Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3708.257ON71471437610.0
YDR109C8.257ON71571527660.0
Smik_4.3558.257ON70470627070.0
Suva_2.2698.257ON72571126590.0
SAKL0H17160g8.257ON73970821470.0
Kwal_56.236078.257ON72571221210.0
KLTH0G13794g8.257ON72570320960.0
TDEL0F038408.257ON72670720840.0
ZYRO0C01782g8.257ON73073120670.0
KLLA0F19041g8.257ON76351219510.0
NCAS0B038708.257ON59650517160.0
Kpol_392.98.257ON59450117010.0
NDAI0J014008.257ON58850916910.0
KAFR0B055608.257ON60549716700.0
KNAG0H032608.257ON58050116490.0
TBLA0E044008.257ON58950616390.0
Ecym_43138.257ON59750116170.0
CAGL0B01727g8.257ON57749915520.0
AGR092W8.257ON59667515190.0
TPHA0B032408.257ON58549814990.0
Suva_14.931.111ON5434995012e-54
Skud_14.891.111ON5695264628e-49
Smik_14.861.111ON5435084405e-46
YNL249C (MPA43)1.111ON5425074325e-45
TDEL0C059001.111ON5435054247e-44
ZYRO0F16016g1.111ON5424704247e-44
Kwal_33.135301.111ON5345004211e-43
KLTH0F03080g1.111ON5334894061e-41
SAKL0C03432g1.111ON5475053894e-39
KNAG0F006601.111ON5355053796e-38
KLLA0C02937g1.111ON5165002991e-27
NCAS0A007801.111ON5495211752e-12
TBLA0G023702.206ON52685790.76
Kpol_1016.241.289ON21166741.9
TPHA0E001205.717ON164291762.0
TBLA0C027801.289ON22066704.8
AFL002C4.128ON115178726.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.370
         (714 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...  1453   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...  1070   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...  1047   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...  1028   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   831   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   821   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   811   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   807   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   800   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   756   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    665   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   659   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   655   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   647   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   639   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   635   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   627   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   602   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   589   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   582   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   197   2e-54
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   182   8e-49
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   174   5e-46
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   171   5e-45
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   167   7e-44
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   167   7e-44
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   166   1e-43
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   160   1e-41
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   154   4e-39
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   150   6e-38
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   119   1e-27
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    72   2e-12
TBLA0G02370 Chr7 (615596..617176) [1581 bp, 526 aa] {ON} Anc_2.2...    35   0.76 
Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON} (61782.....    33   1.9  
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...    34   2.0  
TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON...    32   4.8  
AFL002C Chr6 complement(432329..435720,435784..435847) [3456 bp,...    32   6.1  

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score = 1453 bits (3761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/714 (97%), Positives = 697/714 (97%)

Query: 1   MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGN 60
           MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGN
Sbjct: 1   MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGN 60

Query: 61  MLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLV 120
           MLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLV
Sbjct: 61  MLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLV 120

Query: 121 VVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIP 180
           VVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIP
Sbjct: 121 VVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIP 180

Query: 181 KIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWS 240
           KIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWS
Sbjct: 181 KIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWS 240

Query: 241 EEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGL 300
           EEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGL
Sbjct: 241 EEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGL 300

Query: 301 IDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVH 360
           IDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVH
Sbjct: 301 IDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVH 360

Query: 361 GIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSML 420
           GIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSML
Sbjct: 361 GIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSML 420

Query: 421 ETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSA 480
           ETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSA
Sbjct: 421 ETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSA 480

Query: 481 CEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXX 540
           CEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDG   
Sbjct: 481 CEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVV 540

Query: 541 XXXXXXXXXXXXXXDLAKGRRTLTTKKSSSAQEFFINSYPSPQNSAMRHQNLASDVTCSY 600
                         DLAKGRRTLTTKKSSSAQEFFINSYPSPQNSAMRHQNLASDVTCSY
Sbjct: 541 FGSALLGAAASEAFDLAKGRRTLTTKKSSSAQEFFINSYPSPQNSAMRHQNLASDVTCSY 600

Query: 601 NLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTGILWKV 660
           NLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTGILWKV
Sbjct: 601 NLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTGILWKV 660

Query: 661 MQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714
           MQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK
Sbjct: 661 MQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/715 (72%), Positives = 588/715 (82%), Gaps = 1/715 (0%)

Query: 1   MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGN 60
           M  +K +  MQ +T    V  S++ S+S I  +DPE KFYVGVDVGTGSARAC+IDQSGN
Sbjct: 1   MKSRKRQNNMQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGN 60

Query: 61  MLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLV 120
           MLSLAEKPIKRE+L  NFITQSSREIW+AVC+CV+ V++ES VDP+RV G+GFDATCSLV
Sbjct: 61  MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLV 120

Query: 121 VVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIP 180
           VVSAT+ + +AVGPDFT NDQNIILWMDHRAMKETEEINSS DKCLKYVGGQMSVEMEIP
Sbjct: 121 VVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIP 180

Query: 181 KIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWS 240
           KIKWLKNNL + +FQDCKFFDLPDYLTFKATGKENRSF SAVCKQGFLP GVEGS++GWS
Sbjct: 181 KIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWS 240

Query: 241 EEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGL 300
           +EFLN+IGLSEL ++DFE+LGGSLR KKNFL+AGECI  LD KAA +LGLTE+CVVSSG+
Sbjct: 241 KEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGI 300

Query: 301 IDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVH 360
           IDAYAGWVGTVAAKPES ++GLAE E+   ++NGAIGRLAAVAGTSTCHILLSK+PIFVH
Sbjct: 301 IDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVH 360

Query: 361 GIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSML 420
           G+WGPYRDVLARGFWAAEGGQSCTGVLLDH+I  HPA+TELS + N AGVSKFEYLN +L
Sbjct: 361 GVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKIL 420

Query: 421 ETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSA 480
           ET+V+KR  RSVISLA+HLFFYGDYHGNRSPIAD NMRACIIGQSMDNS+EDLA+ YLSA
Sbjct: 421 ETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSA 480

Query: 481 CEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXX 540
           CEFISQQTRQI+EVMLKSGH+I+AIFMSGGQCRN LL RLLADC+GLPIVIPRY+D    
Sbjct: 481 CEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVV 540

Query: 541 XXXXXXXXXXXXXXDLAKGRRTLTTKKSSSAQ-EFFINSYPSPQNSAMRHQNLASDVTCS 599
                         D  + +RTL  +KSS  + E F +SY S Q  +M  +N  +     
Sbjct: 541 FGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSP 600

Query: 600 YNLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTGILWK 659
           +NL  S  SAP  +N +S  I  Q   D +SEESSK    TV   SL E RY GT  LWK
Sbjct: 601 HNLQLSTPSAPAKINNYSLPICTQQPLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWK 660

Query: 660 VMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714
           VMQELTG+A+ VNPN+ THPDRILLDTKYQIFLDM ETQ++YR MVD +E SFS+
Sbjct: 661 VMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/706 (72%), Positives = 576/706 (81%), Gaps = 3/706 (0%)

Query: 10  MQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPI 69
           MQ K       PS++ S S I   + E KFYVGVDVGTGS RACIID+SGN+LSLAEKPI
Sbjct: 1   MQDKIWQSTTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPI 60

Query: 70  KREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKG 129
           KREEL  NFITQSSREIW+AVC+CV+ VIQE+ VDP R+HG+GFDATCSLVVVSATD K 
Sbjct: 61  KREELLSNFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKE 120

Query: 130 VAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNL 189
           +AVGPDFT NDQNIILWMDHRAMKETEEIN S + CLKYVGGQMSVEMEIPKIKWLKNNL
Sbjct: 121 IAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNL 180

Query: 190 RSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGL 249
            S +FQDCKFFDLPDYLTF+ATGKENRSFSS VCKQGFLP GVEGSNLGWS++FL++IGL
Sbjct: 181 ESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGL 240

Query: 250 SELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVG 309
           SEL ++DFEKLGGSLR++KNFLSAGECIG LD KAAR+LGLTE CVVSSG+IDAYAGWVG
Sbjct: 241 SELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVG 300

Query: 310 TVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDV 369
           TVAAKPES I+GL ENED  +++NGAIGRLAAVAGTSTCHILLSK  IFVHGIWGPYRDV
Sbjct: 301 TVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDV 360

Query: 370 LARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNE 429
           LARGFWAAEGGQSCTGVLLDHVI  HPA+++LSQL +AA VSKFEYLNS+LE +V+KR E
Sbjct: 361 LARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE 420

Query: 430 RSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTR 489
           RSVI LA+HLFFYGDY GNRSPIAD NMRACIIGQSMDNS++DLA+ YL ACEFISQQTR
Sbjct: 421 RSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTR 480

Query: 490 QIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXXXXXXXXXXX 549
           QI+EVMLKSGH I+A+FMSGGQCRN LL RLLADC+GLPIVIPRYIDG            
Sbjct: 481 QIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAA 540

Query: 550 XXXXXDLAKGRRTLTTKKSSSAQ-EFFINSYPSPQNSAMRHQNLASDVTCSYNLPNSISS 608
                DL K RR + +KKSS  Q EF    YPS QN  +  +N +++V  SY L  S  +
Sbjct: 541 ASKVFDLNKRRRVIKSKKSSLVQTEFLEGLYPSIQNLPL--ENHSTNVVASYKLACSNLN 598

Query: 609 APDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTGILWKVMQELTGDA 668
           AP   +     ISK+   DM S++SSKG        +LEE+R     ILWKVMQELTG+A
Sbjct: 599 APARTSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNA 658

Query: 669 KAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714
           K + PN  THPDRILLDTKYQIFLDM ETQ+ YR MVD +EE+FS+
Sbjct: 659 KVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/711 (70%), Positives = 572/711 (80%), Gaps = 5/711 (0%)

Query: 4   KKLRRRMQIKTCHLEVS-PSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNML 62
           K+L+ +M +K        PS+   L    L+D + KF+VGVDVGTGS RACIIDQ G +L
Sbjct: 7   KELQNKMPLKNASYSGQLPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIIDQFGKIL 66

Query: 63  SLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVV 122
           SLAEKPIKREE+R NFITQSS+EIWDAVCHCVKAV+QES VDP +VHG+GFDATCSLVVV
Sbjct: 67  SLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVV 126

Query: 123 SATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKI 182
           SATD KG+AVGPDF+ NDQNIILWMDHRAMKETEEINS+ DKCLKYVGGQMSVEM+IPKI
Sbjct: 127 SATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKI 186

Query: 183 KWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEE 242
           KWLKNNL +E+F+DCKFF+LPDYLTFKATGKENRSF+SAVCKQGFLPAGVE S LGWSEE
Sbjct: 187 KWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEE 246

Query: 243 FLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLID 302
           FLN+IGLSEL  +DFE+LGGSLR KKNFLSAGEC+G LD  +A ELGLT++C+V SG+ID
Sbjct: 247 FLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIID 306

Query: 303 AYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGI 362
           AYAGWVGTVAAKP S I GL+ENE    + N AIGRLAAVAGTSTCHILLSKDPIFVHG+
Sbjct: 307 AYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGV 366

Query: 363 WGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLET 422
           WGPYRDVLAR FW AEGGQSCTG LL HVIK HPA+TELSQL +AA +S FEYLNSMLET
Sbjct: 367 WGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLET 426

Query: 423 MVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACE 482
           +V+KRNERSV+SLA+H FFYGDYHGNRSPIAD NMRACIIGQSMDNSVEDLA+TYL ACE
Sbjct: 427 LVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACE 486

Query: 483 FISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXXXX 542
           FISQQTRQI+E ML++GH+IDAIFMSGGQCRN LL RLLADC+GLPI+IPRYID      
Sbjct: 487 FISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFG 546

Query: 543 XXXXXXXXXXXXDLAKGRRTLTTKKSS-SAQEFFINS-YPSPQNSAMRHQNLASDVTCSY 600
                       DLA  +    T++SS S +E  +N  Y   QN +   QNLA DV+   
Sbjct: 547 SALLGAAASEASDLANEKTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAFDVSPPN 606

Query: 601 NLPNSISSAPDTMNRHSSTISKQSRGDMSS--EESSKGTLNTVALRSLEEKRYRGTGILW 658
           + P+ I + P T+N H S I ++    + S    + K T  +   R L+++R     +LW
Sbjct: 607 STPSYIKNIPATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLW 666

Query: 659 KVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709
           KVMQELTG+AK VNPN  THPDRILLDTKYQIFLDMAE Q++YR+MVD +E
Sbjct: 667 KVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/708 (58%), Positives = 505/708 (71%), Gaps = 24/708 (3%)

Query: 26  SLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSRE 85
           S+S + ++  ++ +YVGVDVGTGSARACIID  GN+LSLAE+PI+R+EL+P++ITQSS+E
Sbjct: 21  SMSALSMEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQE 80

Query: 86  IWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIIL 145
           IW A+C+CVK+V+++S V P+++HG+GFDATCSLVVV     K VAVGPDF   +QNIIL
Sbjct: 81  IWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIIL 140

Query: 146 WMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDY 205
           WMDHRA+ ET+EIN++ DKCLKYVGGQMSVEMEIPKIKWLKNNL  E F+ CKFFDL DY
Sbjct: 141 WMDHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADY 200

Query: 206 LTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLR 265
           LTFKATG E RS+ S VCKQG LP GVE S  GWS+EFL  IGL +L + DF KLGGS++
Sbjct: 201 LTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIK 260

Query: 266 HK----KNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRG 321
                   FLSAGECIGSLD  AA ELGL  +CVV SG+IDAYAGWVGTVAA+ +  I  
Sbjct: 261 SDGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPE 320

Query: 322 LAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQ 381
           L E ++     + A GRLAAVAGTSTCHI +SKDPIFV G+WGPYRDV+A GFW AEGGQ
Sbjct: 321 LVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQ 380

Query: 382 SCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFF 441
           SCTG LL HV+ IHPAYTELS L++AA VSKF+YLNS LE + ++R  RSV++LA+HLFF
Sbjct: 381 SCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFF 440

Query: 442 YGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHK 501
           YGDYHGNRSPIAD +MRA +IGQSMDNS++DLAI YL ACEFI+QQTRQIVE M  SGH+
Sbjct: 441 YGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHR 500

Query: 502 IDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXXXXXXXXXXXXXXXXDLAKGRR 561
           I AIFMSGGQCRN LL RLLADC+GLPIVIPRYID                  +L     
Sbjct: 501 IAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSG 560

Query: 562 TLTTKKSSSAQ---EFFINSYPSPQNSAMRH--QNLASDVTCSYNLPNSISSAPD----- 611
           +L+ ++ SS     E F +S   P+ + +       + D+   Y  P++ +S        
Sbjct: 561 SLSRRRKSSLSGKYEEFKDSMEIPKKNFLSKLGGTASGDLPSPYTAPSATASTSQIASTV 620

Query: 612 ------TMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSL---EEKRYRGTG-ILWKVM 661
                   +  S  I ++   + ++   S G+    A   L   +EK   G G  LW VM
Sbjct: 621 GGFPFPVTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVM 680

Query: 662 QELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709
             +TG  K V P+   HPDR+LLD KY+IFLDMAETQ+RYR  VD +E
Sbjct: 681 YNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/712 (57%), Positives = 507/712 (71%), Gaps = 33/712 (4%)

Query: 26  SLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSRE 85
           S++ + L+  ++ +Y+GVDVGTGSARACIID  GN+LSLAE+PI+RE+L+PNFITQSS+E
Sbjct: 21  SMTGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQE 80

Query: 86  IWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIIL 145
           IW AVCHCVK+V+++S V  +++HG+GFDATCSLVVV     K VAVGPDF   +QNIIL
Sbjct: 81  IWQAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIIL 140

Query: 146 WMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDY 205
           WMDHRA++ETE+IN++ DKCLKYVGGQMSVEMEIPKIKWLKN+L +  F +CKFFDL DY
Sbjct: 141 WMDHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADY 200

Query: 206 LTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLR 265
           LTFKA+GKE RSF S VCKQG LP GVEGS  GWS EFL  IGL + IE DF K+GGS++
Sbjct: 201 LTFKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK 260

Query: 266 HK---KNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGL 322
           +    KNFLSAGE +G++D   A ELGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L
Sbjct: 261 NSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPAL 320

Query: 323 AENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQS 382
            + +      + A GRLAAVAGTSTCHI +S+DPIFV G+WGPYRD LA  FW AEGGQS
Sbjct: 321 VKIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQS 380

Query: 383 CTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFY 442
           CTG LL HV+  HPAYTELSQL +AA VSKF+YLNS LET+ +++  RSV+ LARHLFFY
Sbjct: 381 CTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFY 440

Query: 443 GDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKI 502
           GDYHGNRSPIAD +MRA IIGQSMDNS++DLA+ YL ACEFI+QQTRQIVE M  SGH +
Sbjct: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDM 500

Query: 503 DAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXXXXXXXXXXXXXXXXDLAKGRRT 562
            AIFMSGGQCRN LL RLLADC+GLPIVIPRYID                  DL+     
Sbjct: 501 AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSE 560

Query: 563 LTTKKSSSAQEFFINSYPS----PQNSAMRH--QNLASDVTCSYNLPNSISSA------- 609
           L+  + SS     I  +P+    P+ SA+    Q  + D+   Y  P++ +S        
Sbjct: 561 LSVSRKSS-----IAGHPTDGSQPKKSAVSKLGQFGSDDLPSPYTAPSATASTSQIASTV 615

Query: 610 --PDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLE---EKRYRGTG-----ILWK 659
             P         + +Q+  D  ++ SS+  LN  A    +   E R +G        +W 
Sbjct: 616 GFPFPTPDDPYALGEQTEPDADNDNSSE--LNFKAHSKWKKDMEDRMKGRSSDNGDAMWN 673

Query: 660 VMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEES 711
           VM  +TG  K V P    +PDR LLD KY+IFLDMAETQ++YR++V+ +E+S
Sbjct: 674 VMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/703 (57%), Positives = 495/703 (70%), Gaps = 23/703 (3%)

Query: 26  SLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSRE 85
           S+  + L+  ++ +YVGVDVGTGSARACIID  GN+LSLAE+PI+RE+L+ NFITQSS+E
Sbjct: 21  SMVGLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQE 80

Query: 86  IWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIIL 145
           IW AVCHCVK+V+++S V  +++HG+GFDATCSLVVV     K VAVGPDF+  DQNIIL
Sbjct: 81  IWQAVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIIL 140

Query: 146 WMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDY 205
           WMDHRA++ET+ IN++ DKCLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DY
Sbjct: 141 WMDHRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADY 200

Query: 206 LTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLR 265
           LTFKA+GKE RSF S VCKQG LP GVEGS  GWS EFL  IGL ELIE DF ++GGS++
Sbjct: 201 LTFKASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVK 260

Query: 266 HK---KNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGL 322
           +    KNFLSAGE IG++D   A ELGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L
Sbjct: 261 NSDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPAL 320

Query: 323 AENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQS 382
            + +      + A GRLAAVAGTSTCHI +S+DPIFV G+WGPYRD LA  FW AEGGQS
Sbjct: 321 VKTDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQS 380

Query: 383 CTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFY 442
           CTG LL HV+  HPAYTELSQL +AA VSKF+YLNS LET+ +++  RSV+ LA+HLFFY
Sbjct: 381 CTGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFY 440

Query: 443 GDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKI 502
           GDYHGNRSPIAD +MRA IIGQSMDNS++DLA+ YL ACEFI+QQTRQIV+ M  SGH +
Sbjct: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDL 500

Query: 503 DAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXXXXXXXXXXXXXXXXDLAKGRRT 562
            AIFMSGGQCRN LL RLLADC+GLPIVIPRYID                  DL+     
Sbjct: 501 SAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSA 560

Query: 563 LT-TKKSSSAQEFFINSYPSPQNSAMRHQNLASDVTCSYNLPNSISSA---------PDT 612
           L+ ++KSS A E      P     +   Q    D+   Y  P++ +S          P  
Sbjct: 561 LSVSRKSSIAGEPANAGQPKKSAVSKFGQLGGDDLPSPYTAPSATASTSQIASTIGFPFP 620

Query: 613 MNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLE---EKRYRGTG-----ILWKVMQEL 664
               +  I +    +    ES++  LN  A    +   E R +G        +W VM  +
Sbjct: 621 TPEDAYAIDEHVEQEKDEGESTE--LNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNM 678

Query: 665 TGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDN 707
           TG  K V P    + DR+LL+ KY+IFLDMAETQ++YR +VD+
Sbjct: 679 TGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/707 (56%), Positives = 499/707 (70%), Gaps = 20/707 (2%)

Query: 26  SLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSRE 85
           S++ I L+   + +YVGVDVGTGSARACIID +GN+LSLAEKPI+REEL+PN+ITQSS+E
Sbjct: 22  SMAAISLEQAMI-YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQE 80

Query: 86  IWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIIL 145
           IW ++CHCVK+V+++S V  +R+HG+GFDATCSLVVV   D K V VGP F  NDQNI+L
Sbjct: 81  IWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLVVVDDED-KEVGVGPVFANNDQNIVL 139

Query: 146 WMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDY 205
           WMDHRA+ ET EIN++ DKCLKYVGGQMSVEMEIPKIKWLKNNL  E F  CKFFDL DY
Sbjct: 140 WMDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADY 199

Query: 206 LTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDF------EK 259
           LTFKAT K+ RSF S VCKQG +P GVEGS  GWS++FLNTI L EL+E+ F        
Sbjct: 200 LTFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPAT 259

Query: 260 LGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPI 319
              +     +FLSAGE +G+LD +AA ELGL  +CVV SG+IDAYAGWVGTVAA+ +  +
Sbjct: 260 ATAADGTTHSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVEL 319

Query: 320 RGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEG 379
             LAE +      + A GRLAAVAGTSTCHI LS+DP+FV+G+WGPYRDV+A GFWAAEG
Sbjct: 320 PDLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEG 379

Query: 380 GQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHL 439
           GQSCTG LL HV+  HPA+TELS L++AA +SKF+YLNS LET+V++R +RSV++LA+HL
Sbjct: 380 GQSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHL 439

Query: 440 FFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSG 499
           +FYGDYHGNRSPIAD +MRA IIGQSMDNS++DLAI YL ACEFI+QQTRQIVE M  +G
Sbjct: 440 YFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAG 499

Query: 500 HKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGXXXXXXXXXXXXXXXXXDLAKG 559
           H+I  IFMSGGQCRN LL RLLADC+GLPI+IPRYID                  +    
Sbjct: 500 HQISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHA 559

Query: 560 RRTLTTKKSSSAQEFFINSYPSPQNSAMRHQ--NLASDVTCSYNLPNSISSAPDTMNRHS 617
           +  +T ++ SS      +S PS        Q   +  D+   Y  P++ SS         
Sbjct: 560 KSEITRRRKSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHATSSTSQIAATSG 619

Query: 618 S----TISKQSRGDMSSEESSKGTLNTVALRS-----LEEKRYRGTG-ILWKVMQELTGD 667
           S     + + S         S+G ++    R+     L  +     G  LW VM ++TG 
Sbjct: 620 SFPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQMTGG 679

Query: 668 AKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714
            K V P+    PDR+LL+ KY+IFLDMA++Q+RYR  +D +E++ +K
Sbjct: 680 GKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAIAK 726

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/731 (54%), Positives = 505/731 (69%), Gaps = 26/731 (3%)

Query: 1   MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLK-DPEVKFYVGVDVGTGSARACIIDQSG 59
           MY  + R  M I       S  + +S S + L  +  + +Y+GVDVGTGSARAC+ID  G
Sbjct: 1   MYRGRSRSSMSI-------SQQRLLSQSMLGLSLEQRMIYYIGVDVGTGSARACLIDSMG 53

Query: 60  NMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSL 119
           N++SLAEKPI+REEL+P +ITQSS+EIW A+C+CVK V+++S VD +R+HG+GFDATCSL
Sbjct: 54  NIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVVRDSGVDIERIHGIGFDATCSL 113

Query: 120 VVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEI 179
           V V++ D   V VGPDF   DQNIILWMDHRA++ET EINS+    LKYVGGQMS+EMEI
Sbjct: 114 VAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEINSTNHPVLKYVGGQMSIEMEI 173

Query: 180 PKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGW 239
           PKIKWLKN++  E F D  FFDL D+LT+KATG   RSF+S+VCKQG LP GVEGSN GW
Sbjct: 174 PKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSFNSSVCKQGLLPLGVEGSNNGW 233

Query: 240 SEEFLNTIGLSELIESDFEKLGGSLR-----HKKNFLSAGECIGSLDWKAARELGLTENC 294
           S EFLN I L EL+ +DF KLGGS++     H+ NFLSAG+ +G+L  +AA +LGL ++C
Sbjct: 234 SGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSAGQYVGALSPEAAADLGLADHC 293

Query: 295 VVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSK 354
           VV SG+IDAYAGWVGTVAA+ +  I  LA+ E      + A GRLAAVAGTSTCH+ LS+
Sbjct: 294 VVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVDKATGRLAAVAGTSTCHVALSR 353

Query: 355 DPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFE 414
           DPIFV G+WGPYRDV+A GFW AEGGQSCTG LL HV+  HPAYT+L  L+ +AG+SKF+
Sbjct: 354 DPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFD 413

Query: 415 YLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLA 474
           YLNS LE +V  R ERSV++LA+HLFFYGDYHGNRSPIAD+ MRA IIGQSMDNSV+DLA
Sbjct: 414 YLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLA 473

Query: 475 ITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRY 534
           + YL ACEFI+QQTRQIVE+M KSGH I +IFMSGGQCRN LL RLLADC+GLPI+IPRY
Sbjct: 474 LQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCRNGLLMRLLADCTGLPIIIPRY 533

Query: 535 IDGXXXXXXXXXXXXXXXXXDLAKGRRTLTTKKSSSAQEFFINSYPSPQNSAMRHQNLAS 594
           ID                  +    +  L  +++SS            +    +   L +
Sbjct: 534 IDAAVVFGSALLGAVASESYNAHHTKTDLRKRRASSLGSKDQAIAGLGKGGLSKLSELQT 593

Query: 595 DVTCSYNLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKGT-----------LNTVAL 643
           D    Y  P++ SS+      +   +   +  ++S  E+   T           + +   
Sbjct: 594 DQPSPYTAPHATSSSHMGGGSYFPIVGSDAAANLSPGEAIAETEDEEEPVTFKSVKSTTQ 653

Query: 644 RSLEEKRYRGTG--ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRY 701
            +L EK    +    LWKVM ++TG  K V PN  T+PDR+LL+ KY+IFLDMA TQ++Y
Sbjct: 654 ENLAEKTDTNSNGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQY 713

Query: 702 RHMVDNLEESF 712
           R  +D +E + 
Sbjct: 714 RSAIDRVEANL 724

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/512 (69%), Positives = 424/512 (82%), Gaps = 3/512 (0%)

Query: 26  SLSTIPLKDP-EVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSR 84
           S+S + L++  ++ +YVGVDVGTGSARAC+ID  GN+LSLAE+PI+R EL+PN+ITQSS+
Sbjct: 22  SMSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQ 81

Query: 85  EIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNII 144
           EIW+A+C+CVK V+++S VDP  +HG+GFDATCSLVVV   + + V VGPDFT N QNII
Sbjct: 82  EIWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLVVVDNNN-EDVGVGPDFTDNLQNII 140

Query: 145 LWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPD 204
           LWMDHRA++ETEEIN++ DKCLKYVGGQMSVEMEIPKIKWLKNN+  + F  CKFFDL D
Sbjct: 141 LWMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLAD 200

Query: 205 YLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSL 264
           YLTFKATG E RS+ S VCKQG LP GVEGS  GWS+EFL  IGL ELI  DF KLGGS+
Sbjct: 201 YLTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV 260

Query: 265 RHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAE 324
             +  FLSAGECIG+L  ++A ELGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L +
Sbjct: 261 T-ETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVK 319

Query: 325 NEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCT 384
           +++  +  + A GRLAAVAGTSTCHI +SKDPIFV G+WGPYRDV+A GFW AEGGQSCT
Sbjct: 320 SDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCT 379

Query: 385 GVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGD 444
           G LL HV+  HPAY ELSQL++AA VSKF+YLNS LE + ++R   SV++LA+HLFFYGD
Sbjct: 380 GALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGD 439

Query: 445 YHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDA 504
           YHGNRSPIAD +MRA IIGQSMDNS++DL+I YL ACEFI+QQTRQIVE M  SGH++ A
Sbjct: 440 YHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAA 499

Query: 505 IFMSGGQCRNDLLTRLLADCSGLPIVIPRYID 536
           IFMSGGQCRN LL RLLADC+GLPIVIPRYID
Sbjct: 500 IFMSGGQCRNGLLMRLLADCTGLPIVIPRYID 531

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 39/53 (73%)

Query: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709
           LW+VM  +TG  K V P +   PDR+LL+ KY+IFLDMA TQ++YR +VD ++
Sbjct: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/505 (60%), Positives = 390/505 (77%), Gaps = 5/505 (0%)

Query: 34  DPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHC 93
           D +  +YVG+DVGTGS RAC++D  GNMLSL EK I REEL+PNFITQS+REIW A C C
Sbjct: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70

Query: 94  VKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMK 153
           VK  I++ +VD   V G+GFDATCSLV +     K V VGP+F   D N+ILWMDHRA+K
Sbjct: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130

Query: 154 ETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGK 213
           E  EIN++ DKCLKYVGG MSVEM+IPKIKWLKNN+   +F+ C+FF+L DYLTFKATGK
Sbjct: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190

Query: 214 ENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRH--KKNFL 271
             RSF S VCKQGFLP GVEGS+ GWS+EFL++IGL +L  + ++ LGG+L++  + NF 
Sbjct: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250

Query: 272 SAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYN 331
           S+G+C+G L  +A  ELGL+ENCVV +G+IDAYAG +GT+AA  E   +      D++  
Sbjct: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQ---IKNDSSIG 307

Query: 332 YNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHV 391
              AIGRLA+VAGTSTCH+LLSKDP+FV G+WGPYRDV+A G+W AEGGQ+CTG LL +V
Sbjct: 308 LQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYV 367

Query: 392 IKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSP 451
           + IHPA+ EL   +  A + KF+YLN+ML+ +  K    S + LA+H+FFYGDY GNRSP
Sbjct: 368 LSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSP 427

Query: 452 IADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQ 511
            AD  M A IIGQSM++++E+LA+TYL+ACEFI+QQTRQIVE + K+G  +  I+MSGGQ
Sbjct: 428 YADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQ 487

Query: 512 CRNDLLTRLLADCSGLPIVIPRYID 536
           CRN LL +LL+DC+GLPI++P+Y+D
Sbjct: 488 CRNKLLMKLLSDCTGLPIMLPKYVD 512

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 39/54 (72%)

Query: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709
           +LW+ M  +T     + PN   HPDR LLD KYQIFLDMAETQ++YR MVD+++
Sbjct: 542 MLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/501 (61%), Positives = 381/501 (76%), Gaps = 4/501 (0%)

Query: 40  YVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQ 99
           Y+GVDVGTGS RAC+I+  G +LSL  K I +EEL+PN+ITQSSREIW  +C CV  V+Q
Sbjct: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63

Query: 100 ESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEIN 159
           ES++ P  V G+GFDATCSLVV+     + V VGP+F  +++NIILWMDHRA+KET+EIN
Sbjct: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123

Query: 160 SSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFS 219
           ++ DKCLKYVGG+MSVEME+PKIKWLKNNL   +F +CKFFDL DYLT+KAT K+ RSFS
Sbjct: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183

Query: 220 SAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKK---NFLSAGEC 276
           S VCKQG LP GVEGS++GWS+EF   I L EL   +F  +GGS+  ++   N  S GE 
Sbjct: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243

Query: 277 IGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAI 336
           +G L   +A+ELGL   C+V SG+IDAYAGWVGTVAAK E  I  +  ++D +   + +I
Sbjct: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASSKLDSSI 302

Query: 337 GRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHP 396
           G LA +AGTSTCHI LS  PIFV+GIWGPYRDVL+  FW AEGGQSCTG LL+H++  HP
Sbjct: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362

Query: 397 AYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSN 456
           AY EL +      V  FE+LN+ L  + K+ + RS+ISL +H F YGDYHGNRSPI+D +
Sbjct: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422

Query: 457 MRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDL 516
           MRA IIGQSMD S++ LAI YLSACEFISQQ+RQI+  ++K+GH I  I+MSGGQ RN L
Sbjct: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482

Query: 517 LTRLLADCSGLPIVIPRYIDG 537
           L RLLADC+GLP+VIPRYID 
Sbjct: 483 LMRLLADCTGLPVVIPRYIDA 503

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%)

Query: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714
           LW  M +LT     +NPN   HPDR+LL+ KY+IFLDMAETQ++YR  +D +E SF++
Sbjct: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEASFNE 594

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/509 (60%), Positives = 390/509 (76%), Gaps = 16/509 (3%)

Query: 34  DPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHC 93
           + ++ +Y+GVDVGTGS RACIID  G + S AE  I R+EL+ + ITQSS+EIW AVC C
Sbjct: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61

Query: 94  VKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMK 153
           VK V+ E     D+V G+GFDATCSLVVV     +GVAVGPDF  ++Q+IILWMDHRA+K
Sbjct: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121

Query: 154 ETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGK 213
           ET+EINS+ D+CLKYVGGQMS+EME+PKIKWLK ++  ++F  C+F+DL DYLTFKATG+
Sbjct: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181

Query: 214 ENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSL--RHKKNFL 271
           + RSF S VCKQG +P GVEGS LGWS++FL  I L EL  +D+ KLGGS+   H +NFL
Sbjct: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFL 241

Query: 272 SAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKP---ESPIR-GLAENED 327
           +AGE I  L+ +A  EL L++ C+V SG+IDAYAGW+GTV +     E   R G+A    
Sbjct: 242 TAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMAN--- 298

Query: 328 NTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVL 387
                  AIGRLAAVAGTSTCHI+LSKDPIFV G+WGPY+D + +G+W  EGGQSCTG L
Sbjct: 299 -------AIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGAL 351

Query: 388 LDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHG 447
           L HV++ HP+Y EL +++   G++KF+YLN+ L  M K+ NERSV+ LA+H+FFYGD HG
Sbjct: 352 LQHVLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHG 411

Query: 448 NRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFM 507
           NRSP+AD +M+  I+G SMD S+++LA TYL+ACEFI+QQ RQI+E M  +GH+I AI+M
Sbjct: 412 NRSPLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYM 471

Query: 508 SGGQCRNDLLTRLLADCSGLPIVIPRYID 536
           SGGQCRN LL +LLADCSGL ++IP YID
Sbjct: 472 SGGQCRNSLLMKLLADCSGLSVIIPEYID 500

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 38/55 (69%)

Query: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEE 710
           ILW  M ++T     + P    HPDRILLD KY+IFLDMA+ QKRYR +VD +E+
Sbjct: 534 ILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/497 (59%), Positives = 382/497 (76%), Gaps = 2/497 (0%)

Query: 40  YVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQ 99
           ++GVDVGTGS RAC+ID+ G++L+L +KPI REEL+P FITQSS EIWD++C CV+ VI 
Sbjct: 21  FIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80

Query: 100 ESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEIN 159
           ++++  ++V G+GFDATCSL VV     +G+AVGP F+KNDQNII+WMDHRA +ET+EIN
Sbjct: 81  DAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEIN 140

Query: 160 SSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFS 219
           S  D  LKYVGG+MS+EME+PKIKWLKN++  E F+   FFDLPDYLTFKATG +NRS  
Sbjct: 141 SIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLC 200

Query: 220 SAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGS 279
           SAVCKQG LP GVEGS  GWS  FL+  GL ELIE++FE++GG   + +NFLSAGE + +
Sbjct: 201 SAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVST 260

Query: 280 LDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRL 339
           L   +  +LGLTE+CVV SGLIDAYAG +GT+AA+ +   R   +++ N  +   AIGRL
Sbjct: 261 LSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQDLQNAIGRL 318

Query: 340 AAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYT 399
           AAVAGTSTCHI LS  PIFV+G+WGPY+D+LA+ +W AEGGQSCTG LL HVI  HPAY 
Sbjct: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378

Query: 400 ELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRA 459
           EL      + +  FE LN ++  + +++   +++ L + LF YGDYHGNRSPIAD  MRA
Sbjct: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438

Query: 460 CIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTR 519
            IIGQSMD +VE LA+ YL+ACEFI+ QTR I+  M ++GH I +I+MSGGQCRN++L  
Sbjct: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498

Query: 520 LLADCSGLPIVIPRYID 536
           LLAD +GLP+VIP+YID
Sbjct: 499 LLADFTGLPVVIPKYID 515

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 36/51 (70%)

Query: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDN 707
           LW  M ++TG+   + P    H  + LL+TKY+I++DMA+TQK+YR ++D+
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/501 (58%), Positives = 376/501 (75%), Gaps = 8/501 (1%)

Query: 36  EVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVK 95
           E  +Y+GVDVGTGSARA ++   G  L+L E PIKR+ELR +FITQSS EIW AVCHCV+
Sbjct: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62

Query: 96  AVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKET 155
            V+ +S V+P  V G+GFDATCSLV V A     V VGP+F  + QNIILWMDHRA +ET
Sbjct: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122

Query: 156 EEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKEN 215
           + IN++ D+CLKYVGGQMSVEME+PKIKWLK ++    F  CKFFDLPDYLTF AT K+ 
Sbjct: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182

Query: 216 RSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGE 275
           RSF SAVCKQG LP GV+GS   WS EFL  +GLSELI+++F +LGG+   K  FL+AG+
Sbjct: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQ 242

Query: 276 CIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGA 335
            +G L  +A+ + GL+ +C+V+SG+IDAYAGW+G+V AK         +    +   + A
Sbjct: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAK--------FDQSHKSSGLDVA 294

Query: 336 IGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIH 395
           I RLA +AGTSTCHI+LSK P FV G+WGPYRDVL  G+W AEGGQSCTG LL H+++ H
Sbjct: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354

Query: 396 PAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADS 455
           PA+ EL +L     VS FEYL  ML+T++ KR  R+V+ L+R  F YGD+HGNRSP+AD 
Sbjct: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414

Query: 456 NMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRND 515
           +MRA +IGQSMD S+E LA+ YL+ACEFI+ QTRQIVE M+++GH ++ ++MSGGQCRN 
Sbjct: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474

Query: 516 LLTRLLADCSGLPIVIPRYID 536
           LL +L+AD  G+P+V+P+Y D
Sbjct: 475 LLMQLIADSVGVPVVLPKYTD 495

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%)

Query: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFS 713
           LW +M  +T     V PN  +  +R  +D KY IFLDM E QK YR  +D +  S +
Sbjct: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSIT 580

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/506 (57%), Positives = 383/506 (75%), Gaps = 6/506 (1%)

Query: 37  VKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKA 96
           + +Y+GVDVGTGSARAC+ID +G++LS+ E  I R+EL+P +ITQS+ +IW+ +C C++ 
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 97  VIQESRVD--PDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKE 154
           ++QES VD    ++ G+GFDATCSLVV+++   + VAVGP+F  NDQN+ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 155 TEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKE 214
           T EINS++ KCLKYVGGQMSVEMEIPKIKWLKNN+   +++DCKF DLPD+LT+KATG  
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 215 NRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRH----KKNF 270
            RSF SAVCKQG LP GVEGS  GW+EEFL  IGL +L+E +F KLGG ++     K +F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 271 LSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTY 330
            +AGE IG L  K+++ +G++  C VSSG+IDAYAGW+GT+AA  + PI  L   +DN  
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 331 NYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDH 390
               + GRLA VAGTSTCHI L+  PIFV G+WGPYRDVL   FW AEGGQSCTG LL H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 391 VIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRS 450
           V++ HPAY EL  ++    +S FE LN+ +  +  +R+    + L ++LFFYGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 451 PIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGG 510
           P+AD  MR  IIG SMD+S+ DL   YL ACEFI+QQTR IV++M KSG+ + +++MSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 511 QCRNDLLTRLLADCSGLPIVIPRYID 536
           QCRN+LL +L+++C GLP+VIP+ ID
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNID 506

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 33/53 (62%)

Query: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNL 708
           ILW VM ++TG    V+P   +     LL  KYQI+LDM  TQKRYR MV+ L
Sbjct: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVNGL 589

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/501 (59%), Positives = 376/501 (75%), Gaps = 9/501 (1%)

Query: 37  VKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKA 96
           ++ Y+GVDVGT S RAC++D  G +LSLA KPI R+E++PN++TQSS EIW A+C C++ 
Sbjct: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61

Query: 97  VIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETE 156
           +I +S+V  D + G+GFDATCSLVV+     KGVAVGP+F   +Q+IILWMDHRA+ E  
Sbjct: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121

Query: 157 EINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENR 216
           EINS+  +CLKYVGG+MS+EM+IPKIKWLKNNL    F  C+F+DLPD+LT++ATG + R
Sbjct: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181

Query: 217 SFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRH-KKNFLSAGE 275
           SF S VCK G LP GV+GS  GW ++    IGL+EL   +F KLGG +     NFLSAG+
Sbjct: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGD 241

Query: 276 CIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGA 335
            +G L  +AA +LGLT  C+V+SGLIDAYAGWVGT+AA       G+    D   +   A
Sbjct: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA-------GITLGSDGQES-ELA 293

Query: 336 IGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIH 395
             RLA VAGTSTCHI +SK P F+ G+WGPYRD L  G+W  EGGQSCTG LL HV+K H
Sbjct: 294 SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSH 353

Query: 396 PAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADS 455
           PAY  L +L    G+SKF+++N+ LE + ++R  +SV +L +HLFFYGDYHGNRSPIAD 
Sbjct: 354 PAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADP 413

Query: 456 NMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRND 515
           NMRA IIGQSMD SV+DLAI  L ACEFI+QQTRQIVE + +SGH+I +I+MSGGQCRN 
Sbjct: 414 NMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNL 473

Query: 516 LLTRLLADCSGLPIVIPRYID 536
           +L +LLA+C+ LPIV+P+YID
Sbjct: 474 VLIKLLANCTKLPIVLPKYID 494

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 35/56 (62%)

Query: 656 ILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEES 711
           ILW VM  LTG  + + P+     +  LLD KY+IFLDM ETQKRYR +V   E S
Sbjct: 541 ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENS 596

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/499 (56%), Positives = 359/499 (71%), Gaps = 8/499 (1%)

Query: 39  FYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVI 98
           +Y+GVDVG+GS RAC++D  G MLS+A + I +EE  P  +TQSS EIWDAVC+CVK+ I
Sbjct: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62

Query: 99  QESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEI 158
             S V+   + G+GFDATCSLVV++    + VA GP+F  N+QNII+WMDHRA++ET+EI
Sbjct: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122

Query: 159 NSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSF 218
           N S D CLKYVGGQMSVEMEIPKIKWLKN++  E F+   F DLPDYLTF A+G   RS+
Sbjct: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182

Query: 219 SSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIG 278
            SAVCKQGFLP GVEGS+ GWS EFL  IGL E+ +S+F  LGG      NF  AG  + 
Sbjct: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241

Query: 279 SLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKP-ESPIRGLAENEDNTYNYNGAIG 337
           ++     +   +   C+V SG+IDAYAGW+GTVA+   E P      N     +     G
Sbjct: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVP------NNKEVVDIEECAG 295

Query: 338 RLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPA 397
           RLAAVAGTSTCHI+LSK  IFV G+WGPYRDVL   +W AEGGQS TG LL H++ IHP+
Sbjct: 296 RLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPS 355

Query: 398 YTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNM 457
             ELS L     V KF +LN+ +  + +K N  + + L +  F YGDYHGNRSPIAD NM
Sbjct: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415

Query: 458 RACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLL 517
           RA IIGQSMD S++DLA TYL+ACEFI+ QT+ I++ ++ +GH I AI+MSGGQCRN++L
Sbjct: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNIL 475

Query: 518 TRLLADCSGLPIVIPRYID 536
            +L+A+C+GLP++IP+YID
Sbjct: 476 MQLIANCTGLPLIIPKYID 494

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 653 GTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDN 707
           G  +LW  M  +T D   V P      +R L++ K++IFLDMA+TQ+ YR +V+N
Sbjct: 520 GADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVEN 574

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/675 (46%), Positives = 404/675 (59%), Gaps = 88/675 (13%)

Query: 38  KFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAV 97
           ++YVGVDVGT  ARACIID+SG +L+  + PI R + + + ITQSS EIW AVC  V+A 
Sbjct: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67

Query: 98  IQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEE 157
           + ES+V  D V G+ FDATCSLVV+       VAVGPDF+ N QN+ILWMDHRA+ E  E
Sbjct: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127

Query: 158 INSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRS 217
           INS+    L+YVGG+MSVEM++PKIKWL+ ++    F  CKF+DLPD+LT++ATG E+RS
Sbjct: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187

Query: 218 FSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHK-KNFLSAGEC 276
           F S VCK G +P GV+ S  GWS EFL  IGL EL E  F +LGG+L      F SAGE 
Sbjct: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEP 247

Query: 277 IGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAI 336
           +G L   AA  LGLT  CVV SG+IDAYAGWVGTV A P+         E          
Sbjct: 248 VGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEE--------LA 299

Query: 337 GRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHP 396
           GRLAAVAGTSTC I+LS+ P FV G+WGPYRDVLARG+W  EGGQSCTG LL H +  HP
Sbjct: 300 GRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHP 359

Query: 397 AYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSN 456
           AYTEL Q     G++ F+Y+N  L+ +  +   RS+ +LA+H F YGDYHGNRSP+AD +
Sbjct: 360 AYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPS 419

Query: 457 MRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDL 516
           MRA ++G SMD S +DLA+  L+A EFI+ Q R I++ M  +G  +D +++SGGQ RN L
Sbjct: 420 MRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPL 479

Query: 517 LTRLLADCSGLPIVIPRYIDGXXXXXXXXXXXXXXXXXDLAKGRRTLTTKKSSSAQEFFI 576
           LT+LLAD                                    RR + T +   A   F 
Sbjct: 480 LTQLLADAV----------------------------------RRPVVTPRHVGAAVVFG 505

Query: 577 NSYPSPQNSAMRHQNLASDVTCSYNLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKG 636
           ++  +   +A+ +    ++ T S  LP+S S AP  M+R                     
Sbjct: 506 SALLAA--AAVENYLANTNATASSILPSSASRAP--MHR--------------------- 540

Query: 637 TLNTVALRSLEEKRYRGTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAE 696
                               LW++M  LT     V+P+    PD  LL+ KY++FL+MAE
Sbjct: 541 --------------------LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAE 580

Query: 697 TQKRYRHMVDNLEES 711
            QK YR +VD++E +
Sbjct: 581 AQKLYRKLVDDVENT 595

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/498 (56%), Positives = 360/498 (72%), Gaps = 3/498 (0%)

Query: 40  YVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQ 99
           Y+GVDVGTGSARACI +++G +L++  K I ++EL+  FITQSS EIWDA+   +K VI 
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 100 ESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEIN 159
            S VDP  + G+ FDATCSLVV      + +AVGP+F  ++QNIILWMDHRA  ET+ IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 160 SSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFS 219
           S+ DK LKYVGG+MSVE E+PKIKWLK++L  E F  C F DL D+LT+KATGK   SFS
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 220 SAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKK-NFLSAGECIG 278
           SAVCKQG LP GVEGS LGWS+EFL  IGL EL  ++FEKLGGS+  K+ NFL  G+ +G
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243

Query: 279 SLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGR 338
            +D K A    L  +CVV +G+IDAY+GWVGTVA+     +   +  E N     G++GR
Sbjct: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELN--KIEGSLGR 301

Query: 339 LAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAY 398
           +A V+GTSTCHI+LSK P+F+ G+WGPYRDVLA   WA EGGQS TG LLD++I+ HPAY
Sbjct: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361

Query: 399 TELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMR 458
            EL ++T+    + F YL+  LE +   R   SV  L +++F YGDY+GNRSP+AD  M 
Sbjct: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421

Query: 459 ACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLT 518
             IIGQ+MD+S+ DLAI YL+ACEFI+ QTR I++ ++  GH I AI+MSGG C+N LL 
Sbjct: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481

Query: 519 RLLADCSGLPIVIPRYID 536
            L+++C  LP+V+ +YID
Sbjct: 482 ELISNCCVLPLVLSKYID 499

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 638 LNTVA--LRSLEEKR--YRGTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLD 693
           L +VA  + S++E +  Y    +LW  M+ +T     + P       R  L  KY+++LD
Sbjct: 509 LGSVAAKINSMKENKLEYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLD 568

Query: 694 MAETQKRYR 702
           M +T  +YR
Sbjct: 569 MIDTNIKYR 577

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  197 bits (501), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 146/499 (29%), Positives = 232/499 (46%), Gaps = 81/499 (16%)

Query: 41  VGVDVGTGSARACIIDQSGN-MLSLAEKPIKREELRPNFITQSSR--EIWDAVCHCVKAV 97
           +G+D+G+ SAR  I D   + +L++A++P+      P +   S +  + W      +KA+
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPV------PYYHDSSKKSWKFWQKSTEIIKAL 62

Query: 98  ---IQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKE 154
               QE ++    V   G  ATCSL +       G  +      N+ N+I WMD  A+ E
Sbjct: 63  QNCFQELKITQYNVRSCGVSATCSLAIFQKDLTNGNLIP---YPNEDNVIFWMDSSAVDE 119

Query: 155 TEEINSSEDKC----LKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKA 210
            E +N   +KC    L Y+GG+   EM IPK+K+  N       +    FDL  Y+ ++ 
Sbjct: 120 CEWLN---EKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYEL 176

Query: 211 TGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNF 270
                 +      ++     G +G   GWS  F N          D  KL  ++      
Sbjct: 177 GRLYRWNTDELSARENINGIGNDGEASGWSSSFYN----------DIMKLPSNV------ 220

Query: 271 LSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTY 330
                 IG     +      T  C      ID+YA W    +   E+             
Sbjct: 221 -----TIGLTGLNSNNSSSTTTVC----SCIDSYASWFAVSSPNLEAS------------ 259

Query: 331 NYNGAIGRLAAVAGTSTCHILLSKDPIF---VHGIWGPYRDVLARG--FWAAEGGQSCTG 385
                   L  +AGTSTC++  S  P+    + G+WGP+  +L     +     GQSCTG
Sbjct: 260 --------LFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTG 309

Query: 386 VLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDY 445
            L++H+ K HPA  ++ +    +G   +E L + ++  ++K+N +S+  LA+H+FFYGDY
Sbjct: 310 KLIEHLFKSHPAARKIQR----SGEDIYEVLENSIQD-IEKKNRKSIHILAKHMFFYGDY 364

Query: 446 HGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVM--LKSGHKID 503
            GNR+P ADS MR   IG+S D S+ +L   Y+S  EF+S QT+ I++      SG +I+
Sbjct: 365 EGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIE 424

Query: 504 AIFMSGGQCRNDLLTRLLA 522
            + +SG Q +N  L  L++
Sbjct: 425 ELRVSGSQAKNGRLLSLIS 443

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  182 bits (462), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 139/526 (26%), Positives = 234/526 (44%), Gaps = 78/526 (14%)

Query: 7   RRRMQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGN-MLSLA 65
           R+R   +T  LE+  +K              +  +G+DVG+ SAR  I +   + +L +A
Sbjct: 11  RKRTHNETSMLEIKMTKD-----------SARIGIGIDVGSSSARVGIYNYENDALLGMA 59

Query: 66  EKPIKREELRPNFITQSSREIWDAVCHCVKAV---IQESRVDPDRVHGMGFDATCSLVVV 122
           ++P+   +      +++S + W      +KA+   +Q+ ++    V   G  ATCSL + 
Sbjct: 60  QEPVPYYQDS----SRTSWKFWQRSTEIIKALQKCLQKLKITEYNVKSCGVSATCSLAIF 115

Query: 123 SATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSS-EDKCLKYVGGQMSVEMEIPK 181
                 G  +      N+ N+I WMD  A+ E +++N+    + L ++GG    EM IPK
Sbjct: 116 EKDKRNGSLIP---YPNEDNVIFWMDSSAIDECKQLNAECSQQLLDFLGGSFVPEMGIPK 172

Query: 182 IKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSE 241
           +K+  N       +    FDL  Y+ ++ +     +    + ++     GV+G   GWS 
Sbjct: 173 LKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLYQWNNEVLLKRENNKMVGVDGEASGWSP 232

Query: 242 EFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLI 301
            F   I                       L +   IGS     A    +  + +V S  I
Sbjct: 233 SFYENIM---------------------HLPSNVIIGS---NGATCKKIASSAIVRS-CI 267

Query: 302 DAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSK-DPIFVH 360
           D+YA W    +   E+                     L  +AGTSTC++  +    I + 
Sbjct: 268 DSYASWFAVSSPHLET--------------------SLFMIAGTSTCYMYGTPITDIKIP 307

Query: 361 GIWGPYRDVLARG--FWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNS 418
           G+WGP+  +L     F     GQSCTG L++H+   HP   E+ +     G   ++ L  
Sbjct: 308 GVWGPFDSILDSNSHFSVYAAGQSCTGKLIEHLFVTHPCAKEILK----RGADIYQVLER 363

Query: 419 MLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYL 478
            +   ++K+N +SV    + +FFYGDY GNR+P AD  M+   IG++ D S+ +L   Y+
Sbjct: 364 TIHD-IEKQNGQSVHVFTKDIFFYGDYEGNRTPFADPRMKGSFIGETTDTSILNLIHKYI 422

Query: 479 SACEFISQQTRQIVEVMLKS--GHKIDAIFMSGGQCRNDLLTRLLA 522
              EF+S QTR I++   +   G  I  + +SG Q +N  L  L++
Sbjct: 423 CILEFLSFQTRLIIDTFKRQNIGMCIQELRISGSQAKNKRLLSLIS 468

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 681 RILLDTKYQIFLDMAETQKRYRHMVDNL 708
           R LL  KY+I LDMA+ Q+RY  ++D +
Sbjct: 536 RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  174 bits (440), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 141/508 (27%), Positives = 232/508 (45%), Gaps = 76/508 (14%)

Query: 41  VGVDVGTGSARACIIDQSGN-MLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAV-- 97
           +G+D+G+ SAR  I     + +L +A++P+   +   +F T+ S + W      ++A+  
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQ---DF-TKKSWKFWQKSTEIIEALQK 64

Query: 98  -IQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETE 156
             Q+ ++    V   G  ATCSL +          +      N+ N+I WMD  A  E E
Sbjct: 65  CFQKLKITEYNVKSCGVSATCSLAIFERVHTSEALIP---YPNENNVIFWMDSSATDECE 121

Query: 157 EINSSEDK-CLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKF--FDLPDYLTFKATGK 213
            +N+   K  L Y+GG+   EM IPK+K+  N       QD +F  FDL  Y+ ++    
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHR--QDKRFHIFDLHQYIAYELGRL 179

Query: 214 ENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSA 273
              +    +  +     G +G   GWS  F   I                +    N +  
Sbjct: 180 YQWNIDGLLRGENINGIGNDGEASGWSSSFYKNI----------------MNIPSNVI-- 221

Query: 274 GECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYN 333
              IG +   + + +  T    V    ID+YA W    A  P    R L           
Sbjct: 222 ---IGPVGLVSKKVISTT----VVRSCIDSYASWF---AVSPPFLERSLF---------- 261

Query: 334 GAIGRLAAVAGTSTCHILLSKDPIF---VHGIWGPYRDVL--ARGFWAAEGGQSCTGVLL 388
                   +AGTS+C+  +   P+    + G+WGP+ ++L     F     GQSCTG L+
Sbjct: 262 -------MIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGKLI 312

Query: 389 DHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGN 448
           +H+ + HP   ++ +    +G   ++ L   +  + KK+   S+  LA+ +FFYGDY GN
Sbjct: 313 EHLFESHPCARKILK----SGADIYQVLEQTIHGIEKKKG-LSIHILAKDMFFYGDYEGN 367

Query: 449 RSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVM--LKSGHKIDAIF 506
           R+P AD  M+   IG++ D S+ +L   Y+S  EF+S QT+ I++     K+  +I  + 
Sbjct: 368 RTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELR 427

Query: 507 MSGGQCRNDLLTRLLADC-SGLPIVIPR 533
           +SG Q RN+ L  L++   +G+ I  PR
Sbjct: 428 ISGSQARNERLLSLISLVNNGMSINRPR 455

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 683 LLDTKYQIFLDMAETQKRYRHMVDNLEESFS 713
           LL  KY+I LDMA+ QK Y  +VD +   FS
Sbjct: 513 LLCVKYRIHLDMAKQQKYYYKLVDEVISPFS 543

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  171 bits (432), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 133/507 (26%), Positives = 232/507 (45%), Gaps = 74/507 (14%)

Query: 41  VGVDVGTGSARACIIDQSGN-MLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAV-- 97
           +G+DVG+ SAR  + +   + +L +A++P+   +      ++ S + W      +KA+  
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDS----SKKSWKFWQKSTEIIKALQK 64

Query: 98  -IQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETE 156
            +Q+  +    V   G  ATCSL +        + +      N+ N+I WMD  A+ E +
Sbjct: 65  CLQKLNIREYEVKSCGVSATCSLAIFERDRTSNMLIP---YPNEDNVIFWMDSSAVNECQ 121

Query: 157 EIN-SSEDKCLKYVGGQMSVEMEIPKIKWLKN---NLRSELFQDCKFFDLPDYLTFKATG 212
            +N     + L Y+GG+   EM +PK+K+  +   +LR + F     FDL  Y+ ++ + 
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFH---IFDLHQYIAYELSR 178

Query: 213 KENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLS 272
               +    + ++     G +G   GWS  F   I                       L 
Sbjct: 179 LYEWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNII---------------------NLP 217

Query: 273 AGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNY 332
           +   IG+    A + +  T    V    ID+YA W    +   E+               
Sbjct: 218 SNVSIGTTSLVANKHISTT----VVRSCIDSYASWFAVASPHLETS-------------- 259

Query: 333 NGAIGRLAAVAGTSTCHIL-LSKDPIFVHGIWGPYRDVL-ARG-FWAAEGGQSCTGVLLD 389
                 L  +AGTS+C++   +     + G+WGP+  +L  RG F     GQSCTG L++
Sbjct: 260 ------LFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKLIE 313

Query: 390 HVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNR 449
           H+ + HP   ++  L + A +  ++ L   +   ++K N  S+  L + +FFYGDY GNR
Sbjct: 314 HLFESHPCARKI--LKDGADI--YQVLEQTIRD-IEKNNGLSIHILTKDMFFYGDYEGNR 368

Query: 450 SPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVML--KSGHKIDAIFM 507
           +P AD  ++   IG+S D S+ +L   Y+   EF+S QT+ I++      S   I  + +
Sbjct: 369 TPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRI 428

Query: 508 SGGQCRNDLLTRLLADC-SGLPIVIPR 533
           SG Q +N+ L  L++   +G+ I+ P+
Sbjct: 429 SGSQAKNERLLSLISLVNNGVAIIKPK 455

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 681 RILLDTKYQIFLDMAETQKRYRHMVDNL 708
           R LL  KY I LDMA+ QKRY  +VD +
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  167 bits (424), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 126/505 (24%), Positives = 219/505 (43%), Gaps = 86/505 (17%)

Query: 41  VGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIW------DAVCHCV 94
           +G+D+G+ S R  +     +++    K       + ++       +W      D +   +
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVKQ------KISYYYHGDSALWEYTQSTDEIMKVI 59

Query: 95  KAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKE 154
           +  + + ++D   +   G  ATCS+ +                 + QN+I WMD+ +  E
Sbjct: 60  ERCLHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSKTE 119

Query: 155 TEEINSSEDKCLK-YVGGQMSVEMEIPKIKWLKNNLRS-ELFQDCKF--FDLPDYLTFKA 210
            + +N+  +K L+ ++GG+   EM IPKI  L N L+S +  Q+      DL  YL ++ 
Sbjct: 120 CKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAYEI 179

Query: 211 TGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLN---------TIGLSELIESDFEKLG 261
             +   +F   +    F   G +G   GWS +F           TIG    +E DFE   
Sbjct: 180 AKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLEDDFEYCK 239

Query: 262 GSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRG 321
           G                                 + +  ID Y+ W+   +  PE     
Sbjct: 240 G---------------------------------IVASCIDCYSSWLSLCSPTPEE---- 262

Query: 322 LAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVL--ARGFWAAEG 379
                            L  V GTSTC++  +     + G+WGP+ D+L  +  +   EG
Sbjct: 263 ----------------SLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEG 306

Query: 380 GQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHL 439
           GQSCTG L++H+++ HPA + +++      + K E   S +E    ++  RS+    +H+
Sbjct: 307 GQSCTGKLIEHLLQTHPASSSIAKDDWPLLLEKIEQEISAIE----EQTGRSIHFKTKHM 362

Query: 440 FFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKS- 498
           FFYGD+ GNR+P AD  M    IG++ D S  +L + Y+   EF++ Q + ++ +  K+ 
Sbjct: 363 FFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQ 422

Query: 499 -GHKIDAIFMSGGQCRNDLLTRLLA 522
              KI  I + G Q +N  L  L++
Sbjct: 423 GQDKITEIRICGSQAKNKRLLSLIS 447

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 667 DAKAVN----PNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEE 710
           D K V+    P+    P  +LL+ KY+I LDMA+ Q  YR M++ + E
Sbjct: 492 DQKQVDIFETPSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKIPE 539

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  167 bits (424), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 133/470 (28%), Positives = 208/470 (44%), Gaps = 76/470 (16%)

Query: 41  VGVDVGTGSARACIID-QSGNMLSLAEK--PIKREELRPNF-ITQSSREIWDAVCHCVKA 96
           +G+D+G+ S R  + + Q+  +++   K  P        N+  TQSSREI  A+  C   
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQC--- 66

Query: 97  VIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETE 156
             QE  +D   +   G  ATCSL +    D   +    D    D+N++ WMD  A+KET+
Sbjct: 67  -FQELNIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSIAIKETQ 123

Query: 157 EINS-SEDKCLKYVGGQMSVEMEIPKIKW----LKNNLRSELFQDCKFFDLPDYLTFKAT 211
           E+N  +  +   ++GG    EM +PK++     LKN   +  F+     DL  Y+     
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMSLA 180

Query: 212 GKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFL-NTIGLSELIESDFEKLGGSLRHKKNF 270
            +    +++          G +G   GWS  F  N + L   I      + G  +H ++ 
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENVLQLPPNI------VIGPTKHSQHS 234

Query: 271 LSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTY 330
              G  + S              C      ID Y+ W              L  N  N+ 
Sbjct: 235 SKQGLKVSS--------------C------IDCYSNWFAL-----------LPSNLQNS- 262

Query: 331 NYNGAIGRLAAVAGTSTCHILLSKDPIFVH---GIWGPYRDVLARG--FWAAEGGQSCTG 385
                   L  V GTSTC++  S +  F H   G+WGP+ ++  R   F   E GQSCTG
Sbjct: 263 --------LFIVGGTSTCYLYASSE--FSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTG 312

Query: 386 VLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDY 445
            L++H+ K HPA    S +        F  +N  +E  V++  + S+    +H+FFYGD 
Sbjct: 313 KLIEHLFKTHPAS---SHIDTRDWPHLFSQINDFIEK-VEQNTQDSIHMQTKHMFFYGDL 368

Query: 446 HGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVM 495
            GNR+P AD +M    IG++ D S  +L   Y+S  EFI+ Q + ++ + 
Sbjct: 369 DGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIF 418

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 25/32 (78%)

Query: 683 LLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714
           LL+ KYQI+ +MAE Q++YR  V+N+ E+ +K
Sbjct: 507 LLEVKYQIYFNMAEQQRKYRKQVNNVIENRTK 538

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  166 bits (421), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 139/500 (27%), Positives = 221/500 (44%), Gaps = 78/500 (15%)

Query: 37  VKFYVGVDVGTGSARACIID-QSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVK 95
           V+  +G+D+G+   R    + ++   +++  + +   E      TQSS EI  A+  C +
Sbjct: 4   VRIGLGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFE 63

Query: 96  AVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGV---AVGPDFTK-NDQNIILWMDHRA 151
           ++     +D   V   G  ATCSL V      KG+    V  D    NDQN++ WMD  A
Sbjct: 64  SL----NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNA 119

Query: 152 MKETEEINSSEDKCLKYVGGQMSVEMEIPKI-KWLKNNLRSELFQDCKFFDLPDYLTFKA 210
           ++E   IN        Y GG    EM +PK+  +LK+  ++    D + FDL  Y+ +  
Sbjct: 120 IEECSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN--SDFEVFDLHTYVAYDL 177

Query: 211 TGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNF 270
             +     S  + +      G +G   GW +EF             +EK   +L+   N 
Sbjct: 178 ANRYGWDASFLINRPNHNGIGHDGEIKGWKDEF-------------YEK---TLKLPPNV 221

Query: 271 LSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTY 330
                CI        R      + V  +  ID Y+ W    ++ PE              
Sbjct: 222 RIGPLCIN-------RRF----SPVKVASCIDCYSSWFSMFSSTPER------------- 257

Query: 331 NYNGAIGRLAAVAGTSTCHILLSKDPI-FVHGIWGPYRDVLARG---FWAA-EGGQSCTG 385
                   L   AGTSTC++  +  P   + GIWGP+ D+L       W+  E GQS TG
Sbjct: 258 -------SLFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTG 310

Query: 386 VLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLET---MVKKRNERSVISLARHLFFY 442
            L++H+ + HPA     +  N         L + LET   ++++++  SV    +H+F Y
Sbjct: 311 KLIEHLFESHPAAKPYLEDRNV--------LFNRLETEINLIEQQSAESVHFKTKHMFNY 362

Query: 443 GDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKI 502
           G+  GNR+P  D  M    IG+S D S  DL + Y++  EF++ Q R I E +   G  I
Sbjct: 363 GELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPI 419

Query: 503 DAIFMSGGQCRNDLLTRLLA 522
           + I ++G Q +N+ L  L++
Sbjct: 420 NDIRVAGSQAKNNRLLSLIS 439

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 22/26 (84%)

Query: 681 RILLDTKYQIFLDMAETQKRYRHMVD 706
           R L + KY+I+L+MA+TQ++YR MV+
Sbjct: 505 RALFEIKYKIYLNMAQTQRQYREMVN 530

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  160 bits (406), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 134/489 (27%), Positives = 220/489 (44%), Gaps = 71/489 (14%)

Query: 41  VGVDVGTGSARACIID-QSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQ 99
           +G+D+G+ + R  I D ++  ++ +  KP+       N +TQSS +I  A+  C    IQ
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGC----IQ 66

Query: 100 ESRVDPDRVHGMGFDATCSLVVVSA--TDAKGVAVGPDFTKNDQNIILWMDHRAMKETEE 157
           +   D   V   G  ATCSL V +    D K + +     +   N++ WMD  A  E E 
Sbjct: 67  DLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 158 INSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRS 217
           +N +  +  +++GG    EM IPK+  +     +E     + FDL  Y+ ++   K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAE-GHKLEVFDLHSYIAYELAIKYGWD 185

Query: 218 FSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECI 277
            S  + K      G +G   GW   F N          D  KL  +++           I
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFYN----------DVLKLPANVK-----------I 224

Query: 278 GSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIG 337
           G +          TE+ V  +  ID Y+ W    ++ P +                    
Sbjct: 225 GPIHALN------TESPVRVASCIDCYSNWFSMCSSSPNN-------------------- 258

Query: 338 RLAAVAGTSTCHILL-SKDPIFVHGIWGPYRDVL----ARGFWAAEGGQSCTGVLLDHVI 392
            L   AGTSTC++   +++   + G+WGP+ ++L    A+ +   E GQS TG L++H+ 
Sbjct: 259 SLFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLF 318

Query: 393 KIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPI 452
           + HPA    S   +      F  + S +E + +   E SV   ++H+F YG+  GNR+P 
Sbjct: 319 ETHPAARAYSMDKSKL----FSAIESAIEKLEQDFGE-SVHFRSKHMFTYGELQGNRTPY 373

Query: 453 ADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQC 512
            DS+M    IG++ D S +DL + Y++  EF++ Q + I E       +I  I ++G Q 
Sbjct: 374 CDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EIKDIRIAGSQA 430

Query: 513 RNDLLTRLL 521
           +N   TRLL
Sbjct: 431 KN---TRLL 436

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 23/26 (88%)

Query: 683 LLDTKYQIFLDMAETQKRYRHMVDNL 708
           LL+ KY+I+LDMA+TQ RYR MVD++
Sbjct: 508 LLEAKYKIYLDMAQTQMRYRAMVDSV 533

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  154 bits (389), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 135/505 (26%), Positives = 223/505 (44%), Gaps = 71/505 (14%)

Query: 41  VGVDVGTGSARACIID-QSGNMLSLAEKPIKREEL-RPNFITQSSREIWDAVCHCVKAVI 98
           VGVD+G+ S R  I   ++ ++L + E+P++          TQS+ EI  A+  C+  + 
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL- 71

Query: 99  QESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFT----KNDQNIILWMDHRAMKE 154
              R     +   G  ATCS+ V +     G     D +     +D+N++ WMD  A + 
Sbjct: 72  -GLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVASEA 130

Query: 155 TEEINSSEDKCLKY-VGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGK 213
            + ++      +K  + G    EM +PK+  L         +  + FDL  Y+ +    +
Sbjct: 131 CDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPG---RSLEVFDLHKYIAYDLARR 187

Query: 214 ENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSA 273
                ++   +      G +G   GW +EF   +                L+     L A
Sbjct: 188 YGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV----------------LK-----LPA 226

Query: 274 GECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYN 333
              +G       + +G+  +C      ID YA W G  + +PE                 
Sbjct: 227 TVAVGPASTFKGQRVGVA-SC------IDCYASWFGVCSTQPEQ---------------- 263

Query: 334 GAIGRLAAVAGTSTCHILLSK-DPIFVHGIWGPYRDVL--ARGFWAA-EGGQSCTGVLLD 389
                L  VAGTSTC++  S      + G+WGP+ ++L      W+  E GQS TG LL+
Sbjct: 264 ----SLFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGRLLE 319

Query: 390 HVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNR 449
           H+ + HPA  + +  T       F+ L   +  M +  +  S+  LARH+F YG+  GNR
Sbjct: 320 HLFETHPAARDYAGDTG----RLFKDLEDRIADM-EADSGCSIHHLARHMFLYGELQGNR 374

Query: 450 SPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVE-VMLKSGHKIDAIFMS 508
           +P AD  M    +G++ D S  +LA+ Y+   EF++ QTRQIVE     +   I  + ++
Sbjct: 375 TPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGELRVA 434

Query: 509 GGQCRNDLLTRLLADCSG-LPIVIP 532
           G Q RN  L  L++  +G +P+ +P
Sbjct: 435 GSQARNRRLLSLMSLVNGNMPVRVP 459

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 681 RILLDTKYQIFLDMAETQKRYRHMVD 706
           R LL+ KY I LDMA+ Q+RYR  +D
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEID 542

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  150 bits (379), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 139/505 (27%), Positives = 218/505 (43%), Gaps = 94/505 (18%)

Query: 41  VGVDVGTGSARACIID-QSGNMLSLAEKPIKR--EELRPNF--ITQSSREIWDAVCHCVK 95
           +G+D+G+ S R  I      ++L +  KP+    E  R +    TQ S EI  A+  C  
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWEYTQDSAEILTAIKECFD 67

Query: 96  AVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKET 155
                + +    V   G  ATCSLV+    +  G         + +N++ WMD  A +ET
Sbjct: 68  M----ADLQKYDVKSCGVAATCSLVLC---ERSGDDTFQHCEGDSRNVVFWMDSMAKEET 120

Query: 156 EEINS-SEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKF--FDLPDYLTFKATG 212
             +N+      L ++GG    EM IPK+     ++  E   + ++  FDL  Y+ +K   
Sbjct: 121 NSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYKLAQ 180

Query: 213 K---ENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLN---------TIGLSELIESDFEKL 260
           +        S+     G    G +G   GWS+ F +         TIG  + IE++    
Sbjct: 181 EYCWNTERLSNHPNSNGI---GHDGELAGWSKSFYDKIVRLPPNVTIGCPKTIENE---- 233

Query: 261 GGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIR 320
                                          ++ V+    ID Y+ W         SP++
Sbjct: 234 -------------------------------DSLVIVDSCIDCYSSWF--------SPLQ 254

Query: 321 GLAENEDNTYNYNGAIGRLAAVAGTSTCHIL---LSKDPIFVHGIWGPYRDVLARGFWAA 377
            L +N             L  VAGTSTC+I      K    V GIWGP+ D+L       
Sbjct: 255 SLNKN------------TLFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVY 302

Query: 378 EGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLAR 437
           E G SC+G L++H+   HP+   L+ L+    +SK E   ++ ET    +N  S+   A 
Sbjct: 303 ESGSSCSGKLIEHLFTSHPSAISLN-LSTGQLISKLEEEINIWET----QNATSIHFEAC 357

Query: 438 HLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLK 497
           + F YGD  GNR+P  D  MR   IG+S D S  DL + Y+   E ++ QT+ +V+   K
Sbjct: 358 NNFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEK 417

Query: 498 SGHKIDAIFMSGGQCRNDLLTRLLA 522
             + I+ +F+ G Q +N  L +L++
Sbjct: 418 L-NSINELFICGSQAKNTRLLKLIS 441

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 125/500 (25%), Positives = 213/500 (42%), Gaps = 89/500 (17%)

Query: 41  VGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPN--FITQSSREIWDAVCHCVKAV- 97
           +GVD+G+   R  I D   + L + E   K    R     ITQ + +I  AV      + 
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSL-VKETKEKVPYFRHGNGIITQCTSDILTAVEKAFNTLY 64

Query: 98  IQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQ--NIILWMDHRAMKET 155
           IQE  +       +G  ATCS+VV    D   +       KN +  +II WM   A++ET
Sbjct: 65  IQEYNI-----CSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 156 EEINS-SEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQD--CKFFDLPDYLTFKATG 212
           E +N+ +++  L + GG+   EM IPK+  L     ++L++D      DL  +L +K + 
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHL-----NKLYKDDGLTVLDLHIWLLWKISL 174

Query: 213 KENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLS 272
           K        V +      G +G   GWS+EF   + L+++       +G +   KKN   
Sbjct: 175 KLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIF------IGNNAVIKKNEQF 228

Query: 273 AGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNY 332
              CI                        D YA W    +                    
Sbjct: 229 GDSCI------------------------DCYASWFQCWST------------------- 245

Query: 333 NGAIGR-LAAVAGTSTCHILLSKDPI--FVHGIWGPYRDVLAR--------GFWAAEGGQ 381
              + R L  VAGTSTC  L + D    F+ GIWGP++D+L           +   E G 
Sbjct: 246 -AMLNRTLFVVAGTSTC-FLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGI 303

Query: 382 SCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFF 441
           S TGVLL+ ++  HPA  +       + V+  E +   ++ ++++ + +S+  + ++ FF
Sbjct: 304 SRTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFF 355

Query: 442 YGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHK 501
           + DY    S     +    I+ +  + +++DLA+ Y+   E ++ Q   ++    +    
Sbjct: 356 HEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHIT 415

Query: 502 IDAIFMSGGQCRNDLLTRLL 521
           I  + ++G Q +N  L ++L
Sbjct: 416 ISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 117/521 (22%), Positives = 204/521 (39%), Gaps = 102/521 (19%)

Query: 41  VGVDVGTGSARACIID-QSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHC------ 93
           +G+DVG+ S R  I + + G  +    K I +E L  +   +   ++W    +       
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTI----KTIVKEMLYKH---EPDSKLWHYTQNAFVMRDS 57

Query: 94  VKAVIQESRVDPDRVHGMGFDATCSLVVVS----ATDAKGVAVGPDFTKNDQNIILWMDH 149
           +   ++E  V+   V   G  ATCS+V +     A   + + +  + T N  +II W DH
Sbjct: 58  IFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDH 117

Query: 150 RAMKETEEINS-----------SEDKCLKYVGGQMSV--EMEIPKIKWLKNNLRSELFQD 196
            A  E + +N+            E+K L  +G +     EM IPK+  L N ++   ++ 
Sbjct: 118 TAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYET 177

Query: 197 ---CKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELI 253
               + +DL  Y+      K + +      K      G++G   GW   F     +  L 
Sbjct: 178 PHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFY----VWALP 233

Query: 254 ESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAA 313
           E+ F                  CIG    K   E  +    V     ID YA W  T A 
Sbjct: 234 ETSFPI----------------CIGPS--KVINETSI----VRPKSCIDCYASWFSTDAC 271

Query: 314 KPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHIL-LSKDPIFVHG--------IWG 364
                       +D+T         L   AGTSTC +  + +  +   G         WG
Sbjct: 272 -----------TKDDT---------LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWG 311

Query: 365 PYRDVLARGFWAA-EGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSK-FEYLNSMLET 422
           P+ +VL +   ++ E G S TG+LL+ +   H       Q+T +  V++   Y+ +  + 
Sbjct: 312 PFTNVLDKDKKSSFEIGFSETGILLEKLFNKH-------QITASWSVAESINYVEN--QI 362

Query: 423 MVKKRNERSVISLARHLFFYGDYHGNRSPIA-DSNMRACIIGQS-MDNSVEDLAITYLSA 480
            + +R +   I L   ++ +  Y     P   D+     + G   + +S   L   Y++ 
Sbjct: 363 AIYERKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAI 422

Query: 481 CEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLL 521
            E+++ Q   ++    K    I+ + +SG Q +N  L  L+
Sbjct: 423 LEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>TBLA0G02370 Chr7 (615596..617176) [1581 bp, 526 aa] {ON} Anc_2.206
           YIL142W
          Length = 526

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 27  LSTIPLKDPEVKFYVGV------DVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFIT 80
           L +IPL +P  K  V +      ++G G+    ++  SG +L  AEK I++ ++ P  + 
Sbjct: 64  LKSIPLDNPAAKVLVNLSKVQDDEIGDGTTSVTVL--SGELLREAEKLIEQSKIHPQTVI 121

Query: 81  QSSREIWDAVCHCVKAVIQESRVDP 105
           +  R    A    ++ V  ++  DP
Sbjct: 122 EGYRIASRAALKALEEVAVDNSKDP 146

>Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON}
           (61782..62417) [636 nt, 212 aa]
          Length = 211

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 449 RSPIADSNMRACIIGQSMDNSVED---LAITYLSACEFISQQTRQIVEVMLKSGHKIDAI 505
           ++ +AD  +  C++G  +D   ED    ++    A ++  +Q     EV  K+G K++ +
Sbjct: 104 KNKVADDKLVICLVGNKLDLCQEDSGKRSVEISDAKQYADEQGLLFFEVSAKTGEKVNDV 163

Query: 506 FMSGGQ 511
           F S G+
Sbjct: 164 FKSIGE 169

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
           YIL159W
          Length = 1642

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 574 FFINSYPSPQNSAMRHQNLASDVTCSYNLPNSISSAPDTMNR-HSSTISKQSRGDMSSEE 632
           + INS  S  N  M  ++   D++    + +SI+   D M+R HS  I+K++  +M+  E
Sbjct: 534 YLINSLFSNSNIHMLDRDDDFDISPELVVQSSIN---DLMDRLHSDEIAKRAMDEMTGLE 590

Query: 633 SSKGTLNTVALRSLEEKRYRGTGILWKVMQE 663
            +   L +  L SL+E+R+  TG L K +QE
Sbjct: 591 HNLIKLKS-ELESLKEERHADTGELIKELQE 620

>TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON}
           Anc_1.289 YKR014C
          Length = 220

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 449 RSPIADSNMRACIIGQSMDNSVEDLA---ITYLSACEFISQQTRQIVEVMLKSGHKIDAI 505
           +S + D N+  C++G  +D   ED +   +    A ++  +Q     EV  KSG  +  +
Sbjct: 103 KSKVGDENLVICLVGNKIDLCDEDESKRVVLTKDAKDYADEQNLMFYEVSAKSGENVKEV 162

Query: 506 FMSGGQ 511
           F   G+
Sbjct: 163 FQVIGE 168

>AFL002C Chr6 complement(432329..435720,435784..435847) [3456 bp,
           1151 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YAL001C (TFC3); 1-intron
          Length = 1151

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 380 GQSCTGVLL---DHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRN-ERSVISL 435
           G   TGV +    HV+K+   Y    +      V+  +YL +++ET+ K +N  R V+ L
Sbjct: 147 GNLVTGVQIIYKGHVVKLIKFYKFADEKPRRLYVNMRQYLPNIVETVKKSKNGVRQVVDL 206

Query: 436 ARHLFFYGDYHGNRSPIA 453
            R L F  D   N++ IA
Sbjct: 207 KRELKFDKDKRLNKAFIA 224

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,315,626
Number of extensions: 2956467
Number of successful extensions: 8985
Number of sequences better than 10.0: 50
Number of HSP's gapped: 9214
Number of HSP's successfully gapped: 77
Length of query: 714
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 597
Effective length of database: 40,065,477
Effective search space: 23919089769
Effective search space used: 23919089769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)