GE A P+DI+                CK  +TG+LIPIPQYPL
Sbjct: 198 VHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPL 257

Query: 202 YTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVL 261
           YTA+ +L +A  LPYYLDE   WST+ +EI KV QD+LE GI+P+ L+VINPGNPTG+VL
Sbjct: 258 YTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVL 317

Query: 262 TEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLAS 321
           T E I  +  +AAKYG+ VI+DEVYQ+N+F   +FHSMKK+LR LQ   P K+DN+QLAS
Sbjct: 318 TVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLAS 377

Query: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPG 381
           LHS SKG +GECG RGGY E +GF+ +++  + KL SIS+CS V GQA+VDLM  PP+ G
Sbjct: 378 LHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKG 437

Query: 382 DESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRES 441
           + SYE D+ ER  I    + R+N LYE FN LEG+ CQ PQGAMY+FP + LP  A + +
Sbjct: 438 EPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMA 497

Query: 442 ERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQSF 501
           + L + PDEFYC  LL++TGICTVPGSGFGQ+PGTYHVRTTFLAPG +W++ W+ FH  F
Sbjct: 498 QNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEF 557

Query: 502 FNEYR 506
           F +YR
Sbjct: 558 FEKYR 562

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/492 (59%), Positives = 366/492 (74%), Gaps = 1/492 (0%)

Query: 16  KDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIG 75
           K  +FKPA K+T  DLN +V KA+YAVRG IP RA+ LK++L  NP  LPF  +INANIG
Sbjct: 32  KHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIG 91

Query: 76  NPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGA 135
           NPQQL+QKPLTF RQVLS+L+YP +L        +  L+ +DA++RA+ +L DIG SVG+
Sbjct: 92  NPQQLNQKPLTFYRQVLSLLQYPMVLDETFSG-NTKTLYKQDAIERAKRILNDIGSSVGS 150

Query: 136 YSHSQGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIP 195
           YS SQGV G+R+TVA++I+ RDGGE A  EDI+                CK   +G+LIP
Sbjct: 151 YSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIP 210

Query: 196 IPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGN 255
           IPQYPLYTA+ +L N   LPYYL+E   WST  +EIE VV +A+ + I P VL+VINPGN
Sbjct: 211 IPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGN 270

Query: 256 PTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFD 315
           PTGA+L+ E+I +I  +AA +GI VI+DEVYQEN+F   +FHSMKKVLR LQ   PGK++
Sbjct: 271 PTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYE 330

Query: 316 NVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMV 375
           NVQLASLHS SKG  GECGQRGGYME+ GFS +I+  + KL SIS+C VVTGQA+VDLM 
Sbjct: 331 NVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMT 390

Query: 376 NPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPD 435
            PP+ G+ SYEQD+ ERS I +E+  RA  L++ FN +EG+ CQ PQG+MYLFP++ +P 
Sbjct: 391 CPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPH 450

Query: 436 KAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWK 495
           KA  +++ L + PDE YCA LLE+TGICTVPGSGFGQKPGT+H+RTTFLAPGT WI  W+
Sbjct: 451 KALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWR 510

Query: 496 NFHQSFFNEYRD 507
            FHQ F N+YRD
Sbjct: 511 EFHQIFCNKYRD 522

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/488 (57%), Positives = 358/488 (73%), Gaps = 3/488 (0%)

Query: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79
           F PA  +T  D+N +V KA+YAVRG IPTRA+EL+  L+++PG LPF  II ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 80  LDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHS 139
           L QKPLTF RQV+S+++ P++L++  E L     F  D + RA  +L+D GGSVGAYS S
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154

Query: 140 QGVPGIRQTVADFITARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQY 199
           QGV G R+TVA FI  RDG  PA P+++Y                CK   TG+LIPIPQY
Sbjct: 155 QGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213

Query: 200 PLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGA 259
           PLYTA+ +  NA  LPYYL+E   WST  DE+E+V+ D+ ++ I P  L+VINPGNPTG+
Sbjct: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273

Query: 260 VLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQL 319
           VL+ + +  I  +AAKYGI VI+DEVYQ+NVF D KFHSM+KVL+ LQ   P  + NVQL
Sbjct: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333

Query: 320 ASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQ 379
           ASLHSISKG  GECGQRGGYME++GF +++R    KL SIS+C VVTGQA+VDLMV PP 
Sbjct: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393

Query: 380 PGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFR 439
            GD SYEQ  QE   I++E+  R+ LL++TF  LEGIEC  PQGA+YLFP+L LP KA  
Sbjct: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453

Query: 440 ESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQ 499
            +++LG+  DE YC+ LL+ TGICTVPG+GFGQ PGTYHVRTTFL PGT+WI++WK+FH+
Sbjct: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513

Query: 500 SFFNEYRD 507
            F+++YRD
Sbjct: 514 KFYDKYRD 521

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/494 (56%), Positives = 361/494 (73%), Gaps = 8/494 (1%)

Query: 20  FKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQ 79
           F PA K +  D+N S+ KAEYA+RG+IP RA+EL  +L +N   LPF  I+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 80  LDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHS 139
           LDQ+PLTF RQV+S++++P++L+   + L +  ++SKD+++RA  LL  IGGSVGAYS S
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 140 QGVPGIRQTVADFITARD-GGEPA------TPEDIYXXXXXXXXXXXXXXXXCKDTRTGL 192
           QGV  IR+ VA FI  RD   +P       T  +++                 KD   G+
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 193 LIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVIN 252
           L+PIPQYPLYTA+ +L  +++LPYYL+E  NWST+  +IE++V DA+++ I+P+ L+VIN
Sbjct: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 253 PGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPG 312
           PGNPTGA+LT+++I  I  IAA+YGI +I+DEVYQENV+  F+FHS KKVL +L+  YP 
Sbjct: 247 PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVD 372
           K+DNVQLASLHSISKG  GECGQRGGYMEI GFS D++  L K+ SISICSVVTGQ +VD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 373 LMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLI 432
           LMVNPPQPGDESYE D+ ERS I + +  ++N LY+ F  L GI CQ PQGAMYLFPRL 
Sbjct: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 433 LPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQ 492
           L + A   +  L ++PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFL PG +WI 
Sbjct: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 493 NWKNFHQSFFNEYR 506
           +W+ FH  F  +Y+
Sbjct: 487 SWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/497 (54%), Positives = 353/497 (71%), Gaps = 10/497 (2%)

Query: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78
           D  PA K +  D++ S+   EYA+RG+IPTRADEL+E+L  +P  LPF  II ANIGNPQ
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSH 138
           QL+Q+PLTF RQVLS++EYP ++      L    +++ DA+KRAE +L  IGGSVGAYS 
Sbjct: 65  QLEQEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSS 123

Query: 139 SQGVPGIRQTVADFITARDGGEPA---------TPEDIYXXXXXXXXXXXXXXXXCKDTR 189
           SQG+  IR+ VA  I  RD  E           T  +I+                 KD  
Sbjct: 124 SQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDEN 183

Query: 190 TGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLI 249
            G+L+PIPQYPLYTA+ +L N+++LPYYL+E+ NWST+ +EIE +++DA+ + I+P+ L+
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLV 243

Query: 250 VINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHC 309
           +INPGNPTGA+L+ E+I +I  IAAKYGI +I+DEVYQ N++ DFKFHS KK+L  L+  
Sbjct: 244 IINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQ 303

Query: 310 YPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQA 369
           YP K+DNVQLASLHSISKG  GECGQRGGY E++GFS +I+  + KL SI ICSVVTGQ 
Sbjct: 304 YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 370 IVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFP 429
           +VDLM  PP+ GD SY+ D++ER+ I + +  ++N LY+ F+ L GI CQ PQGAMYLFP
Sbjct: 364 LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 430 RLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQ 489
           RL L      E++   +EPDEFYC  LLE+TGICTVPGSGFGQK GTYHVRTTFL  G +
Sbjct: 424 RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 490 WIQNWKNFHQSFFNEYR 506
           WI+ W+ FH  F N+Y+
Sbjct: 484 WIKLWEKFHLEFMNQYK 500

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 104/257 (40%), Gaps = 39/257 (15%)

Query: 225 STESDEIEKVVQDALEKGI--RPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVIS 282
           +T  DE + +  DALEK    +   +I+  P NP G V TE+ + ++  +  ++   VIS
Sbjct: 167 NTTGDEWQ-IDWDALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVIS 225

Query: 283 DEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEI 342
           DEVY+   F +  F  +  +             N  +A+L +++ G  G+     G+   
Sbjct: 226 DEVYEHLYFTE-SFPRIANI-------------NEDIANL-TLTVGSAGKSFAATGWR-- 268

Query: 343 VGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKI------F 396
           +G+     D L   +S         +A   +    P P  E+     +   KI       
Sbjct: 269 IGWIISKNDQLLNYVS---------KAHTRICFASPSPLQEACAGSIEHALKIDYFPKMR 319

Query: 397 NEMRTRANLLYETFNGLEGIECQNPQGAMYL---FPRLILPDKAFRESERLGVEPDEFYC 453
            E R +  +L   F+ L G+    P+G  ++   F ++ +P+      E L    D    
Sbjct: 320 EEYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRIS 378

Query: 454 ASLLESTGICTVPGSGF 470
             L+   GI  +P + F
Sbjct: 379 YWLINEIGIVAIPPTEF 395

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 16/107 (14%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSV-LIVIN-PG 254
           P Y   ++   +F A+V   +L +E N+     E+E++        I+P+   IV+N P 
Sbjct: 113 PTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERM--------IKPNTKCIVLNTPN 164

Query: 255 NPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKK 301
           NP  +V+  ET+  I  +A K+GI V  DEVY         FHS +K
Sbjct: 165 NPLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 100/256 (39%), Gaps = 42/256 (16%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + ++    + D      +   +I+  P NP G V T E + RI  I  K  + +ISD
Sbjct: 183 WTVDYEQFANAITD------KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISD 236

Query: 284 EVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIV 343
           EVY+   F D           ++    P      ++  L ++S G  G+     G+   V
Sbjct: 237 EVYEHLYFTD--------SFTRIATLSP------EIGQL-TLSVGSAGKSFAATGWR--V 279

Query: 344 GFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKI--FNEMRT 401
           G+   +   L   +S         +A   +    P P  E+      +  +I  F  MR 
Sbjct: 280 GWVVSLNPELLSYVS---------KAHTRICFASPSPLQEAVANSINDALEINYFENMRQ 330

Query: 402 RANLLYETFNGL---EGIECQNPQGAMYL---FPRLILPDKAFRESERLGVEPDEFYCAS 455
                Y+ F  +    G+    P+G  ++   F ++ +P+  +   E +  +  +F  A 
Sbjct: 331 EYKHKYDIFTSVFKELGLPYTEPEGTYFILVDFSKVKIPE-GYSYPEEIANKAKDFRIAY 389

Query: 456 -LLESTGICTVPGSGF 470
            L+   G+  +P + F
Sbjct: 390 WLINELGVVAIPPTEF 405

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+   DE+E  +        +   LI+  P NP G V T E + RI  I  K+ + +ISD
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 284 EVYQENVF 291
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 104/233 (44%), Gaps = 25/233 (10%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECN-WSTESDEIEKVVQDALEKGI 243
           C   +  +LI  P Y +Y+  A + + +++   L  E N +   +D++ + +Q   +  I
Sbjct: 108 CVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNSFQMNTDKVIETLQG--DSNI 165

Query: 244 RPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVL 303
           +  +  V +PGNPTGA++   +I +I L   + GI  I DE Y         F S     
Sbjct: 166 K--IAFVTSPGNPTGALIDIASIEKI-LSQWQSGIVAI-DEAY-------IDFCSTGGSA 214

Query: 304 RKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMS-ISIC 362
             L + YP       LA L ++SK F G  G R G   +   S+D+   L  + +  +I 
Sbjct: 215 APLVNKYP------NLAVLQTLSKSF-GLAGVRLG---VTFTSKDLSRVLNAMKAPYNIS 264

Query: 363 SVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEG 415
           S+ +   +  L     Q   ++ ++  +ER ++   + +  N+      GL+ 
Sbjct: 265 SMASNLVLKALSSESVQTMKDNVQEIVEERERVLKALTSMENVQDTQVGGLDA 317

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 215 PYYLDEECNWSTESDEIEKVVQDALEKGI--RPSVLIVINPGNPTGAVLTEETIARICLI 272
           P  LD+     TE +    +  D LEK I  R   +I+  P NP G V T E + R+  I
Sbjct: 160 PRELDDRVTRGTEWE----IDWDILEKTINSRTKCVIINTPHNPIGKVFTREELLRLGKI 215

Query: 273 AAKYGIAVISDEVYQENVFND 293
                I +ISDEVY+   F+D
Sbjct: 216 CVDNNIVIISDEVYEHLYFSD 236

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 105/262 (40%), Gaps = 42/262 (16%)

Query: 218 LDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYG 277
           + E   W  + D + + + +      +   +I+ +P NP G V T E + ++  I  + G
Sbjct: 192 VTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKG 245

Query: 278 IAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRG 337
           I +ISDEVY+   F D +F  +  +  ++              S H+++ G  G+     
Sbjct: 246 IYIISDEVYEHLYFTD-EFTRIATLSEEI--------------SQHTLTVGSAGKSFAAT 290

Query: 338 GYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPGDE--SYEQDRQERSKI 395
           G+   +G+       L  L S         +A V +  + P P  E  +   +   ++  
Sbjct: 291 GWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALKTTY 339

Query: 396 FNEMRTRANLLYETFNGL---EGIECQNPQGAMYL---FPRLILPDKAFRESERLGVEPD 449
           + + R      YE F       G+     +G+ +L   F RL LP   +   E L  +  
Sbjct: 340 YADTRAAYQKKYERFQKPFDDLGLPYTRAEGSYFLLVDFSRLPLPAD-YHFPEELADKGR 398

Query: 450 EFYCAS-LLESTGICTVPGSGF 470
           +F  A  L+   G+  +P S F
Sbjct: 399 DFRVAYWLINELGLVAIPCSSF 420

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + ++ E V+ +      +   +I+  P NP G V T E + RI  I  K+ + +ISD
Sbjct: 183 WTLDFEQFENVITN------KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISD 236

Query: 284 EVYQENVFND 293
           EVY    F D
Sbjct: 237 EVYDNLYFVD 246

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 105/247 (42%), Gaps = 28/247 (11%)

Query: 158 GGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYY 217
           G EP T +++                 C+     +L   P Y +Y+  A++ + +++   
Sbjct: 78  GIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIV--- 134

Query: 218 LDEECNWSTESDEIEKVVQDAL---EKGIRPSVLIVINPGNPTGAVLTEETIARICLIAA 274
              EC   TE +  +  V + L   +   +  +L + +PGNPTG ++ ++ I  I L   
Sbjct: 135 ---ECPLITEDNSFQMNVPEVLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFI-LENW 190

Query: 275 KYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECG 334
             G+ V+ DE Y +    +   +SM K++ K    YP       L  L ++SK F G  G
Sbjct: 191 TNGLVVV-DEAYIDFADAEGTTYSMAKLVTK----YP------NLTVLQTLSKSF-GLAG 238

Query: 335 QRGGYMEIVGFSQDIRDALFKLMSI--SICSVVTGQAIVDLMVNPPQPGDESYEQDRQER 392
            R G    V F+ +   ++   M    +I S+ +  AI  +         E+     QE+
Sbjct: 239 IRLG----VTFASEEFSSVLNAMKAPYNISSLTSKYAIEAVQEENLNYMIENARNVNQEK 294

Query: 393 SKIFNEM 399
            ++ NE+
Sbjct: 295 HRLLNEL 301

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + ++ EK +        +   +I+  P NP G V T E +  +  I  K+ + +ISD
Sbjct: 184 WTIDFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISD 237

Query: 284 EVYQENVFND 293
           EVY+   F D
Sbjct: 238 EVYEHLYFTD 247

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 95/255 (37%), Gaps = 40/255 (15%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W  + D ++  +        +   +I+  P NP G V TE  + R+  I  K  + +ISD
Sbjct: 175 WQIDWDSLQAAMNS------KTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISD 228

Query: 284 EVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIV 343
           EVY+   F D           ++    P      ++  L +++ G  G+     G+   +
Sbjct: 229 EVYEHLYFKD--------SFTRIATLSP------EIGQL-TLTVGSAGKSFAATGWR--I 271

Query: 344 GFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPGDESYEQ--DRQERSKIFNEMRT 401
           G++  +   L              +A   +    P P  E+     +  E+ + F E R 
Sbjct: 272 GWALSLNQELLSY---------AAKAHTRICFASPSPLQEAVANAFNDAEKVEYFKETRL 322

Query: 402 RANLLYETFNGL---EGIECQNPQGAMYL---FPRLILPDKAFRESERLGVEPDEFYCAS 455
           +    YE F  +    G+    P+G  ++   F ++ +P       E L    D      
Sbjct: 323 QYIRKYEIFTNVLNELGLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYW 382

Query: 456 LLESTGICTVPGSGF 470
           L+   G+  +P + F
Sbjct: 383 LMNELGVVAIPPTEF 397

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 237 DALEKGIRPSV--LIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFND 293
           +  EK I P    +I+  P NP G V T E +  +  I  K+ + +ISDEVY+   F D
Sbjct: 189 EQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYFTD 247

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + ++ EK +        +   +I+  P NP G V T + +  +  I  K+ + +ISD
Sbjct: 184 WTIDFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISD 237

Query: 284 EVYQENVFND 293
           EVY+   F D
Sbjct: 238 EVYEHLYFTD 247

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/289 (21%), Positives = 115/289 (39%), Gaps = 51/289 (17%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           P Y    +   +F A+V    L +E ++      ++ ++++         ++I+ NP NP
Sbjct: 110 PTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKN------NTKLIIINNPNNP 163

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHC--YPGKF 314
            G+V+ ++ + +IC +  +  I + SDEVY+        FHS++  +     C  Y    
Sbjct: 164 LGSVIKKDLLKQICKLCEENDIYLHSDEVYRP------IFHSLEDEMVPPSACELYSKAI 217

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDAL----FKLMSISICSVVTGQAI 370
            +  ++  +S++       G R G++ +    Q +RDA     + ++S+S+      Q +
Sbjct: 218 VSGSMSKAYSVA-------GIRLGWL-VSKDKQFLRDAASRRDYNMISVSMIDDQIAQYV 269

Query: 371 VDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPR 430
           +D   N       +YE          N  R   + + E  +  E      P  A     +
Sbjct: 270 LD---NREYVIKRNYEL-------CLNNFRLLNDFMDEHSDKFEFY--HKPTAATVCLAK 317

Query: 431 LILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHV 479
           +             GV     +   L E  G+  VPG  FG  PGT  +
Sbjct: 318 V------------KGVNDTMKFATFLAEKYGVLAVPGEAFGV-PGTIRI 353

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 78/186 (41%), Gaps = 23/186 (12%)

Query: 154 TARDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYPLYTASASLFNAQV 213
           TA +   P T  +I                 C   R  +L+  P Y +Y+  A + + +V
Sbjct: 77  TADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEV 136

Query: 214 LPY-YLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLI 272
           +    + E+ ++  +SD+    V D L       +L + +PGNPTGA +    I ++ L 
Sbjct: 137 VTCPLITEDNSFQMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKV-LQ 191

Query: 273 AAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGE 332
               G+ V+ DE Y      DF   S   ++ K Q+          L +L ++SK F G 
Sbjct: 192 NWDRGLVVV-DEAYV-----DFCGGSTAPLVTKYQN----------LVTLQTLSKSF-GL 234

Query: 333 CGQRGG 338
            G R G
Sbjct: 235 AGIRLG 240

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + ++ E  +        +   +I+  P NP G V T E +  +  I  K+ + +ISD
Sbjct: 200 WTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISD 253

Query: 284 EVYQENVFND 293
           EVY+   F D
Sbjct: 254 EVYEHLFFTD 263

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 6/70 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W  + D + K + +      R   +I+  P NP G V T E + ++  I  K  I +ISD
Sbjct: 184 WKIDFDILNKTINE------RTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISD 237

Query: 284 EVYQENVFND 293
           EVY+   F D
Sbjct: 238 EVYEHLYFGD 247

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 12/103 (11%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           P Y    +   +F A+V    L E+ ++    D ++K ++          ++I+ NP NP
Sbjct: 111 PTYSQLYSVPKMFGAEVTLLELSEKDSFLPNLDTLKKAIKS------NTKLIIINNPNNP 164

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSM 299
            G V+++E +  IC +  +  + +  DEVY+        FHS+
Sbjct: 165 LGCVISDELLTSICELCKEKNVYLHCDEVYRP------IFHSL 201

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 6/72 (8%)

Query: 220 EECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIA 279
           E   W+ + DE+   +        +   LI+  P NP G V T E + +I  I  +  + 
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 280 VISDEVYQENVF 291
           +ISDEVY+   F
Sbjct: 233 IISDEVYEHLYF 244

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 12/103 (11%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           P Y    +   +F A+V    L +E  +    + ++K+++          ++I+ NP NP
Sbjct: 110 PTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKS------NTKLIIINNPNNP 163

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSM 299
            G+ ++ ET+  IC +  +  I +  DEVY+        FHSM
Sbjct: 164 LGSAISTETLNDICQLCEENNIYLHCDEVYKP------IFHSM 200

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG-N 255
           Y+ S+SL+ A+     V P  LDE   +    +++E ++ +   +  +P +L  I  G N
Sbjct: 165 YSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           PTG+ L+++  A+I  IA K+   +I DE Y
Sbjct: 222 PTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 220 EECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIA 279
           E  +W+ + +E+ K          +   LI+  P NP G V T+E + +I  +  +  + 
Sbjct: 187 EGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVV 240

Query: 280 VISDEVYQENVFND 293
           +ISDEVY+   F D
Sbjct: 241 IISDEVYEFLYFTD 254

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 244 RPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFND 293
           +   +IV +P NP G V T+E + ++  I  +  + +ISDEVY+   FND
Sbjct: 202 KTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYEFLYFND 251

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/256 (20%), Positives = 103/256 (40%), Gaps = 42/256 (16%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + DE  + +        +   +I+  P NP G V T E + ++  I  +  + +I+D
Sbjct: 184 WTVDFDEFTRAITP------KTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIAD 237

Query: 284 EVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIV 343
           EVY+   F D +F  +  +  ++              S+ S  K F    G R G+  +V
Sbjct: 238 EVYEHLYFVD-EFPRIATLSEEIGQL---------TLSVGSAGKSFAA-TGWRIGW--VV 284

Query: 344 GFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPGDE--SYEQDRQERSKIFNEMRT 401
             + D+                  +A   +    P P  E  SY  D   +   F  MR 
Sbjct: 285 SQNPDLLQ-------------YASKAHTRICFASPSPIQEACSYSIDHALKIDYFENMRQ 331

Query: 402 RANLLYETFNGL---EGIECQNPQGAMYL---FPRLILPDKAFRESERLGVEPDEFYCAS 455
                ++ F  +    G+    P+G+ ++   F ++ +PD +++  E +  +  +F  ++
Sbjct: 332 EYVKKFKIFTSVFDELGLPYTIPEGSYFVLADFSKVKIPD-SYQFPEEIMSKGKDFRISN 390

Query: 456 -LLESTGICTVPGSGF 470
            L+   G+  +P + F
Sbjct: 391 WLINELGVVAIPPTEF 406

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/264 (21%), Positives = 113/264 (42%), Gaps = 31/264 (11%)

Query: 156 RDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVLP 215
           +D  +P T E++                 C   +  +L+  P Y +Y+  A + + +++ 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 216 YYL-DEECNWSTESDEIEKVVQDALEKGIRPSV--LIVINPGNPTGAVLTEETIARICLI 272
             L   + ++   +DE+ K  Q+       PS+  + + +PGNPTGA +    I +I L 
Sbjct: 138 CPLITSDNSFQANTDEVIKTAQN------DPSIKLIFITSPGNPTGAKVETSRIEKI-LQ 190

Query: 273 AAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGE 332
               G+ V+ DE Y      DF   S   ++ K    YP       L  L ++SK F   
Sbjct: 191 NWDRGMVVV-DEAYI-----DFCGGSTAPLVTK----YP------NLCVLQTLSKSF--- 231

Query: 333 CGQRGGYMEIVGFSQDIRDALFKLMS-ISICSVVTGQAIVDLMVNPPQPGDESYEQDRQE 391
            G  G  + I   S+++   L  + +  +I S+ +  A+  +  +  +   +   +++ +
Sbjct: 232 -GLAGIRLGITFASKEMARVLNSMKAPYNISSLASEYALRAVQPDNLKVMKQLSLENKSQ 290

Query: 392 RSKIFNEMRTRANLLYETFNGLEG 415
           + ++  E+ +  N+  E   GL+ 
Sbjct: 291 QHRLVKELTSLPNVHKEPIGGLDA 314

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 6/91 (6%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           P Y   ++   +F A+V    L+ E ++  +  +++ +++           +++ NP NP
Sbjct: 113 PTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKG------NTKCIVLNNPNNP 166

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQ 287
            G+V+   T+  I  +A K  I VI DEVY+
Sbjct: 167 LGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 6/76 (7%)

Query: 218 LDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYG 277
           + E   W+ + ++ +  +        +   +I+  P NP G V T E + +I  I  +  
Sbjct: 179 VTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNICVEKN 232

Query: 278 IAVISDEVYQENVFND 293
           + +ISDEVY+   F D
Sbjct: 233 VIIISDEVYEHLYFTD 248

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 71/161 (44%), Gaps = 24/161 (14%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE---K 241
           CK     +++  P Y +Y+  A++ +  V+       C    E +  +  V+  LE   K
Sbjct: 105 CKPAVQKIMVLPPTYSMYSVCANINDVDVV------NCPLIVEDNSFQMDVKRTLETLKK 158

Query: 242 GIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKK 301
                +L + +PGNPTG ++  + I  + L   K G+ V+ DE Y +  F+ +     KK
Sbjct: 159 DDLIRLLFITSPGNPTGKIIAIKDIIYV-LEHWKNGLVVV-DEAYVD--FSTYFNEETKK 214

Query: 302 V----LRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGG 338
                + KL   YP       L  L ++SK F G  G R G
Sbjct: 215 TEYFSVAKLVTKYPN------LTVLQTLSKSF-GLAGIRLG 248

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 6/68 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + DE+   +        +   LI+  P NP G V T E +  I  I  +  + +ISD
Sbjct: 187 WTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISD 240

Query: 284 EVYQENVF 291
           EVY+   F
Sbjct: 241 EVYEHLYF 248

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 119/288 (41%), Gaps = 38/288 (13%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIR 244
           C   +  +LI  P Y +Y+    + + + +   L  E N S + D  EKV++  L+    
Sbjct: 108 CVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDN-SFQMD-TEKVIE-TLQNDPS 164

Query: 245 PSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLR 304
             ++ + +PGNPTGA++  E I ++ L   + G  V+ DE Y         F +    + 
Sbjct: 165 IKLVFITSPGNPTGALIKPENIEKL-LSQWQSGFVVV-DEAY-------IDFCTTGGSVA 215

Query: 305 KLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMS-ISICS 363
            L + YP       LA L ++SK F G  G R G   I   S D    L  + +  +I +
Sbjct: 216 PLVNKYP------NLAVLQTLSKSF-GLAGIRLG---ITFTSSDFSRILNAMKAPYNISA 265

Query: 364 VVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQG 423
           + +  AI  +            +Q   ER+++   + +  N+      GL+         
Sbjct: 266 MASNLAIEAMRPESVATMKSLAKQITDERARVLKALTSLNNVQDTHVGGLD--------- 316

Query: 424 AMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFG 471
           A +L  R++   K    S RL     E Y    +ES  +    G+ +G
Sbjct: 317 ANFLLLRVLEDGKG---SNRLA---KELYQKLAVESAVVTRFRGTEYG 358

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 74/158 (46%), Gaps = 24/158 (15%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQ--VLPYYLDEECNWSTESDEIEKVVQDALEKG 242
           C   +  +LI    Y +YT  + + + +   +P  L EE  +  + ++I + +Q+     
Sbjct: 108 CVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEEDKFQIDEEKILETLQN----- 162

Query: 243 IRPSVLIVI--NPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300
             PS+ +V   +PGNPTG  +    I +I L   + G+ V+ DE Y      DF   S K
Sbjct: 163 -DPSIKLVFITSPGNPTGTFIDVNRIEKI-LSQWQTGLVVV-DEAYI-----DFVEGSDK 214

Query: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGG 338
             L  L      K++N+  A L ++SK F G  G R G
Sbjct: 215 GSLAPLAT----KYENI--AVLQTLSKSF-GLAGIRLG 245

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 244 RPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           RPS+L  I+ G NPTG  ++ E  ARI  +A KY   ++ D+ Y
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 123/292 (42%), Gaps = 39/292 (13%)

Query: 202 YTASASLFNAQ---VLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG-NPT 257
           +++S S   AQ   V P  LDE         ++E ++ +  E   +P +L  +  G NPT
Sbjct: 166 FSSSISAAEAQGVNVFPIPLDEH---GIIPSKLETILDNWTEGAAKPKLLYTVPTGQNPT 222

Query: 258 GAVLTEETIARICLIAAKYGIAVISDEVY------------QENVFNDFKFHSMKKVLRK 305
           G+ L+ +    I  IA K+   +I DE Y               V   +  H  K+ ++ 
Sbjct: 223 GSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYADH--KEFIQN 280

Query: 306 LQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVV 365
           L+  +       ++  L S+SK      G R G+  IVG ++DI   +  L  ++I +  
Sbjct: 281 LEKSFVSIDTEGRVLRLDSLSKVLA--PGTRFGW--IVG-AKDILARILSLQEMTIQAPA 335

Query: 366 T-GQAIVDLMVNPPQPGDESYEQD----RQERSKIFNEMRTRANLLYETFNGLEGIECQN 420
              Q+I+   +N  + G E Y       R E +K   +     + LY+    ++ I+   
Sbjct: 336 GFTQSIIAGTMN--RWGQEGYLDWLIGLRHEYTK---KRDCCIDALYKYLPQVDYIKINP 390

Query: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLES--TGICTVPGSGF 470
           P   M+ F   I   K    + + G +P++   A    S  +G+  VPG+ F
Sbjct: 391 PIAGMF-FTVNIDASKHPEFATKYGSDPEKVEKAIFDRSIASGVLVVPGNWF 441

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 224 WSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISD 283
           W+ + D+    + +      +   +I+ +P NPTG V T E +  +  I  +  + +ISD
Sbjct: 168 WTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICVEKNVYIISD 221

Query: 284 EVYQENVF 291
           EVY+   F
Sbjct: 222 EVYENLYF 229

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256
           P Y   ++  S+F A V   +L+ E  ++    +++  V+           +++ NP NP
Sbjct: 113 PTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVR------ANTKYIVLNNPNNP 166

Query: 257 TGAVLTEETIARICLIAAKYGIAVISDEVY 286
            G+V++ E +  I   A +  I ++ DEVY
Sbjct: 167 LGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 235 VQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
            QD  +K  R  + +V    NPTGA+ +  +  ++  +A KY I +ISD+VY
Sbjct: 178 AQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 66/145 (45%), Gaps = 27/145 (18%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIE---KVVQDALEKGIRPSVLIVINP 253
           P Y +Y+  AS+ + +++      +C   T  +  +   + V D L+K     ++ + +P
Sbjct: 117 PTYGMYSVCASVNDVEIV------KCPLVTSDNSFQVDTEAVLDTLKKDPLIKLVFITSP 170

Query: 254 GNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGK 313
           GNPTGA +    I +I L     GI V+ DE Y      DF   S   ++ K    YP  
Sbjct: 171 GNPTGAKIETSRIEKI-LQNWDQGILVV-DEAYI-----DFCGGSTAPLVNK----YP-- 217

Query: 314 FDNVQLASLHSISKGFMGECGQRGG 338
                + +L ++SK F G  G R G
Sbjct: 218 ----NICTLQTLSKSF-GLAGIRVG 237

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG-N 255
           YT S+S++ A+     V P  LD +       + +E ++ +      +P +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGINVFPVPLDAD---GLIPERLEAILDNWNPDTAKPKLLYTIPTGQN 221

Query: 256 PTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           PTG+ L+++    I  IA K+ + +I DE Y
Sbjct: 222 PTGSSLSDDRKVEIYRIAKKHDLLIIEDEPY 252

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 2/63 (3%)

Query: 226 TESDEIEKVVQD-ALEKGIRPSVLIVINP-GNPTGAVLTEETIARICLIAAKYGIAVISD 283
           ++ D   +++Q  AL K I   VL  I    NP+G   + ET  R+  IA KY + VISD
Sbjct: 165 SQPDSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISD 224

Query: 284 EVY 286
           +VY
Sbjct: 225 DVY 227

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           +++E+++ +  E   +P +L  I  G NPTG+ L+++   +I  +A K+   +I DE Y
Sbjct: 191 EKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 27/157 (17%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEECNWSTESDEIEKVV-QDALEKG 242
           C  ++  +L+  P Y +Y+  A++ +  V+    + E+ ++  ++ EI  ++  D L K 
Sbjct: 107 CVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNSFQIDATEILNILANDPLIK- 165

Query: 243 IRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIA-VISDEVYQENVFNDFKFHSMKK 301
               ++ + +PGNPTGA +    I RI  +   +    VI DE Y      DF   S   
Sbjct: 166 ----LVFITSPGNPTGAKI---EIDRIEYLLKNWDQGLVIVDEAYI-----DFSGGSTAP 213

Query: 302 VLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGG 338
           ++ K    YP       L +L ++SK F G  G R G
Sbjct: 214 LVTK----YP------NLVTLQTLSKSF-GLAGIRLG 239

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 72/165 (43%), Gaps = 30/165 (18%)

Query: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE---KGIRPSVL 248
           L++P P Y +Y+  A + + +V+      EC   TE +  +  + + LE         +L
Sbjct: 116 LVLP-PTYSMYSVFAMINDTEVV------ECPLITEDNSFDMDLDNVLETLSNDDSIKLL 168

Query: 249 IVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQH 308
            +  PGNPTGA ++ + I  + L     GI V+ DE Y      DF   S       L +
Sbjct: 169 FITTPGNPTGASISTQKI-EMLLNNWSAGIVVV-DEAYI-----DF---SSSDSAAPLVN 218

Query: 309 CYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDAL 353
            YP       L  + ++SK F G  G R G   +   S+DI   L
Sbjct: 219 KYP------NLVVIQTLSKSF-GLAGVRLG---LTFASEDISKVL 253

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 95/221 (42%), Gaps = 37/221 (16%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDAL---EK 241
           C   +  +L+  P Y +Y+  A++ + +V+      +C  +   +  +   + AL   + 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDVEVV------QCPLTVSDNSFQMDTEAALTILKN 161

Query: 242 GIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKK 301
                ++ V +PGNPTGA +    I +I L   + G+ V+ DE Y      DF   S   
Sbjct: 162 DPLIKLIFVTSPGNPTGAKIKTCLIEKI-LQNWENGLVVV-DEAYI-----DFCGGSTAP 214

Query: 302 VLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISI 361
           ++ K    YP       L +L ++SK F G  G R G         +I +A+    +IS 
Sbjct: 215 LVTK----YP------NLVTLQTLSKSF-GLAGIRLGMTYATSDLANILNAMKAPYNIS- 262

Query: 362 CSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTR 402
            S+ +  A+        +   +S  Q  +  SK+ NE + R
Sbjct: 263 -SLASEYAL--------KAVQDSSLQKMEATSKLINEEKMR 294

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 112/275 (40%), Gaps = 40/275 (14%)

Query: 161 PATPEDIYXXXXXXXXXXXXXXXXCKDTRTGLLIPIPQYPLYTASASLFNAQVL--PYYL 218
           P T E+I                 C  ++  ++I  P Y +Y+  A + +   +  P   
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 219 DEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGI 278
           ++       S  +E + QD   K     ++ + +PGNPT A++    I ++  +    G 
Sbjct: 144 EDNSFQMDTSKVLETLAQDPTIK-----LIFITSPGNPTAALIDTAEIEKV--LNNWTGG 196

Query: 279 AVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGG 338
            V+ DE Y      DF   S   ++ K    YP       LA + ++SK F G  G R G
Sbjct: 197 LVVVDEAYI-----DFCGGSTTPLVNK----YP------NLAVIQTMSKSF-GLAGVRLG 240

Query: 339 YMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNE 398
              +   S  I   L  + +    S +T +  +  +    QP +    ++ +  +K+ NE
Sbjct: 241 ---LAFTSTQISRVLNSMKAPYNISAMTSEVCLRAL----QPDN---LENMEYTAKLINE 290

Query: 399 MRTRANLLYETFNGLEGIECQNPQG--AMYLFPRL 431
            ++R   + +    LE +E ++  G  A ++  RL
Sbjct: 291 QKSR---VLKELTSLEYVENEHIGGLDANFILIRL 322

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 104/239 (43%), Gaps = 42/239 (17%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIE---KVVQDALEK 241
           C   +  +L+  P Y +Y+  A++ + +V+      +C      +  +   + V   LE 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDIEVV------QCPLVVSDNSFQMDVEAVLTILEN 161

Query: 242 GIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKK 301
                ++ V +PGNPTGA +    I ++ L   + G+ V+ DE Y      DF   S   
Sbjct: 162 DPLIKLVFVTSPGNPTGAKIKTSLIEQV-LQNWQNGLVVV-DEAYI-----DFCGGSTAP 214

Query: 302 VLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMS-IS 360
           ++ K    YP       L +L ++SK F G  G R G   +   S+D+   L  + +  +
Sbjct: 215 LVTK----YP------NLVTLQTLSKSF-GLAGIRLG---MTYASKDLAKILNAMKAPYN 260

Query: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQ 419
           I S+    A+  +        D +  +  ++ +K+ NE +TR   L +    LE ++ Q
Sbjct: 261 ISSLAAEHALTAVQ-------DHNLTK-MEDTAKLINEEKTR---LLKALTALEYVDDQ 308

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG-N 255
           YT S+S++ A+     V P  LD +       + +E ++ +   +  +P +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGVNVFPVPLDAD---GLIPERLEAILDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           PTG+ L+++    I  IA K+   +I DE Y
Sbjct: 222 PTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 25/156 (16%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECN-WSTESDEIEKVVQ-DALEKG 242
           C   +  +L   P Y +Y+  A++ + +VL   L  E N +  +S ++  ++  D L K 
Sbjct: 107 CVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNSFQPDSQKVISILSSDPLIK- 165

Query: 243 IRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKV 302
               ++ + +PGNPTGA +    I +I  + +  G  V+ DE Y      DF   S   +
Sbjct: 166 ----LVFLTSPGNPTGAKIDSNIIIKI--LESWDGGFVVVDEAYI-----DFCGGSTAPL 214

Query: 303 LRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGG 338
           + K    YP       L +L ++SK F G  G R G
Sbjct: 215 VTK----YP------NLITLQTLSKSF-GLAGIRLG 239

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 235 VQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
            Q   +K  R  + +V    NPTGA+ +  +  ++  +A KY I +ISD+VY
Sbjct: 179 AQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 4/110 (3%)

Query: 240 EKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSM 299
           +K  R  + +V    NP+G   +  T  ++  +A KY I +ISD+VY   V+ D    ++
Sbjct: 184 KKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVY-DQPCDAL 242

Query: 300 KKVLRKLQHCYPGKFDNVQLASLHSISKGFMGEC---GQRGGYMEIVGFS 346
            K L +L H     ++  +    ++IS     +    G R GY E V  +
Sbjct: 243 PKCLPRLTHLDRASYEYGENGYGNTISNATFSKVIAPGLRCGYQESVNMN 292

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           +++EK++ +      RP +L  I  G NPTG  L ++    I  IA K+   +I DE Y
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 25/156 (16%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECN-WSTESDEIEKVVQ-DALEKG 242
           C   +  +L+  P Y +Y+  A + + +++   L  + N +  +++ +  V+Q D L K 
Sbjct: 109 CVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNSFQMDTESVLTVLQNDPLIK- 167

Query: 243 IRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKV 302
               +L + +PGNPTGA +  E I  + L     G+ V+ DE Y      DF   S   +
Sbjct: 168 ----LLFITSPGNPTGARIETERIETV-LQNWTDGLVVV-DEAYI-----DFCGGSTAPL 216

Query: 303 LRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGG 338
           + K    YP       L +L ++SK F G  G R G
Sbjct: 217 VTK----YP------NLVTLQTLSKSF-GLAGIRLG 241

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 204 ASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLT 262
           ASA        P  +DE        +++E+++ +      +P +L  I  G NPTG  L 
Sbjct: 169 ASAEAQGITTFPIPIDEH---GIIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLA 225

Query: 263 EETIARICLIAAKYGIAVISDEVY 286
           +E    I  IA K+   +I DE Y
Sbjct: 226 DERKVEIYRIACKHDFLIIEDEPY 249

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 112/251 (44%), Gaps = 40/251 (15%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLD-EECNWSTESDEIEKVVQ-DALEKG 242
           C   +  +L+  P Y +Y+  A++ + +V+   L   + ++  +++ +  +++ D+L K 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDSLIK- 166

Query: 243 IRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKV 302
               ++ V +PGNPTGA +    I ++ L     G+ V+ DE Y      DF   S   +
Sbjct: 167 ----LMFVTSPGNPTGAKIKTSLIEKV-LQNWDNGLVVV-DEAYV-----DFCGGSTAPL 215

Query: 303 LRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISIC 362
           + K    YP       L +L ++SK F G  G R G          I +A+    +IS  
Sbjct: 216 VTK----YP------NLVTLQTLSKSF-GLAGIRLGMTYATAELARILNAMKAPYNIS-- 262

Query: 363 SVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQ 422
           S+ +  A+        +   +S  +  +  SKI NE + R   L +    L+ ++ Q   
Sbjct: 263 SLASEYAL--------KAVQDSNLKKMEATSKIINEEKMR---LLKELTALDYVDDQYVG 311

Query: 423 G--AMYLFPRL 431
           G  A +L  R+
Sbjct: 312 GLDANFLLIRI 322

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           +++E ++ +  E   +P +L  I  G NPTG+ L  E    I  IA K+   +I DE Y
Sbjct: 191 EKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 4/92 (4%)

Query: 255 NPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKF 314
           NP+G+  + ET  R+  +A +Y + +ISD++Y    + D     + + L  L H      
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIYDLLAY-DQPSDQLPRALPSLVHVDRATL 249

Query: 315 DNVQLASLHSISKGFMGEC---GQRGGYMEIV 343
           +  Q +  H+++     +    G R GY E V
Sbjct: 250 NEEQDSWGHTVANASFSKIVAPGLRCGYQESV 281

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 55/131 (41%), Gaps = 16/131 (12%)

Query: 216 YYLDEECNWSTESDEIEKVVQDALEKGIRP---SVLIVINPGNPTGAVLTEETIARICLI 272
           YY D   +  +   ++E+   D      RP    +L+     NPTG   T E  +RI  +
Sbjct: 190 YYEDGAVDVDSWLAQLERAAAD------RPYPQCILLHACCHNPTGVDPTREQWSRILSV 243

Query: 273 AAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGE 332
               G+  I D  YQ     D +  +       L+ C   ++DN  L   HS +K  MG 
Sbjct: 244 INGLGMVPIVDMAYQGLESGDLRADAY-----LLRMCLEHRWDN-GLYVCHSFAKN-MGL 296

Query: 333 CGQRGGYMEIV 343
            G+R G + +V
Sbjct: 297 YGERVGSLSVV 307

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           +++E ++ +      +P +L  I  G NPTG+ L++E    I  IA K+   +I DE Y
Sbjct: 191 EKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 6/68 (8%)

Query: 220 EECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIA 279
           E  +W  + + +     D      +  ++I+ NP NP G V   + +  +  +    G  
Sbjct: 163 EANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 280 VISDEVYQ 287
           +I+DEVY+
Sbjct: 217 IIADEVYE 224

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 71/155 (45%), Gaps = 23/155 (14%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECN-WSTESDEIEKVVQDALEKGI 243
           C   +  +L+  P Y +Y+  A++ + +V+   L  E N +   SD+    V D L+   
Sbjct: 108 CVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNSFQLNSDK----VLDILKNDP 163

Query: 244 RPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVL 303
              ++ + +PGNPTG  +  + I ++ L     G+ V+ DE Y      DF   S+  ++
Sbjct: 164 LIKLVFITSPGNPTGVKIETKRIEKV-LQNWDNGLVVV-DEAYI-----DFCGGSLAPLV 216

Query: 304 RKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGG 338
            + Q+          L  L ++SK F G  G R G
Sbjct: 217 TQYQN----------LIVLQTLSKSF-GLAGIRLG 240

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 105/259 (40%), Gaps = 42/259 (16%)

Query: 185 CKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIE---KVVQDALEK 241
           C   +  +L+  P Y +Y+  A++ + +V+      +C  +   +  +   + V   L  
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDVEVV------QCPLTVSDNSFQMNTEAVLTILNN 161

Query: 242 GIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKK 301
                ++   +PGNPTGA +    I  + L     GI V+ DE Y      DF   S   
Sbjct: 162 DPLIKIMFATSPGNPTGAKIKTCLIEEV-LQKWDNGIVVV-DEAYV-----DFCGGSTAP 214

Query: 302 VLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISI 361
           ++ K    YP       L +L ++SK F G  G R G          I +A+    +IS 
Sbjct: 215 LVTK----YP------NLVTLQTLSKSF-GLAGIRLGMTYATAELAKILNAMKAPYNIS- 262

Query: 362 CSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNP 421
            S+ +  A+        +   ES  +  +  SK+ NE + R   L +    L+ ++ Q  
Sbjct: 263 -SLASEYAL--------KAVQESNLRKMEATSKVINEEKMR---LLKELTSLDYVDDQYV 310

Query: 422 QG--AMYLFPRLILPDKAF 438
            G  A +L  R+   D A 
Sbjct: 311 GGLDANFLLIRINGGDNAL 329

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 20/148 (13%)

Query: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVI 251
           +L+P P Y +Y   A + +   +   L    N S + DE   + Q  L+K I+  V+ + 
Sbjct: 116 MLLP-PTYGMYKVCADINDVGYVEVPLISSDN-SFQIDEDRILEQLNLDKSIK--VVFIT 171

Query: 252 NPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYP 311
           +PGNPTGA +    + ++ L     GI V+ DE Y         F + K  L  L + +P
Sbjct: 172 SPGNPTGACIEVGRVEKL-LRNWTAGIVVV-DEAY-------IDFSADKPSLSPLVNKHP 222

Query: 312 GKFDNVQLASLHSISKGFMGECGQRGGY 339
                  L  L ++SK   G  G R G+
Sbjct: 223 ------NLVVLQTLSKA-SGLAGIRLGF 243

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 226 TESDEIEKV--VQD---ALEKGIRPSVLIVI-NPGNPTGAVLTEETIARICLIAAKYGIA 279
           TE ++ EK+  + D   A+ K I   V+  I    NPTG   + ET  ++  IA KY + 
Sbjct: 167 TEEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDML 226

Query: 280 VISDEVY 286
           +I+D+VY
Sbjct: 227 IIADDVY 233

>Smik_9.154 Chr9 complement(257229..259199) [1971 bp, 656 aa] {ON}
           YIL037C (REAL)
          Length = 656

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 51/130 (39%), Gaps = 16/130 (12%)

Query: 381 GDESYEQDRQERSKIFNEMRTRANLLYETF-----NGLEGIECQNPQGAMYLFPRLILPD 435
             +S E   +  S IFN++ +++NL+ ET+     N +   E    Q A  LF    + D
Sbjct: 155 ATDSIENVLEVNSTIFNDLFSKSNLINETWNEISENAMTIDEDSVSQMASNLFLNYSMFD 214

Query: 436 KAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWK 495
             F+   R  V    F         G  T      G    T  +   FL   T W+Q  K
Sbjct: 215 GIFQNYSRKLVSLQMF--------NGTITDFSIQLG---STGALNLGFLRNSTDWVQLKK 263

Query: 496 NFHQSFFNEY 505
           NF  S  NE+
Sbjct: 264 NFTTSLQNEF 273

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 82/192 (42%), Gaps = 22/192 (11%)

Query: 202 YTASASLFNAQ---VLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPG-NPT 257
           Y++S    +AQ    +P  LD E     + +E+     D       P +L  I  G NPT
Sbjct: 164 YSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPT 223

Query: 258 GAVLTEETIARICLIAAKYGIAVISDEVY---QENVFNDFKFHSMKKVLRKLQHC-YPGK 313
           G  L++     I  +A KY + +I DE Y   Q + +   +    +   R + H  + G 
Sbjct: 224 GCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGS 283

Query: 314 FDNV--------QLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVV 365
                       ++  L S+SK F   C  R G++  VG S+ + D  + L  +SI S  
Sbjct: 284 LGKSFLELDVEGRVVRLDSVSKTFAPGC--RMGWL--VG-SKHLLDNYWNLHEVSIQSTC 338

Query: 366 T-GQAIVDLMVN 376
              Q+I+  ++N
Sbjct: 339 GFAQSILGGILN 350

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 74/179 (41%), Gaps = 31/179 (17%)

Query: 213 VLPYYLDEE-CNWSTESDEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARIC 270
           ++P  L+E   NWS+   E+             P +L  I  G NPTG  L++     I 
Sbjct: 188 IVPSKLEEMLANWSSLYGEMP-----------MPKLLYTIPTGQNPTGCTLSDNRKPHIY 236

Query: 271 LIAAKYGIAVISDEVY-----QENVFNDFKFH-------SMKKVLRKLQHCYPGKFDNVQ 318
            +A +Y I +I D+ Y        V  D +         S    +  L   +     + +
Sbjct: 237 RLAQQYDIIIIEDDPYYFLQMDPYVSEDARLETAEASTMSQATFMNSLNRSFLELDTDGR 296

Query: 319 LASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVT-GQAIVDLMVN 376
           +  L S+SK F   C  R G++  VG S+ + D  + L  +SI S     Q I+  ++N
Sbjct: 297 VVRLESVSKTFAPGC--RMGWL--VG-SKHLLDNYWNLHEVSIQSTCGFAQTILSGILN 350

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 237 DALEKGIRPSVLIVI-NPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDF 294
           D   +G  P +L  I N  NPTG  L EE    +  +A++Y   +I D+ Y     N+F
Sbjct: 197 DVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEF 255

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 237 DALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           D  +K  R  + +V    NP+GA  ++E   ++  +A +Y I +ISD+VY
Sbjct: 182 DDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVY 231

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           +++ KV+++      +P +L  I  G NPTG  + +     I  IA KY   ++ DE Y
Sbjct: 193 EKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPY 251

>TPHA0D01620 Chr4 complement(337644..339878) [2235 bp, 744 aa] {ON}
           Anc_2.268 YNL045W
          Length = 744

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 50/107 (46%), Gaps = 18/107 (16%)

Query: 194 IPIPQYPLYTASASLFNAQV--------LPYYLDEECNWSTESDEIEKVVQDALEKGIRP 245
           +PIP Y +  AS +L NA++         P+ LD +C W    D +EK ++ A EK + P
Sbjct: 317 VPIPAYLVGIASGNLVNAEIGPRSKVYCEPFRLD-DCKWEFSGD-VEKFIK-AAEKIVFP 373

Query: 246 ------SVLIVINPGNPTGAVLTEETIARICLIAA-KYGIAVISDEV 285
                  +L+ +N     G      T A   LIA  K  I VI+ E+
Sbjct: 374 YEWGSYDILVNVNSYPYGGMESPNMTFATPTLIAYDKSNIDVIAHEL 420

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 7/131 (5%)

Query: 217 YLDEECNWSTESDEIEKVVQ-DALEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAK 275
           Y D   N    S E++ +   +A +K  R  + +V    NP G   + ET  ++  +A K
Sbjct: 160 YFDSISN--DNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARK 217

Query: 276 YGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISKGFMGEC-- 333
           + + ++SD+VY    ++D     +   L +L H     + +      ++IS     +   
Sbjct: 218 HDMLIVSDDVYDLLRYDD-SLDELPHPLPRLTHVDRMSYKHGDSGYGNTISNATFSKIIA 276

Query: 334 -GQRGGYMEIV 343
            G R GY E V
Sbjct: 277 PGLRFGYQETV 287

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 254 GNPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
            NP+G   T ET  R+  IA KY + +++D+VY
Sbjct: 204 ANPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>TDEL0E01030 Chr5 (210699..213857) [3159 bp, 1052 aa] {ON} Anc_4.267
           YDL073W
          Length = 1052

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 279 AVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLASLHSISK 327
            V++ E+  E VF  F    M + LR L  C+P       L SLH  S+
Sbjct: 388 TVLTTEMINEFVFTHFSILRMWECLRSLSGCFPNDPSMTSLLSLHDSSQ 436

>KLLA0F03377g Chr6 complement(317185..318615) [1431 bp, 476 aa] {ON}
           similar to uniprot|P41814 Saccharomyces cerevisiae
           YNL062C GCD10 Subunit of tRNA (1-methyladenosine)
           methyltransferase with Gcd14p required for the
           modification of the adenine at position 58 in tRNAs
           especially tRNAi-Met first identified as a negative
           regulator of GCN4 expression
          Length = 476

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 12/132 (9%)

Query: 258 GAVLTEETIARICLIA--AKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFD 315
           G+V+ E ++A I  +   A  G A+IS  +     F+    HS +K L++ +  +  KF 
Sbjct: 111 GSVVQEMSMAEIEAMKREAASGDAIISKMIESHKSFHQKTVHSQEKYLKRKKQKF-AKFF 169

Query: 316 NVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS-----ICSVVTGQAI 370
            V+       S G +    ++G  + ++  SQ+       L +I+     +C   TG  I
Sbjct: 170 TVEYLD----SSGLLHYLIEKGDVLRVMDISQESLGMALNLANINSNGQYLCIDETGGLI 225

Query: 371 VDLMVNPPQPGD 382
           V  M+     GD
Sbjct: 226 VYAMLERMFAGD 237

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 254 GNPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
            NP+G   + ET  R+  IA KY + VI+D+VY
Sbjct: 202 ANPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>KLTH0H06666g Chr8 (586283..588313) [2031 bp, 676 aa] {ON} similar
           to uniprot|P38315 Saccharomyces cerevisiae YBR216C YBP1
           and to uniprot|P53169 Saccharomyces cerevisiae YGL060W
           YBP2
          Length = 676

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 17/79 (21%)

Query: 272 IAAKYGIAVISDEVYQENVFN----------DFKFHSMKKV----LRKLQHCYPGKFDNV 317
           I+ K   A I+ EV  EN+ N          + KFH++ ++    LR++  CYP KF  +
Sbjct: 156 ISLKKQEAQIAPEVLAENIHNHNRSPEEVSLEVKFHALLELVGTTLRRIDTCYPSKFLAM 215

Query: 318 QLASLHS---ISKGFMGEC 333
            ++++ +   ++  F+ +C
Sbjct: 216 AVSAIFNFVRLNASFVDDC 234

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 9/79 (11%)

Query: 230 EIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVYQE 288
           ++E ++ +      +P +L  I  G NPTG  L +E    I  IA K+   +I D  Y  
Sbjct: 193 KLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDAPYY- 251

Query: 289 NVFNDFKFHSMKKVLRKLQ 307
                  F  M K  R LQ
Sbjct: 252 -------FLQMDKYERDLQ 263

>KLTH0D03322g Chr4 complement(314732..316684) [1953 bp, 650 aa] {ON}
           similar to uniprot|P32477 Saccharomyces cerevisiae
           YJL101C GSH1 Gamma glutamylcysteine synthetase catalyzes
           the first step in the gamma-glutamyl cycle for
           glutathione (GSH) biosynthesis expression induced by
           oxidants cadmium and mercury
          Length = 650

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 444 LGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNW 494
           L V+ D+  CA   E  G+C    + F  + G Y +  T   P T ++ N+
Sbjct: 67  LAVDDDDVLCALNTEDVGVCQAHNTSFHPEYGRYMIEATPARPYTGFMSNY 117

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 254 GNPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
            NP+G   + ET  R+  IA KY + +I+D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALEKGIRPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           +++EK++ +      +P +L  I  G NPTG  L    +  I  IA K+   ++ D  Y
Sbjct: 192 EKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDAPY 250

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 244 RPSVLIVINPG-NPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDF-KFHSMKK 301
           +P +L  I  G NPTG+ L  E  +++  IA K+   ++ DE Y      D+ K  S++K
Sbjct: 206 KPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPYYFLQMEDYVKDPSLRK 265

Query: 302 VLRKLQH 308
            + KL H
Sbjct: 266 EV-KLSH 271

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 239 LEKGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVY 286
           L+K  +  + ++    NP+G     ET  ++  +A KY + +I+D+VY
Sbjct: 189 LKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDMLIITDDVY 236

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 236 QDALEKGIRPSVLIVI-NPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDF 294
           ++ L+K I   V   I    NP+G     ET  ++  IA KY + +I D+VY    +N F
Sbjct: 174 KNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVYDLLDYN-F 232

Query: 295 KFHSMKKVLRKLQH 308
             ++   V  +L H
Sbjct: 233 DSNATSNVAPRLVH 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,433,249
Number of extensions: 2304009
Number of successful extensions: 6160
Number of sequences better than 10.0: 118
Number of HSP's gapped: 6229
Number of HSP's successfully gapped: 118
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)