Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3718.262ON58058028320.0
Suva_2.2708.262ON63258324250.0
Smik_4.3568.262ON57658023910.0
YDR110W (FOB1)8.262ON56658023610.0
KAFR0B055408.262ON5193648181e-102
TDEL0F038908.262ON4763698051e-100
NCAS0B038508.262ON5885257714e-94
SAKL0H17028g8.262ON5503387483e-91
ZYRO0C01650g8.262ON5863677131e-85
NDAI0J013808.262ON6244067072e-84
Kwal_56.237998.262ON4883376912e-83
KLTH0G13684g8.262ON5083376904e-83
Ecym_43088.262ON5293406698e-80
KLLA0F19140g8.262ON5273466428e-76
Kpol_392.68.262ON4573376342e-75
AGR086C8.262ON5343376262e-73
Kpol_543.388.262ON4423636158e-73
KNAG0H032408.262ON5193695921e-68
CAGL0B01771g8.262ON5363895834e-67
TBLA0E044308.262ON4814124869e-54
TPHA0J007408.262ON4083334204e-45
TPHA0A018108.262ON4573714076e-43
TBLA0F030708.262ON4453733998e-42
NDAI0B06160singletonON140394920.017
NDAI0G00600singletonON48892900.026
NDAI0G00550singletonON41256870.051
Kpol_1035.3singletonON1130107800.43
Kpol_2000.35singletonON704149770.88
Kwal_36.16338singletonON60499771.1
Kwal_27.11219singletonON74499761.5
Kwal_39.16409singletonON73499751.6
KLTH0D01738g7.53ON29133732.3
Kwal_33.15089singletonON47899733.1
Smik_4.408.447ON18869703.3
NDAI0D004107.483ON320103714.2
Kwal_27.12438singletonON64199724.2
Kwal_13.691singletonON86599724.4
Suva_9.2392.651ON97144724.6
Kwal_54.19470singletonON54299714.8
Kwal_60.24910singletonON52499706.1
YIR023W (DAL81)2.651ON97044706.4
Kwal_26.7891singletonON31099696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.371
         (580 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...  1095   0.0  
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   938   0.0  
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   925   0.0  
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   914   0.0  
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   319   e-102
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   314   e-100
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   301   4e-94
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   292   3e-91
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   279   1e-85
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   276   2e-84
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   270   2e-83
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   270   4e-83
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   262   8e-80
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   251   8e-76
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   248   2e-75
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   245   2e-73
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   241   8e-73
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   232   1e-68
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   229   4e-67
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   191   9e-54
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   166   4e-45
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   161   6e-43
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   158   8e-42
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            40   0.017
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    39   0.026
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    38   0.051
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    35   0.43 
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...    34   0.88 
Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A ...    34   1.1  
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...    34   1.5  
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...    33   1.6  
KLTH0D01738g Chr4 (170277..171152) [876 bp, 291 aa] {ON} similar...    33   2.3  
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...    33   3.1  
Smik_4.40 Chr4 complement(78729..79295) [567 bp, 188 aa] {ON} YD...    32   3.3  
NDAI0D00410 Chr4 (86277..87239) [963 bp, 320 aa] {ON}                  32   4.2  
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...    32   4.2  
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...    32   4.4  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    32   4.6  
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...    32   4.8  
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...    32   6.1  
YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Posit...    32   6.4  
Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON...    31   6.7  

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/580 (91%), Positives = 533/580 (91%)

Query: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60
           MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA
Sbjct: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60

Query: 61  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120
           YVDSY            TPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE
Sbjct: 61  YVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120

Query: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180
           NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH
Sbjct: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180

Query: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240
           FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE
Sbjct: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240

Query: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300
           GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD
Sbjct: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300

Query: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXX 360
           ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPY     
Sbjct: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRR 360

Query: 361 XXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420
                   PAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL
Sbjct: 361 RNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480
                                 DFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL
Sbjct: 421 ANEAENNGNNNRNHPDNNFGNDDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480

Query: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEETDGTRQADPQVDQSVE 540
           TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEETDGTRQADPQVDQSVE
Sbjct: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEETDGTRQADPQVDQSVE 540

Query: 541 ITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580
           ITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL
Sbjct: 541 ITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/583 (79%), Positives = 486/583 (83%), Gaps = 4/583 (0%)

Query: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60
           M   RY G LFDD  DSLPS S   KSSPQ RKTTSPRESRE LKDRLLILP MGESYT 
Sbjct: 51  MAKLRYKGTLFDDEGDSLPSESAKSKSSPQRRKTTSPRESRESLKDRLLILPLMGESYTE 110

Query: 61  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120
           YVDSY            TPIFLESLTRQLTQ+IYELIKTKSLTA+TLQQISDKYDGV AE
Sbjct: 111 YVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAE 170

Query: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180
           NKLLFL+RQYYVDNEGNVRD RNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH
Sbjct: 171 NKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 230

Query: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240
           FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEP+ G AIE
Sbjct: 231 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIE 290

Query: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300
           GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFLSFAR+PIFVTSSTLDKDDLYD
Sbjct: 291 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYD 350

Query: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXX 360
           ICEEIASKYGL IGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPY     
Sbjct: 351 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRR 410

Query: 361 XXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420
                   P QVLLSEVPGHNAKFETKRERVIENTY+RNMF MAGGKGLIYLEDVNTFAL
Sbjct: 411 RNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFAL 470

Query: 421 XXXXXXXXXXXXXXXXXXXXXXDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480
                                 +FEEEVQKQFDLTEQNYIDEYDDLAHDSSEGE+EP+TL
Sbjct: 471 -VNEGESSNNNENLNNTNIGNDNFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTL 529

Query: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHN-IEETDGTR--QADPQVDQ 537
           TPEE  SH VEE+RI STSETTDLDGNTK+E DE EE N N +E  +     Q +   D+
Sbjct: 530 TPEENTSHNVEEERIESTSETTDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDR 589

Query: 538 SVEITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580
           SVEIT P+TSYYQT   PS KRQK+ +Q HGD+TRDFG SMEL
Sbjct: 590 SVEITSPETSYYQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  925 bits (2391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/580 (78%), Positives = 485/580 (83%), Gaps = 4/580 (0%)

Query: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60
           MT  RYNG LFDD DDSLPS S TRK+  Q RK TS RESR+  KDRLLILPSMGESYT 
Sbjct: 1   MTKPRYNGVLFDD-DDSLPSESATRKAPSQGRKATSSRESRDSSKDRLLILPSMGESYTE 59

Query: 61  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120
           YVDSY            TPIFLESLTRQLTQ+IYELIKTKSLTADTLQQISDKYDGVVAE
Sbjct: 60  YVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 119

Query: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180
           NKLLFLQRQYYVD+EGNVRDGRNNDKIYCEP HIYDMVMATHL+NKHLRGKTLHSFLFS+
Sbjct: 120 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSY 179

Query: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF+G  IE
Sbjct: 180 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIE 239

Query: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD
Sbjct: 240 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 299

Query: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXX 360
           ICEEIASKYGL IGLGLKSSARFHTGGILCI YALNSYKEECLADWGKCLRYGPY     
Sbjct: 300 ICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRR 359

Query: 361 XXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420
                   PAQVLLSE+PGHNAKFETKRERVIENTYSRNMFK AGGKGLIYLEDVNTFAL
Sbjct: 360 RNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFAL 419

Query: 421 XXXXXXXXXXXXXXXXXXXXXXDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480
                                 +FEEEVQKQFDLTEQNYIDEYDDLAH+SSEGEF P+TL
Sbjct: 420 -ANKADNSYNNGSSHNNDVDNDNFEEEVQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTL 478

Query: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEETDGTRQADPQVDQSVE 540
           TPEEK + I EE+RIGS S    L+ NT+QE+ E E+ +   ++ D T Q +P+VDQS+E
Sbjct: 479 TPEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQ--KDADATPQTEPEVDQSLE 536

Query: 541 ITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580
           I +P+TSY+QT  SPS KRQKL+QQ HGDVTRDFG SMEL
Sbjct: 537 IAKPETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/580 (79%), Positives = 480/580 (82%), Gaps = 14/580 (2%)

Query: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60
           MT  RYN  LFDD DDS+PS SVTRKS  Q RK TSP ESRE  KDRLLILPSMGESYT 
Sbjct: 1   MTKPRYNDVLFDD-DDSVPSESVTRKS--QRRKATSPGESRESSKDRLLILPSMGESYTE 57

Query: 61  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120
           YVDSY            TPIFLESLTRQLTQ+IYELIKTKSLTADTLQQISDKYDGVVAE
Sbjct: 58  YVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 117

Query: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180
           NKLLFLQRQYYVD+EGNVRDGRNNDKIYCEPKH+YDMVMATHLMNKHLRGKTLHSFLFSH
Sbjct: 118 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSH 177

Query: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF G AIE
Sbjct: 178 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIE 237

Query: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFL+FARVPIFVTSSTLDKDDLYD
Sbjct: 238 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYD 297

Query: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXX 360
           ICEEIASKYGL IGLGLKSSARFHTGGILCIQYALNSYK+ECLADWGKCLRYGPY     
Sbjct: 298 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRR 357

Query: 361 XXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420
                   P QVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL
Sbjct: 358 RNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 417

Query: 421 XXXXXXXXXXXXXXXXXXXXXXDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480
                                 +FEEEVQKQFDLTE+NYIDEYDDLAHDSSEGEFEPNTL
Sbjct: 418 ANEADNSCNNNGILHNNNIGNDNFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTL 477

Query: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEETDGTRQADPQVDQSVE 540
           TPEEK  H V+E RI ST     + G      +EPE+ +   +E+DG      QVDQSVE
Sbjct: 478 TPEEKPPHNVDEDRIESTGVAAPMQG-----TEEPEKGDQ--KESDGA----SQVDQSVE 526

Query: 541 ITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580
           ITRP+TSYYQT  SPS KRQKL+QQ +GD TRDFG SMEL
Sbjct: 527 ITRPETSYYQTLESPSTKRQKLDQQGNGDQTRDFGTSMEL 566

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  319 bits (818), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 152/364 (41%), Positives = 228/364 (62%), Gaps = 2/364 (0%)

Query: 50  ILPSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQ 109
           I+P MGESYT+Y DS+               F +S+   LT++ Y+LI+T SLT +TL  
Sbjct: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107

Query: 110 ISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLR 169
            + K+  + AE + LFL+R+YY DN G + D    DKI CEP +++DM+M  HLMN H  
Sbjct: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167

Query: 170 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 229
            K +H  L + ++N +  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227

Query: 230 VFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 289
           +FEPF    IE KY ++L CRDY S ++W+LPLK+TKFKHL+P ++SLFLSF R PIF+ 
Sbjct: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287

Query: 290 SSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 349
           +++LD  D++DICE+IA +Y L IGLG      FH  GI  ++  L +++EECL  W  C
Sbjct: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347

Query: 350 LRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 409
           L+YG Y             P  +L S++   + KF+ K  +++EN  S ++ ++    GL
Sbjct: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405

Query: 410 IYLE 413
           I+LE
Sbjct: 406 IFLE 409

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 154/369 (41%), Positives = 223/369 (60%), Gaps = 3/369 (0%)

Query: 49  LILPSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQ 108
            + PSMGESY  Y +SY               + ES+  Q+   IYELI+T SLT +TL 
Sbjct: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98

Query: 109 QISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHL 168
             SDK+D   AE+K +FL R+YY +N G VRD R  DKI CEP  I+D++M  HLMN H+
Sbjct: 99  SNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157

Query: 169 RGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHI 228
             + +++ L   ++N +   +    ++CS CN  G  +PL++Y+  +++  LLP+ER+HI
Sbjct: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217

Query: 229 EVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 288
           E+FE F   +I  K+  VL CRDY + F+WL PLK+TKFKHL+  + +L L    VPIF+
Sbjct: 218 EIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFM 277

Query: 289 TSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGK 348
            SSTLDK DL+DICE++  KY + +GLG  SS++FH  GI  ++  LN+ K +C++DW  
Sbjct: 278 ESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNM 337

Query: 349 CLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKG 408
           CLRYGPY             P  +L      +   F  K+E +I+   ++N+  +   KG
Sbjct: 338 CLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHV--NKG 395

Query: 409 LIYLEDVNT 417
           L+YLED N+
Sbjct: 396 LLYLEDENS 404

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 535 VDQSVEITRPDTSYYQTAASPSIKRQKLNQ 564
           +  S EI+ P+TS+YQ   SPS KR +L Q
Sbjct: 447 MHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  301 bits (771), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 175/525 (33%), Positives = 271/525 (51%), Gaps = 42/525 (8%)

Query: 44  LKDRLLILPSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLT 103
           LK +  ++P++GE Y  YVD                 F +++  QL +  YELIKT SLT
Sbjct: 77  LKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLT 136

Query: 104 ADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHL 163
            +TL   + K D   A ++L+FL R+Y +D +GNVRD    +++ CEP  IYDM+M  HL
Sbjct: 137 QETLSATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHL 196

Query: 164 MNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPM 223
           +N H R +  H  L   ++N +   ++ + QFCS CN   +  P K+YK  + +  LLP+
Sbjct: 197 INDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPL 256

Query: 224 ERIHIEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           ER+ +EVFEPF G  + GKYP +L  RDYRS F+W++PL+++KF HL+ +IS +  S  R
Sbjct: 257 ERVQVEVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIR 316

Query: 284 VPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECL 343
           +PIF  ++T++  D +DI E+I  KY + IGLG K   +  T G+  I+  L  +KEECL
Sbjct: 317 IPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECL 376

Query: 344 ADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKM 403
           ADW  CL+YGP+             P  +L  ++P    K   K E+++++  + N+ K+
Sbjct: 377 ADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI 436

Query: 404 AGGKGLIYLEDVNTFALXXXXXXXXXXXXXXXXXXXXXXDFEEEVQKQFDLTEQNYIDEY 463
             G+G IYLED N                             E+ + +++    +  D  
Sbjct: 437 --GRGCIYLEDRNP----------------------------EDPEAEYEANTDDESDTE 466

Query: 464 DDLAHDSSEGEFEPNTLTPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIE 523
           D++ H   + E     ++P    +   +E   G  S   D   N  +E     +V  ++ 
Sbjct: 467 DNVEHRQEDEEDIGAMMSPMIDNTRTEDELENGEKSHEDDNHSNDNEEG--VTKVEGSVP 524

Query: 524 ETDGTRQ------ADPQVDQSVEITRPDTSYYQ----TAASPSIK 558
            T   R+       + Q  +S EIT P TSYYQ    T + P++K
Sbjct: 525 TTPKRRKLNNKNVTNTQETESPEITEPSTSYYQTYQETTSQPTMK 569

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  292 bits (748), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 141/338 (41%), Positives = 216/338 (63%), Gaps = 1/338 (0%)

Query: 81  FLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRD 140
           +LES+  QLTQ  YELIKT +LT +TL  ++D      AE K LFL+R+YYVD++  VRD
Sbjct: 57  YLESVKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRD 116

Query: 141 GRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 200
            + +D I CEP+ +Y+++++ HL+N HL  + LH FL S ++N +   +    ++CS+CN
Sbjct: 117 HKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECN 176

Query: 201 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF-TGGAIEGKYPYVLLCRDYRSSFMWL 259
            + ++KP  ++K  + Y  LLP+ERIH+E+F+PF T   IE KY +VL CRDY S F+WL
Sbjct: 177 PQEEVKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWL 236

Query: 260 LPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKS 319
            PL    F+ L+P ++   LS  R+PIF+ ++TLD+ D++D+CE IA KY L IGLGL +
Sbjct: 237 SPLTGITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNN 296

Query: 320 SARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPG 379
           S+ F+  GI  ++Y L + K++C  DWG CL+YG Y                +L +EV  
Sbjct: 297 SSHFYKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSS 356

Query: 380 HNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNT 417
              KF+ KRE++I   ++ N+  +    G++Y+E+ N+
Sbjct: 357 CGKKFKLKREKIIHELFAHNVVTLKDTGGMVYVENENS 394

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  279 bits (713), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 138/367 (37%), Positives = 219/367 (59%), Gaps = 4/367 (1%)

Query: 49  LILPSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQ 108
            I+P M + + + +               +  F  ++  QLTQQIYELI++ +L+   L+
Sbjct: 38  FIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE 97

Query: 109 QISDKYDGVVAENKLLFLQRQYYVDNE-GNVRDGRNNDKIYCEPKHIYDMVMATHLMNKH 167
           +   K+ G  +E +  +L+ +Y+V  E G V D + +D+I CEP  ++ +VM +HL N H
Sbjct: 98  RCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNH 156

Query: 168 LRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIH 227
           +    +H  L   +AN +   I     +CSKCN   K KP ++ +  ++Y +LLP+ER+H
Sbjct: 157 VTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVH 216

Query: 228 IEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIF 287
           IEVFEPF G  I+G++ ++L  RDY S ++W+LPL++ K KH+I  +SS  L   R+PIF
Sbjct: 217 IEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIF 276

Query: 288 VTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWG 347
           + S+T+D++ L+D+C +IA  Y L +GLG+K+S RFH  GI  ++  L S+KEECL DW 
Sbjct: 277 LESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWN 336

Query: 348 KCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGK 407
            CL+YGP+             P  +L + VP  N KF  KR  VI +T S+ +  +  G+
Sbjct: 337 LCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHL--GE 394

Query: 408 GLIYLED 414
           G+++LE+
Sbjct: 395 GVLFLEN 401

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  276 bits (707), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 148/406 (36%), Positives = 224/406 (55%), Gaps = 8/406 (1%)

Query: 12  DDGDDSLPSGSVTR-KSSPQMRKTTSPRESREPLKDRL--LILPSMGESYTAYVDSYXXX 68
           ++G  +   GS+TR +S           + R+P +      ++P++GESY  YVD     
Sbjct: 51  EEGAATSNKGSMTRPRSEVNGDDDDGNEDERDPKRRHYGSYLIPNVGESYMDYVDPEVDV 110

Query: 69  XXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQR 128
                       F  S+  QL + +YELI+TKSLT +TL   +  +    A  +    +R
Sbjct: 111 DLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL---AANFPHFHAPTRCALFKR 167

Query: 129 QYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAI 188
           +Y  DNEG VRD    ++I C+P  +Y+M+M  HLMN H + +  H  L S +AN +   
Sbjct: 168 RYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANITRDF 227

Query: 189 IDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYPYVLL 248
           +    QFCS CN    + PL ++K  + Y  +LP+ER+HIE+FEPF G  IEGKY +V+ 
Sbjct: 228 LYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGKKIEGKYSHVIY 287

Query: 249 CRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASK 308
           CRDYRS ++ L PLK+TKFK+L+  I+ L  +  R+PIF+ + +L+  D +DI E I  K
Sbjct: 288 CRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFDIFEAIVEK 347

Query: 309 YGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXX 368
           Y + +GLG+K++ RFHT G+  ++  L  +++ECL DW  CL+YGP+             
Sbjct: 348 YQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTKHNDRACGV 407

Query: 369 PAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 414
           P  +L   V     K   K E++I      N+ ++  G G IYLE+
Sbjct: 408 PVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGSIYLEE 451

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  270 bits (691), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 201/337 (59%), Gaps = 4/337 (1%)

Query: 81  FLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRD 140
           + ES+  QLTQ+ ++L+++ +LTA+ L   SDK      E K L L+R++YVD +G VRD
Sbjct: 50  YQESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRD 109

Query: 141 GRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 200
            + +D + CEP+ ++D++M  HL N H+  + LH +L   +ANT+ A      ++CS+CN
Sbjct: 110 FKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECN 169

Query: 201 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLL 260
            +  ++P ++++  ++Y  LLP+ER+H+E+  PF    IEG Y +VL  RDY S F+W+ 
Sbjct: 170 PEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQ 228

Query: 261 PLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSS 320
           PL S +   +     +  LS  RVPIFV +STL + DL+++CE IAS+YGL IGLG+  S
Sbjct: 229 PLASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRS 288

Query: 321 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGH 380
             F   G+  ++Y L   +E CL  W  CL++G               P  +L S V  +
Sbjct: 289 TTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDY 348

Query: 381 NAKFETKRERVIENTYSRNMFKM---AGGKGLIYLED 414
             +FE KRE +IE  ++ N+ ++      +G+IYLED
Sbjct: 349 GRQFELKREELIEKLFASNVVELRNEGRRRGMIYLED 385

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  270 bits (690), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 132/337 (39%), Positives = 208/337 (61%), Gaps = 4/337 (1%)

Query: 81  FLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRD 140
           + ES+  QLTQ  ++L+++ SLT D L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109

Query: 141 GRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 200
            + +D + CEP+ ++D++M  HL N HL  + LHS+L  ++ANT+ A      ++CS+CN
Sbjct: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169

Query: 201 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLL 260
            + +++P K+++  ++Y  LLP+ER+H+E+  PF+  AIEG Y +VL  RDY S F+W+ 
Sbjct: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQ 228

Query: 261 PLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSS 320
           PLK    + +   + +  L   R+PIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 229 PLKGDDVRDITKGLLATLLLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288

Query: 321 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGH 380
           + F   G+  ++Y L   +E+CL  W  CL+YG               P  +L S V  +
Sbjct: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348

Query: 381 NAKFETKRERVIENTYSRNM--FKMAG-GKGLIYLED 414
             +FE KRE +IE  ++RN+   K++G  +G+IYLED
Sbjct: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLED 385

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  262 bits (669), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 126/340 (37%), Positives = 196/340 (57%), Gaps = 4/340 (1%)

Query: 81  FLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRD 140
            + ++  QLTQ IYELI + +L+  TL +  DK      ENK + L+R+Y +  +GNV D
Sbjct: 66  LINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSI-LQGNVVD 124

Query: 141 GRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 200
            +  D    EP  ++D++MA HL+N HL  + +H  L + +AN +    + V  +CS CN
Sbjct: 125 HKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCN 184

Query: 201 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGA---IEGKYPYVLLCRDYRSSFM 257
               +K    YK  ++YDK++P+ER H+E+F PF       IE KY +VL CRDY S F+
Sbjct: 185 TDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFV 244

Query: 258 WLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGL 317
           W+LPL+   F+ L+P ++ L  S  R+PIF+ ++TLD+ D++D+CE IA KY L IGLGL
Sbjct: 245 WMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGL 304

Query: 318 KSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEV 377
            S   F   G+  I+     +KE+C+ +W  CLR                 P+ +L +E+
Sbjct: 305 NSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEI 364

Query: 378 PGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNT 417
                KF+ K+ ++I+  Y+ ++ +     G+IYLED N+
Sbjct: 365 SNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  251 bits (642), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 124/346 (35%), Positives = 192/346 (55%), Gaps = 11/346 (3%)

Query: 82  LESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRDG 141
           + ++  QLTQ IY+L+ + +LT + L + SDK      ENK + L+R+YYV  E  + D 
Sbjct: 89  INTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYV-QENLLHDV 147

Query: 142 RNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNK 201
           +  D +  EP  ++D++M+ H++N H+  K +++ L + +AN + +    V  FCSKCN+
Sbjct: 148 KRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNE 207

Query: 202 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGG----------AIEGKYPYVLLCRD 251
            G     K++K  +++  L+P+ R H+E+F PF              IEGKYP+VL CRD
Sbjct: 208 SGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRD 267

Query: 252 YRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGL 311
           Y S ++WL PLKS     L+PV++ L  S  R+PIF+ + TLD+ D++D+CE IA  Y +
Sbjct: 268 YYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKI 327

Query: 312 CIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQ 371
            IGLG+ SS  F   GI  ++     +KEECL DW  CL+                 P+ 
Sbjct: 328 KIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSD 387

Query: 372 VLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNT 417
           +L S     + KF T +  VI      ++ +     G+IYLED N+
Sbjct: 388 LLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENS 433

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  248 bits (634), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/337 (38%), Positives = 200/337 (59%), Gaps = 4/337 (1%)

Query: 81  FLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGN-VR 139
           F  ++   L+Q+IY+LI T  LT   + +   K+     E K  FL+ +YYV ++G  VR
Sbjct: 92  FQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVR 150

Query: 140 DGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKC 199
           D RN+DKI C P  + ++V+ THL+N+H   K++H  L   +AN S  I      +CS C
Sbjct: 151 DRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFC 210

Query: 200 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTG-GAIEGKYPYVLLCRDYRSSFMW 258
           N    +KPLK+ K+ ++Y+ LLP ERIHIE+F+PF     IEG Y ++L  RDY S ++W
Sbjct: 211 NPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVW 270

Query: 259 LLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLK 318
           L PLK T FK L   + + F +  + PI++ SST++++DL  + ++IA KY L IG+G+ 
Sbjct: 271 LYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIG 330

Query: 319 SSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLL-SEV 377
           +S+ FH  G+  ++  L  +++ECL DWG CL+YG               P  +LL S +
Sbjct: 331 NSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGI 390

Query: 378 PGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 414
              + K+++K+  VI+ T+  NM  +  GK  IYLED
Sbjct: 391 SECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLED 427

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  245 bits (626), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 123/337 (36%), Positives = 196/337 (58%), Gaps = 4/337 (1%)

Query: 81  FLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRD 140
            ++++  QLTQ+IY+LI + +L+   L +  DK      ENK + L+R+Y V   G V D
Sbjct: 60  IMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRY-VAKGGIVID 118

Query: 141 GRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCN 200
            +  D    EP  ++DM+M+ HL+N H+  + ++  +   +AN +  + + V  +CS CN
Sbjct: 119 RKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCN 178

Query: 201 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE---GKYPYVLLCRDYRSSFM 257
               ++    YK  ++++KL+P+ER H+EVF PF    +E   GKY + L CRDY S F+
Sbjct: 179 MDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFI 238

Query: 258 WLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGL 317
           WLLPL+   F++L+P ++ L  +  RVPIF+ ++TLD+ D++DICE IA +Y   IGLGL
Sbjct: 239 WLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGL 298

Query: 318 KSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEV 377
            S   F   GI  ++  L+ YKEEC  DW  CLR                 P+ +L +E+
Sbjct: 299 NSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEI 358

Query: 378 PGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 414
           P  + KF+ K++++I+  Y+ ++       G+IYLED
Sbjct: 359 PNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLED 395

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  241 bits (615), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 203/363 (55%), Gaps = 1/363 (0%)

Query: 52  PSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQIS 111
           P +G +   Y+DS                +L+S+   L+Q +YELI+   L  DTL +  
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104

Query: 112 DKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGK 171
            ++  + A  K L+L+R+Y +  +G V D    +KI  EP   YD +++TH++N+HL  +
Sbjct: 105 TRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164

Query: 172 TLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 231
            +H  L + ++N S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224

Query: 232 EPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSS 291
           EPF    I+ +Y +++  RDYRS F+W+ PLK+TKFK L   I  L L   R+PI++ ++
Sbjct: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284

Query: 292 TLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLR 351
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  ++  LN  K++CL DW  CL+
Sbjct: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344

Query: 352 YGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIY 411
            G Y             P+++ L E+      FE+KR  +I +   +N +K +  KGL+Y
Sbjct: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404

Query: 412 LED 414
            +D
Sbjct: 405 AQD 407

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  232 bits (592), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/369 (33%), Positives = 202/369 (54%), Gaps = 8/369 (2%)

Query: 50  ILPSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQ 109
           ++P +G+ ++ Y D                 +  +   +++Q++Y L K   +T + + +
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94

Query: 110 ISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLR 169
           +           K++++ R+YY D  G +RD   N++I  +P H +D++M+ HLMNKHL 
Sbjct: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154

Query: 170 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 229
            + ++  L   +AN    +I    ++CS CN   K+ P K   +P +++K LP+ERI IE
Sbjct: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIE 213

Query: 230 VFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 289
           + EPF    +EGKY  +++ +D+   F WL PLK+TKFK+++PV++ + LSF RVPI+V 
Sbjct: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273

Query: 290 SSTLDKDDLYDICEEIASKYGLCIGLGL--KSSARFHTGGILCIQYALNSYKEECLADWG 347
           S+TLD  DL+DI E I +KYG+ IGLG   +SSA   T     I   LN + +ECL D+ 
Sbjct: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATAR---INRDLNDHHDECLFDFN 330

Query: 348 KCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGK 407
            CL+YGP              P  ++        AKF  KR  +++++ S  +  M  G 
Sbjct: 331 NCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCV--MNRGM 388

Query: 408 GLIYLEDVN 416
           G +YLE  N
Sbjct: 389 GTLYLESPN 397

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  229 bits (583), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 205/389 (52%), Gaps = 20/389 (5%)

Query: 49  LILPSMGESYTAYV---DSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTAD 105
            ++P++ E+Y  Y+   DS                F E L  +LTQ+ Y L+   +LT +
Sbjct: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119

Query: 106 TLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMN 165
           T+ +  + +    AE K   L +++Y D EGN+RD + ++ I  EP  ++++++  HL N
Sbjct: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179

Query: 166 KHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMER 225
            HL+   L   L   +AN +   +     +C++CN    IKP+++ +  ++ ++LLP+ER
Sbjct: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239

Query: 226 IHIEVFEPFTGG--------------AIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLI 271
           +HIEVF PF                  IEGKY +V  CRD+R+ ++W  PLK+ KFK L+
Sbjct: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299

Query: 272 PVISSLFLS-FARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILC 330
             I++ F++     PIFV SST+D+DDL +I E +ASKYGL +GLG  +  +FH  GI  
Sbjct: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359

Query: 331 IQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAK-FETKRE 389
            +  L+  K EC  DW  CL+ G Y              + +L +E+ G   +    K+ 
Sbjct: 360 FKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKA-SNILFTELMGQFERDMRKKKL 418

Query: 390 RVIENTYSRNMFKMAGGKGLIYLEDVNTF 418
           + IE ++S N+       G I++E V  +
Sbjct: 419 KYIEQSFSENIKTYPKSGGCIFIEHVQDY 447

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  191 bits (486), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 128/412 (31%), Positives = 205/412 (49%), Gaps = 19/412 (4%)

Query: 18  LPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTAYVD---SYXXXXXXXXX 74
           + + S  + S+ Q  K+ +P E  E LK  +     +G SYT Y+D   S          
Sbjct: 1   MTNDSHQQNSNIQDLKSLTPDEKLEMLK--IYNPKDLGISYTDYLDEKNSNVNIELLEKG 58

Query: 75  XXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKY-DGVVAENKLLFLQRQYYVD 133
                 +       LTQ+  +++ T +L+ + + +   K  +   A  K  F  R+YY++
Sbjct: 59  YKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLN 118

Query: 134 NEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQ 193
            + N+ D R   +I CEPK++YD+V+A HL  K      +   L   F+N     ID+  
Sbjct: 119 EDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCA 176

Query: 194 QFCSKC--NKKGKIKPLKE---YK--RPDMYDK-LLPMERIHIEVFEPFTGGAIEGKYPY 245
           ++CSKC  ++   +K   +   +K  R ++ D+ L PMERIHIE+F PF    IE KY  
Sbjct: 177 KYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQR 236

Query: 246 VLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFA-RVPIFVTSSTLDKDDLYDICEE 304
           +L  RDY + ++W   LK  K KH+  +++  FLS A  VPIF+ SST+D  DL+DICE+
Sbjct: 237 ILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEK 296

Query: 305 IASKYGLCIGLGLKSSA-RFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXX 363
           I+ +Y + +GLG  +    FH  GI   +  +N  K +CL  W   L +G          
Sbjct: 297 ISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNS 356

Query: 364 XXXXXPAQVL-LSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 414
                P  ++  + +     KF  +R R+I+ T + N  K+     +I++ED
Sbjct: 357 RILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIED 408

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  166 bits (420), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 99/333 (29%), Positives = 160/333 (48%), Gaps = 10/333 (3%)

Query: 89  LTQQIYELIKTKSLTADTLQQI-------SDKYDGVVAENKLLFLQRQYYVDNEGNVRDG 141
           LTQ++Y LI+ K+   +T ++        S KY G  A  K + ++ +Y ++  G + D 
Sbjct: 62  LTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGT-ANKKFMLMEDRYQLNELGQITDK 120

Query: 142 RNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNK 201
           RN+ K+   P  IYD++M  H +N HL    +H  L   ++N S A++    Q CS CN 
Sbjct: 121 RNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP 180

Query: 202 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTG-GAIEGKYPYVLLCRDYRSSFMWLL 260
           K   K + EY R    DK    E+IH+E+F+PF        K+ +V+  RDY + ++WL 
Sbjct: 181 KSTYKHI-EYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLY 239

Query: 261 PLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSS 320
           PL+    K L   +++  L   R+PI++ S TLD+ +L  I + I+    L +G+G    
Sbjct: 240 PLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKL 299

Query: 321 ARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGH 380
             F   GI  ++      +E C  +W K +                  P  ++  E    
Sbjct: 300 DEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD 359

Query: 381 NAKFETKRERVIENTYSRNMFKMAGGKGLIYLE 413
           N  ++ KR+R I  T S+N   +  GK  +Y E
Sbjct: 360 NKTYKKKRQRTILLTLSKNTILLKNGKSALYKE 392

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  161 bits (407), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 101/371 (27%), Positives = 177/371 (47%), Gaps = 9/371 (2%)

Query: 50  ILPSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQ 109
           I+P +G+ Y + +                     S T  L++++Y+L+K   LT   +  
Sbjct: 32  IIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRKNVA- 87

Query: 110 ISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLR 169
           ++   D   A  +L+ L+ +YY D++  V D    +KI  +P H + MVM THL+N HL 
Sbjct: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147

Query: 170 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDK--LLPMERIH 227
              ++  L   FAN S   I    ++CS CN     K ++  K P + +   +L  ER+ 
Sbjct: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK--KNIRRKKEPQLSNSPDILFYERLI 205

Query: 228 IEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIF 287
           ++V  PF    I+ +Y ++L   D+ + FMW  PLK+ K + +I  ++   ++    P+F
Sbjct: 206 LDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265

Query: 288 VTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWG 347
           ++S TL  +D++++C  +A +Y + IGLG ++  + ++     +   LNS+K ECL  W 
Sbjct: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY-VTRILNSHKTECLKSWF 324

Query: 348 KCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGK 407
            CL++                    L S +     K+E + + +I    S N   +  G 
Sbjct: 325 MCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGS 384

Query: 408 GLIYLEDVNTF 418
             IY ED  +F
Sbjct: 385 HFIYSEDEFSF 395

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  158 bits (399), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 182/373 (48%), Gaps = 11/373 (2%)

Query: 52  PSMGESYTAYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQQIYELIKTKSLTADTLQQIS 111
           P +G+    Y DSY            T  F  +L + +T  +Y  ++ +SL  D     +
Sbjct: 31  PPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPA 90

Query: 112 DKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGK 171
                 +  +K ++LQ +Y  +++G++ + + N K+ CEPK+IY + M  H MN H+R  
Sbjct: 91  SL---KIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSN 146

Query: 172 TLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEV 230
            L+  L   + N  + ++  V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++
Sbjct: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206

Query: 231 FEPFTGGAIE--GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 288
            +PF    I+   KY ++LL RDY S + W+ PLKS   K++   +    ++  R PIF+
Sbjct: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266

Query: 289 TSSTLDKDDLYDICEEIASKYGLCIGLGLKSSAR--FHTGGILCIQYALN--SYKEECLA 344
            S  + +  L  I  +I  +Y + I +G+       F   GI  + Y LN    KE+C +
Sbjct: 267 HSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKS 326

Query: 345 DWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMA 404
           DW +C+R   +                ++  +    N  FE KR+ ++ +    N+ K+ 
Sbjct: 327 DWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIG 386

Query: 405 GGKGLIYLEDVNT 417
               +IY ++ N+
Sbjct: 387 ECGSIIYFDNNNS 399

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 40/94 (42%), Gaps = 7/94 (7%)

Query: 189 IDW--VQQF-CSKCNKKGKIKPLKEY--KRPDMYDKLLPMERIHIEVFEPFTGGAIEGKY 243
           +DW  + +F C  C   GKI   K     R        P E IH ++F P +G  I    
Sbjct: 338 VDWSGIDKFQCKDC-LAGKITKHKHIVGSRLKYQKSYEPFEYIHTDLFGPVSGVDITSP- 395

Query: 244 PYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSL 277
            Y +   D  + F W+ PLK     H++P+   L
Sbjct: 396 KYFISFTDENTRFRWVFPLKKKDADHILPIFQQL 429

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 189 IDW--VQQF-CSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYPY 245
           +DW  + +F C  C   GK+   K      +  K  PM  IH ++F P +G  I     Y
Sbjct: 151 VDWSGIDKFQCKDC-LTGKLTKHKHIVGSRLNIKS-PMSYIHTDLFGPVSGVDITSP-KY 207

Query: 246 VLLCRDYRSSFMWLLPLKSTKFKHLIPVISSL 277
            +   D  + F W+ PLK     H++P+   L
Sbjct: 208 FISFTDENTRFRWVFPLKKKDADHILPIFQQL 239

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 222 PMERIHIEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSL 277
           P E IH ++F P +G  I     Y +   D  + F W+ PLK     H++P+   L
Sbjct: 290 PFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQL 344

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 183 NTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGK 242
           N++  ++D V + CS+C    K   L   + P+++   +   R H++   P         
Sbjct: 789 NSNLLLLD-VVRLCSRCETYEKFSDL-PIELPEIHRTPV-FSRWHLDFAGPLPA---HNG 842

Query: 243 YPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 289
           Y Y LL  DY S+ + + PL    F  +  +I  ++ +F R  + VT
Sbjct: 843 YKYFLLAADYTSNLILVRPLAEQSFTSVYDLIFDIYATFGRPHMLVT 889

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 61/149 (40%), Gaps = 20/149 (13%)

Query: 183 NTSHAIIDWVQQFCSKCNKKGKIK----PLKEYKRPDMYDKLLPMERIHIEVFEPFTGGA 238
           N++  ++D V+Q C +C    K +     L E +R  ++       R H++   P     
Sbjct: 342 NSNLLLLDVVKQ-CPRCETYQKFRDIPIELPEIRRIPVF------SRWHLDFAGPLKD-- 392

Query: 239 IEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDL 298
            +  Y Y LL  DY S+ + + PL+   F  +  ++ +++  F    + +T      D+ 
Sbjct: 393 -KDGYKYFLLAADYTSNLILVKPLREQTFHSVYEIMRAIYAIFGSPHMLIT------DNG 445

Query: 299 YDICEEIASKYGLCIGLGLKSSARFHTGG 327
                 I  +    + L    S+ +H  G
Sbjct: 446 RQFANAIIPQVARSLKLKYYQSSAYHPRG 474

>Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A -
           TyA Gag protein [contig 364] PARTIAL
          Length = 604

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 39/99 (39%), Gaps = 5/99 (5%)

Query: 189 IDWVQQFCSKCNK----KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW++    +C      KGK        R    +K   +E +H ++F P       G   
Sbjct: 85  VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 143

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 39/99 (39%), Gaps = 5/99 (5%)

Query: 189 IDWVQQFCSKCNK----KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW++    +C      KGK        R    +K   +E +H ++F P       G   
Sbjct: 140 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 198

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 199 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 237

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A -
           Ty ORF [contig 372] FULL
          Length = 734

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 39/99 (39%), Gaps = 5/99 (5%)

Query: 189 IDWVQQFCSKCNK----KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW++    +C      KGK        R    +K   +E +H ++F P       G   
Sbjct: 246 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 304

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 305 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 343

>KLTH0D01738g Chr4 (170277..171152) [876 bp, 291 aa] {ON} similar to
           uniprot|P39731 Saccharomyces cerevisiae YAL034W-A MTW1
           Essential component of the MIND kinetochore complex
           (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
           kinetochore subunits contacting DNA to those contacting
           microtubules critical to kinetochore assembly
          Length = 291

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 513 DEPEEVNHNIEETDGTRQADPQVDQSVEITRPD 545
           ++P EV+H + +  GT  + P  D ++E++ PD
Sbjct: 251 NQPSEVSHEVPDGAGTTGSSPSTDHAIEVSSPD 283

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 189 IDW--VQQF-CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 85  VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 143

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Smik_4.40 Chr4 complement(78729..79295) [567 bp, 188 aa] {ON}
           YDL200C (REAL)
          Length = 188

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%)

Query: 171 KTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEV 230
           K   S + +   N    ++D V+ F  +  K+     L+E K  + Y K +   RI++E 
Sbjct: 23  KRTRSLVIASLGNDKQLLLDKVEAFLKRYEKQDMKYKLRELKDTEKYKKSIENYRIYLEK 82

Query: 231 FEPFTGGAI 239
             P   GAI
Sbjct: 83  KMPLPSGAI 91

>NDAI0D00410 Chr4 (86277..87239) [963 bp, 320 aa] {ON} 
          Length = 320

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 146 KIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKI 205
           KI C   H Y ++  T   N   + K ++SF ++        ++  V+Q  SKC K+G+ 
Sbjct: 2   KILCWFLHSYSIITQT---NNQAKNKEMNSFTYTSIQ-KQKRLLTLVEQKLSKCAKQGET 57

Query: 206 K--PLKEY-KRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYPY 245
           K   L+E     ++ D+LL     +I+ FE F     +  Y Y
Sbjct: 58  KGYNLREMVGHANLLDQLLD----NIQNFENFENHQRQHSYYY 96

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 189 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 246 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 304

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 305 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 343

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
           YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 189 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 239

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

>Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa]
           {ON} YIR023W (REAL)
          Length = 971

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 250 RDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTL 293
           RDY  +++W+L + S  F  L   ++++ L FA++P  +T   L
Sbjct: 707 RDYLRNYIWVLKIGSKYFDKLSNALNNMHLLFAQIPGLLTDEPL 750

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -
           TyB Gag-Pol protein [contig 416] FULL
          Length = 542

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 189 IDW--VQQF-CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 239

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 189 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW++   F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 381 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 439

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 440 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 478

>YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Positive
           regulator of genes in multiple nitrogen degradation
           pathways; contains DNA binding domain but does not
           appear to bind the dodecanucleotide sequence present in
           the promoter region of many genes involved in allantoin
           catabolism
          Length = 970

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 246 VLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 289
            ++ RDY  ++ W+L + S  F  L   ++++ L FA++P  +T
Sbjct: 704 AMIFRDYVRNYTWVLKIGSKYFDKLSNALNNMHLLFAQIPGLLT 747

>Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 55] FULL
          Length = 310

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 189 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIEGKYP 244
           +DW++   F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 85  VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMHHMP-SGVPK 143

Query: 245 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 283
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,206,910
Number of extensions: 2619918
Number of successful extensions: 12609
Number of sequences better than 10.0: 172
Number of HSP's gapped: 12819
Number of HSP's successfully gapped: 330
Length of query: 580
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 465
Effective length of database: 40,294,809
Effective search space: 18737086185
Effective search space used: 18737086185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)