Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3698.255ON69869836850.0
YDR108W (TRS85)8.255ON69869732850.0
Suva_2.2688.255ON69569832620.0
Smik_4.3548.255ON69869732140.0
NCAS0B038808.255ON70670823510.0
NDAI0J014108.255ON71669622810.0
ZYRO0C01826g8.255ON69969522630.0
CAGL0B01705g8.255ON67267322210.0
TDEL0F038208.255ON68768321880.0
Kpol_392.118.255ON67567721770.0
KAFR0B055708.255ON66968320690.0
TPHA0B032608.255ON71471619940.0
KLTH0G13860g8.255ON70871818770.0
Kwal_56.235838.255ON70072218610.0
SAKL0H17226g8.255ON71974417900.0
TBLA0E043808.255ON88981717430.0
KNAG0H032708.255ON64871116330.0
Ecym_43168.255ON62368512871e-169
AGR096C8.255ON62367212821e-168
KLLA0F18953g8.255ON64769011811e-153
NCAS0D008302.330ON69079830.25
NDAI0E010108.709ON57399780.95
Kwal_26.95945.16ON56685724.9
ACL054W8.141ON972128725.6
NDAI0D03540na 1ON110729717.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.369
         (698 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...  1424   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...  1269   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...  1261   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...  1242   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   910   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   883   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   876   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   860   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   847   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   843   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   801   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   772   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   727   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   721   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   694   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   676   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   633   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   500   e-169
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   498   e-168
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   459   e-153
NCAS0D00830 Chr4 complement(148296..150368) [2073 bp, 690 aa] {O...    37   0.25 
NDAI0E01010 Chr5 complement(203904..205625) [1722 bp, 573 aa] {O...    35   0.95 
Kwal_26.9594 s26 complement(1281082..1282782) [1701 bp, 566 aa] ...    32   4.9  
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    32   5.6  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    32   7.8  

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1424 bits (3685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/698 (98%), Positives = 687/698 (98%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
           NTENFPIFMNTNEMLPVFLICYNDESQEEFEKC           FVESIFLPLWKESFID
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
           DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540
           PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY
Sbjct: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540

Query: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600
           AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE
Sbjct: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600

Query: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660
           HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH
Sbjct: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660

Query: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFIE 698
           CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFIE
Sbjct: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFIE 698

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score = 1269 bits (3285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/697 (87%), Positives = 642/697 (92%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           MVFSYEHYMNLLFHLDNS+E VPPEIAKRI+SNAIAPVITVTSTPLFDKHIQETY VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE KVG +EHEV D S S +S+ KN+NL VPN  KKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SLFQRDSTQSQYIRFTRPLGDLIETRD NDMLFNYHSLEV+LDNYLKLV  NT+E  PH+
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
           NTENFPIFMNTNEMLPVFL+CYND+SQEEFEKC           FVESI L LWK+SFI 
Sbjct: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIY 300

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
           DENS I+LHQPVMSSLEEILFFLQAPTQTTLSL LINSIYD+LDYLVYDLMIPFMKRKVS
Sbjct: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNP NG+HQHNSLTRD QGNEYF+SSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540
           PLIERALATYE CS+IQR KGKE +S  VTEPVRSYETRCMILASELFLSLS+TWTSTPY
Sbjct: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540

Query: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600
           AIQYLETILDECKLGPCSQIM+WERLSDCYNLRVDPRIKHRVG MKK  K+TEDLR   +
Sbjct: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600

Query: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660
           + TDHF +EDILSEGLTRRRKAAFFRLIAAKKWAEQK WRQVSWCLKDIESTYSEIKFLH
Sbjct: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660

Query: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFI 697
            N  ILSKLK+QLNLKD+DSAP P+EKN T TS++FI
Sbjct: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFI 697

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score = 1261 bits (3262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/698 (86%), Positives = 642/698 (91%), Gaps = 3/698 (0%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           MVFSYEHYMNLLFHLD+S E VPPEIAKRIVSNAIAPVITVTSTPLFDKHIQE Y+VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANEGK    E +  + S S+ES SKNQNLGVP+ALK+GSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKF---EQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSN 117

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SLFQRDSTQSQY+RFTRPLGDLIETRDTNDMLFNYHSLEV+LDNYLKLV  NT+E  PHD
Sbjct: 118 SLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS GEVYEDARDLLVNFKNLNH
Sbjct: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
           NTE+FPIFMNTNEMLPVFL+CYNDESQEEFEKC           FVESI LPLWK+SF+D
Sbjct: 238 NTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVD 297

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
            ENS+I+LHQPVMSSLEEILFFL+APTQT LSLPLINSIYD+LDYLVYDLMIPFMKRK+S
Sbjct: 298 VENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKIS 357

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNK P NG+HQHNSLT+D QGNEYF+SSSSEFLMRKL
Sbjct: 358 FWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKL 417

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 418 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 477

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540
           PLIERALATYE CS++QR   KEL+SS V EPVRSYETRCMILASELFLSLSDTWTSTPY
Sbjct: 478 PLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY 537

Query: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600
           AIQYLETILDECKLGPCSQIM+WERLSDCYNLRVDPR+KH+VG MKKS K TEDLRN DE
Sbjct: 538 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDE 597

Query: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660
           + TDHF EEDILSEGLTRRRKAAFFRL+AAKKWAEQK WRQVSWCLKDIE+TYS+I FLH
Sbjct: 598 YDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657

Query: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFIE 698
            N  ILS LK+QLN KD+DSAP PTEKNPT TSIN+IE
Sbjct: 658 GNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYIE 695

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1242 bits (3214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/697 (85%), Positives = 640/697 (91%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           MVFSYEHYMNLLFHLDNS+E VPPEIAKRIVSNAIAPVITVTSTPLFDKHIQE Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE KVG +EH+V DT+ SMES SK++NL VPN  KKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SLFQRDSTQSQYIRFTRPL DLIETRDTNDMLFNYHSLEV+LDNYLKLV +NT+E  PHD
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
           NTENFP+FMNTNEMLPVFL+CYNDESQEEFEKC           FVES+ L LWK+SFI+
Sbjct: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIE 300

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
             NS+I+LHQPVMSSLEEILFFLQAPTQT+LSLPLINSIYD+LDYLVYDLMIPFMKRKVS
Sbjct: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNP+NG+H HNSLT D QGNEYF+SSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQ IVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540
           PLIE+ALATYE CS+IQR K ++ SSS+  EPVRSYETRCMILASELFLSLSD WTSTPY
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540

Query: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600
           AIQYLETILDECKLGPC QIMIWERLSDCY+LRVDPRIKHRVG MKK  ++TEDLR GD 
Sbjct: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600

Query: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660
           + TDHF ++DILSEGLTR+RKAAFFRLIAA+KWAEQK WRQVSWCLKDIES YS+IKFL+
Sbjct: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660

Query: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFI 697
            +  ILSKL +QLNLKDL+SAP PTEKNPT TS++FI
Sbjct: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFI 697

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/708 (63%), Positives = 538/708 (75%), Gaps = 34/708 (4%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           M FSYEHYMNLLFHLD  +E VP EIAKRIVSNAI+PVI VTST   D HI ETYN+DSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           YMLLRFF GCVSDRDQANE +    +   S+ ++++ + S      +P    +G RSRSN
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSP-----LPKVRTRG-RSRSN 114

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SLFQRDSTQSQYIRFT+PLGD+I T++ NDMLF+YHSLE+YL NYL L+ +NT++  P++
Sbjct: 115 SLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYE 174

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN 
Sbjct: 175 LLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNS 234

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
           +T NFPIFMNTN+MLPV L+CY+D+  E+FE C           FVE I LPLWK+S+  
Sbjct: 235 STHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPS 294

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
           D    + LHQPVMSSLEE+++FL  P + TL   LI SIY+ILD LVY+LMIPFMKRK++
Sbjct: 295 DPQ--VHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           FW+ETILQPRKSLF+GAKF KKFM K     +HQ N LT+D QGNEYF+S+SSEFLMRKL
Sbjct: 353 FWDETILQPRKSLFHGAKFLKKFMTKTAL--THQENLLTKDAQGNEYFTSASSEFLMRKL 410

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ+IVTVKM+KNDIN
Sbjct: 411 ADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDIN 470

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540
           PLIE+AL+TYE C+ +     K  +   +  PVRSYETRCMILASELFLSLSDTWTSTPY
Sbjct: 471 PLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530

Query: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVG----------------- 583
           AI YLETIL ECKLG CSQIMIWERLSDCY LRVDPRIKH+                   
Sbjct: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590

Query: 584 ---VMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWR 640
              VM  S    ED+ N   + TD    +DI+S+G TR+RKAAFFRL+AAKKWAEQK WR
Sbjct: 591 QGHVMTPSPLTKEDVSNDANNDTD----QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWR 646

Query: 641 QVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLNLKDLDSAPGPTEKN 688
           QVSWCL+ I+ TYS+I     +D IL K++++L   + ++     EKN
Sbjct: 647 QVSWCLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKN 694

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/696 (64%), Positives = 532/696 (76%), Gaps = 28/696 (4%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           MVFSYEHYMNLLFHLD+++E VPPEIAKRIVSNAIAPVITVTSTP  D HIQETYN+DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVS---DTSVSMESLSKNQNLGVPNALKKGSRS 117
           YMLLR+FGGCVSDRDQANE  VG  E +V+   + S  + SL        P    +  RS
Sbjct: 61  YMLLRYFGGCVSDRDQANE-LVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRS 119

Query: 118 RSNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETA 177
           RSNSLFQRDSTQSQYIRFT+P+ D++  + +NDMLF+YHSLE+YL+ YL+L+  NTN + 
Sbjct: 120 RSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNST 179

Query: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
           P++LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV FKN
Sbjct: 180 PYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKN 239

Query: 238 LNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKES 297
           LN  T NFPIFMNTN+MLP+FL+CY+   QE+FE C           FVES+ LPLW E 
Sbjct: 240 LNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQ 299

Query: 298 FIDDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKR 357
           +  + +  + LHQP+MSSLEE+++FLQ P    LS+ LINSIY+ILD L+YDLM+PFMKR
Sbjct: 300 Y--EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKR 357

Query: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLM 417
           K+ FWEETILQPR+SLF+GAKF KKFM KN  N   Q N LT+D +GNEYF+ SS+E LM
Sbjct: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSSTELLM 415

Query: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKN 477
           RKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQSIVTVKMIKN
Sbjct: 416 RKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKN 475

Query: 478 DINPLIERALATYEKCS--QIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTW 535
           DINPLIERAL TYE C+   IQ    K  +  SV EP+RSYETRCMIL SELFLSLSDTW
Sbjct: 476 DINPLIERALQTYENCAITLIQDTTNKVFAEQSV-EPLRSYETRCMILLSELFLSLSDTW 534

Query: 536 TSTPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVG------------ 583
           TSTPYAI YLETIL ECKLGPCSQI IWERLSDCY LR+DPRI++++             
Sbjct: 535 TSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTT 594

Query: 584 -----VMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKH 638
                V   S  + + ++   +  +     ++ILS+G TRRRK+AFFRLIAAKKWAEQK 
Sbjct: 595 TADKVVATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQ 654

Query: 639 WRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674
           WRQV+WCLKD+ES Y        +D I++KL++ L+
Sbjct: 655 WRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/695 (62%), Positives = 530/695 (76%), Gaps = 36/695 (5%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           M  SYE+YMNLLFHLD+ +E VPP+IA+RIVSNA++PVITV+STP  D+HI++TY++DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHE---VSDTSVSMESL---SKNQNLGVPNALKKG 114
           YM LRFFG CVSDRDQANE +   ++ E   V++     ++L   S+  +L VP+     
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 115 S-------------RSRSNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVY 161
                         R RSNSLFQRD TQSQY+RFTRP+ DLIE+ D+NDMLF+YHSLEV+
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 162 LDNYLKLVTENTNETAPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISN 221
           L+N L+LV E T++  P +LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS 
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 222 GEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXX 281
           G+ YE+ARDLL+ FKNLNH  ENFPIFM+T ++LPVFL+CYNDES++E   C        
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 282 XXXFVESIFLPLWKESFIDDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYD 341
              FVES+ LPLWK S+ D  +  ++LHQP+MSSLEE+L+FLQ+PT T L L LIN  Y+
Sbjct: 301 KQLFVESLLLPLWKRSYSD--HGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358

Query: 342 ILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPANGS--HQHNSLT 399
           IL+ LV DLM+PFMKRK+SFWEETILQPRKSLF+GA FFKK M+KN +NGS  HQ  SL 
Sbjct: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKN-SNGSNNHQPISLG 417

Query: 400 RDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCA 459
           +D+ GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWCA
Sbjct: 418 KDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCA 477

Query: 460 VSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETR 519
           VS+LMGAQ+IVTVKMIKNDI+PLI+RAL TYE C+  +   G+EL       PVRSYETR
Sbjct: 478 VSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYV-----PVRSYETR 532

Query: 520 CMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIK 579
           CM LASELFLSLSDTWTSTPYA+  LETIL EC+LGPCS+IMIWERLSDCY  R+DPRI+
Sbjct: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592

Query: 580 HRVGVMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHW 639
           H+                 DE   D    E+I++ GLTR+RKAAFFRLIAA KW EQK W
Sbjct: 593 HKTSAQGAKAM-------TDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQW 645

Query: 640 RQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674
           +Q  WCLK+IE  Y+ + F++  D IL++LK Q+N
Sbjct: 646 KQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/673 (62%), Positives = 516/673 (76%), Gaps = 8/673 (1%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           MVFSYEHYMNL++HLD++ E VP +IAKR+VSNA+APVITVTST L D+HI+ETY +DSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE K+G +  +V++  V  E    N  L VP   +   RS SN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTN-GLTVPRQTR--VRSNSN 117

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SL+QRD+TQSQY+RFT+PL DLI T+D NDMLF+YHSLEVYL  YL +V +  +   PH 
Sbjct: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLK SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+
Sbjct: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
           N  +FP F+NTN++LPVFL+CYN +++ EFE+C           FVESI LPLW   F D
Sbjct: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTD 297

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
             N  + LHQPVMSS+EEI+FFLQ P    L L L+N IYD +D +VYDLM PFMKRK++
Sbjct: 298 --NLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMT 355

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           FWEETIL PRKSLF+GAKFFKKFMNK+      Q NSL ++  G+ Y SS+S EFLMRKL
Sbjct: 356 FWEETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKL 414

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ+IVT KM+KN+IN
Sbjct: 415 ADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEIN 474

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540
           P IERAL  YE C+       K   S  ++ PVRSYETRCM LASELFLSLSDTWTSTP+
Sbjct: 475 PAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF 534

Query: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600
           AI YLETIL+ECKLGP S+IMIWERLSDCY +R+DPRIKHR+G ++   K+ E++   D 
Sbjct: 535 AIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDP 592

Query: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660
              D F  EDILS+GLTR RKAA F+LIAA+KW EQK WR++SWCL D+ESTYS++K  +
Sbjct: 593 KNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFN 652

Query: 661 CNDSILSKLKSQL 673
             + + ++L+++L
Sbjct: 653 KENLLYTRLRNEL 665

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/683 (60%), Positives = 521/683 (76%), Gaps = 23/683 (3%)

Query: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62
            SYE+YMNLL HLD+ ++ VP +IAKRIVSNAI+PVI VTSTP  D+HIQET+++DSLYM
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 63  LLRFFGGCVSDRDQANE--GKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           LLRFFG CV DRDQA+E      P+  + ++ S S         L V +     SR RSN
Sbjct: 64  LLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSS-------STLAVASG---PSRKRSN 113

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SLFQRD+TQSQYIRFTRPL DL+E+ DTNDMLF+YH+LE +L+N L L+ ++TN+  PH 
Sbjct: 114 SLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHK 173

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKS+YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH
Sbjct: 174 LLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNH 233

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
            T+NFP+F+NTN++LPVFL+CYN +S+E++E C           FVE I LPLWK+++  
Sbjct: 234 TTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNY-- 291

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
              + + LHQP+M+SL+E+L+FL+ P++  LSL LINSIYD+L+ L+  LMIPFM+RK+S
Sbjct: 292 KTATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKIS 351

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGS-HQHNSLTRDRQGNEYFSSSSSEFLMRK 419
           FWEETILQPR+SLF+G+KF K+FM+K  +  + HQ  S+ +D  G EYF SSS+EFLMRK
Sbjct: 352 FWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRK 411

Query: 420 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDI 479
           LADWSMMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ+IVT KM+K DI
Sbjct: 412 LADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDI 471

Query: 480 NPLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTP 539
           +PLI+RA+ TYE C+           S+S+  PVRSYETRCM LASELFLSLSDTWTSTP
Sbjct: 472 DPLIQRAVETYENCALYDTQLSGSKKSNSMA-PVRSYETRCMFLASELFLSLSDTWTSTP 530

Query: 540 YAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRV--GVMKKSFKETEDLRN 597
           YA++ LETIL EC+LGPCSQIMIWERLS+CY  R+D RI+H+V  G M       E + N
Sbjct: 531 YALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNE----EKVEN 586

Query: 598 GDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIK 657
            D+   +H    DI++ GLTR RKAAFF+LIAA KWAEQK WRQ SWCLKD E  Y+ I+
Sbjct: 587 EDDSEKEH-THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIE 645

Query: 658 FLHCNDSILSKLKSQLNLKDLDS 680
           F++  D  L+KLK  L   ++DS
Sbjct: 646 FVNRKDLALAKLKETLKNVEIDS 668

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/677 (60%), Positives = 525/677 (77%), Gaps = 21/677 (3%)

Query: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST   D+H+Q++YN+DSLY+
Sbjct: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65

Query: 63  LLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQN---LGVPNALKKGSRSRS 119
           L+R+FGGC+SDRDQANE     N    +   V+ + + + +N   L +P + ++ SRSRS
Sbjct: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKS-ERYSRSRS 124

Query: 120 NSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPH 179
           NSLFQRDSTQS YIRFT+P+ DLI +RD++DMLF+YHSLEVYL+  L L+ +NTN+   H
Sbjct: 125 NSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDH 184

Query: 180 DLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLN 239
             LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN N
Sbjct: 185 KALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQN 244

Query: 240 HNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFI 299
           +  E FP FM+TN++L VFL+CY+ +S+E+ E C           F ES+ LPLW +S  
Sbjct: 245 NAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH- 303

Query: 300 DDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKV 359
             E+  ++LHQP MSSL+E+L+F + P+   L L LIN+IYD+++ LV DLMIPFM+RK+
Sbjct: 304 -SEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKI 362

Query: 360 SFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRK 419
           SFWEETILQPRKSLF+G K F+KFMN++ +  ++Q+N++ +D +GNEYF+SSS EFL+RK
Sbjct: 363 SFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRK 422

Query: 420 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDI 479
           LADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ+IVT KMIKND+
Sbjct: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482

Query: 480 NPLIERALATYEKCSQIQRH--KGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTS 537
           NPLIER+L TYE+CS + ++  +  EL    ++EPVRSYETRCM+L SELFLSL+DTWTS
Sbjct: 483 NPLIERSLDTYEQCSILAQNSLENDEL----LSEPVRSYETRCMLLTSELFLSLNDTWTS 538

Query: 538 TPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRN 597
           TPYA+  LETIL ECKLG CSQIMIWERLSDCYN+R DPRI+HRV  + K     E+   
Sbjct: 539 TPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTK----IENNEG 594

Query: 598 GDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIK 657
           G +  TD     DI+S+GL R+RKAAFFRL+AAKKWAEQK WRQVSWCL+D+E  Y ++ 
Sbjct: 595 GQQLQTD-----DIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLS 649

Query: 658 FLHCNDSILSKLKSQLN 674
           F    + I  KLK +LN
Sbjct: 650 FSKRPELIYQKLKDELN 666

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/683 (59%), Positives = 515/683 (75%), Gaps = 23/683 (3%)

Query: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62
           FSYEHYMNLLFHL+ S+E +P EIA+RIVS+AIAPVITVTSTP  DKHIQ+TY++DSLYM
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSNSL 122
           LLRFFGGCVSDRDQA+E K                  + + +  +       +RSRSNSL
Sbjct: 64  LLRFFGGCVSDRDQASESKAN----------------APHSSSSLTTTKTTRARSRSNSL 107

Query: 123 FQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHDLL 182
           FQRDSTQSQYIRFTRPL DL+E  D NDMLF++HSLE YL  YL+LV + T ++  H LL
Sbjct: 108 FQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLL 167

Query: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242
           KKS+YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+N + YEDA+ LL+ FKNL++  
Sbjct: 168 KKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTI 227

Query: 243 ENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFIDDE 302
           + FPI++NT +MLPVFL+CYN +S EE ++C           FVESI LPLWK S+    
Sbjct: 228 DKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY--QT 285

Query: 303 NSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSFW 362
              IKLHQPVMSSL+E+++FLQ+  Q TL + L N+ YD+L+ LVY L+IPFM+RK++FW
Sbjct: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345

Query: 363 EETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLAD 422
           EET+LQP+KS+F+G+KF KK M++   +   Q N LT+D  GNEYF+SSS E L+RKLAD
Sbjct: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405

Query: 423 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 482
           WS+MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ+IVTVKM+KNDI+PL
Sbjct: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465

Query: 483 IERALATYEKCSQIQRHKGKELS---SSSVTEPVRSYETRCMILASELFLSLSDTWTSTP 539
           I+RAL  Y+ C+       K++     S+  EPV SYETRC+IL+SELFLSLSDTWTSTP
Sbjct: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTP 525

Query: 540 YAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKK--SFKETEDLRN 597
           YAI YLE+IL+E +LGPCS+IMIWERLSDCY+LRVDPRIK +V  ++K  + +E  D  +
Sbjct: 526 YAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEH 585

Query: 598 GDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIK 657
              +  D     +I+S+GLTR+RKAAFFRL+AAK WAEQ  W+QV WCL +I   YS + 
Sbjct: 586 RILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVG 645

Query: 658 FLHCNDSILSKLKSQLNLKDLDS 680
            ++ +D IL++L+ + N+   DS
Sbjct: 646 LVNRDDLILTRLREEYNIAVSDS 668

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/716 (55%), Positives = 488/716 (68%), Gaps = 51/716 (7%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHE-------------VSDTSVSM-------ESLS 100
           Y LLR+FGGC+SDRDQ+NE  +   E E             + +T V +       E L 
Sbjct: 61  YTLLRYFGGCISDRDQSNE-YIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQ 119

Query: 101 KNQNLGVP------------------NALKKGS-----RSRSNSLFQRDSTQSQYIRFTR 137
            +QN+  P                  N L K S     RSRSNSLFQRDSTQSQ+IRFTR
Sbjct: 120 SDQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTR 179

Query: 138 PLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHDLLKKSIYHSFFSLAISS 197
           P+ DL+ +  T DMLF+YH+LE++L + LK+V + T +   H  L+KS+YH FFS AISS
Sbjct: 180 PIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISS 239

Query: 198 TNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPV 257
           TN LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    NFPIFM+TN++LPV
Sbjct: 240 TNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPV 299

Query: 258 FLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFIDDENSSIKLHQPVMSSLE 317
           F++CYN  S EE EK            F E I +PLW + + DD   ++KLHQP MSSL+
Sbjct: 300 FVLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDD--ITVKLHQPAMSSLD 357

Query: 318 EILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGA 377
           E+L+  Q      L L LIN IYD L+ L  DLMIPFM+RK++FWEETILQP+KSLF G 
Sbjct: 358 EMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGT 417

Query: 378 KFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTY 437
           K F+KFM +       Q N   +D QGNEYF+S+S+ FL+RKLADWSMM+SDFKTAY+T+
Sbjct: 418 KLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTF 477

Query: 438 ESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQIQ 497
           ESL++D++ +PKYLASC+EWCAV +LMGAQ+IVT KMIKND+NPLIER+L  Y  C+ + 
Sbjct: 478 ESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLL 537

Query: 498 RHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPC 557
                E   S  TEPVRSYETRCM++ SELFLSLSDTWTSTPYA+  LETIL ECKLG C
Sbjct: 538 NSIA-ESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGAC 596

Query: 558 SQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLT 617
           SQIMIWERLSDCYNLR DPR+KH++    +S   T  +    E          I+ +GLT
Sbjct: 597 SQIMIWERLSDCYNLRTDPRVKHKL----RSNISTSSVSEVSEEEIKKQDVSSIVLKGLT 652

Query: 618 RRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQL 673
           R+RKA+FFRL+AAKKWAEQ  WRQVSWCL DI   Y +  F      I  KLK  L
Sbjct: 653 RQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/718 (51%), Positives = 487/718 (67%), Gaps = 70/718 (9%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           M  S+  YMNL FHLD++ E VP EI+++IVS+A++PV+TVTST   D+HIQE+Y VDSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           YMLLR+FG CVSDRDQA   + GP         +  ES  KN+N           R+RSN
Sbjct: 61  YMLLRYFGDCVSDRDQA---EAGPE--------LGTES-GKNRN-----------RARSN 97

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180
           SLFQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEV+L+ YL LV  NT    PH 
Sbjct: 98  SLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHT 155

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LL+ SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++
Sbjct: 156 LLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHN 215

Query: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFID 300
            T +FP F+N N++LPVFL+CY ++S+E+FE C           FVES+ LP W ++   
Sbjct: 216 TTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINA 275

Query: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360
             + S  LHQP+MSSLEE ++ +   +  TL L LIN IYD L  L+ +LMIPFMKRK+S
Sbjct: 276 GASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKIS 335

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           FW+E+ILQPRKS+F  +KFF+K ++K PA      +S T  +QG  YF+++S+EF++RKL
Sbjct: 336 FWDESILQPRKSIFPNSKFFRKLISKTPAPPP-ASDSATHSQQGVAYFAATSNEFILRKL 394

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQSIVTVKMIKNDI+
Sbjct: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRS------------------------- 515
           PLI RAL +YE  ++  + K  +L SS++ +                             
Sbjct: 455 PLINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVS 514

Query: 516 ---------YETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMIWERL 566
                    YETRCM+LA+ELFLSLSDTWT+TPYAI+YLETILDEC LG  S+I++WERL
Sbjct: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574

Query: 567 SDCYNLRVDPRIKHRV----GVMKKSFKETEDLRNGDE-----HYTDHFIEEDILSE-GL 616
           + CY LRVDPR+K ++    G   ++ K  E+    DE        DH I ++ ++  GL
Sbjct: 575 AYCYALRVDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLGL 634

Query: 617 TRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674
            RRRK+  FRLIA KKW E K WRQ  W LKDIE  YSE+ F + +D IL KL+ +++
Sbjct: 635 ARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIH 692

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/722 (52%), Positives = 483/722 (66%), Gaps = 78/722 (10%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           M  SYE YMNL+ HLD++ E VP EI+++IVSNA++PV+TVTS+   DKHIQE+Y +DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRFFGGCVSDRDQAN---EGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRS 117
           YMLLR+FG C+SDRDQA+   E  V PN                          K  +RS
Sbjct: 61  YMLLRYFGDCISDRDQADSEQESGVEPN--------------------------KSRARS 94

Query: 118 RSNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETA 177
           RS SLFQR +  SQ++RFTRPL D+I TR+T D+LF+YHSLEV+L  YL+LV   T+   
Sbjct: 95  RSGSLFQRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDT 152

Query: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
           PH LL+ SIYH FF+ AISST +LSPYE FNHP+ SL+ALDIS  E YEDARDLLV FKN
Sbjct: 153 PHTLLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKN 212

Query: 238 LNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKES 297
           +++ T +FP F+N N++LPVFL+CY + S+E+FE C           FVES+ LP W  +
Sbjct: 213 MHNKTPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVN 272

Query: 298 FIDDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKR 357
           F   +  +  LHQP+MSSLEE +F +   +   L LP I  IYD L  LV +LMIPFMKR
Sbjct: 273 FTAKDTPTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKR 332

Query: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLM 417
           K+SFWEE+ILQPR+S+F  +KFF+K ++K P   S  ++S T   QG  YF+++S+E L+
Sbjct: 333 KISFWEESILQPRRSIFPNSKFFRKLISKAP-TPSTNNDSATHSEQGLAYFAATSNELLL 391

Query: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKN 477
           RKLADWS MLSDFKTAYSTYE L  D +  P+YLA C+EWCA+S+LMGAQSIVTVKMIKN
Sbjct: 392 RKLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKN 451

Query: 478 DINPLIERALATYEKC------------SQIQ-RHKGKELS------------------- 505
           DI+PLI RAL +YE C            S++Q R   K L+                   
Sbjct: 452 DIDPLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDF 511

Query: 506 --SSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMIW 563
             SS+ ++  +SYETRCM+LA+ELFLSLSDTWT+TPYAI+YLETILD+C +G  S+I+IW
Sbjct: 512 EISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIW 571

Query: 564 ERLSDCYNLRVDPRIKHRVGVM--------KKSFKETE--DLRNGDE-HYTDHFIEED-I 611
           ERL+ CY LRVDPR+K R+           +K  +E+E  D  +GDE     H + +  I
Sbjct: 572 ERLAYCYALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSCI 631

Query: 612 LSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKS 671
            S GLTR+RKA  FRLIA KKW E K WRQ  W  +D+E  YS + F +  D IL KL+ 
Sbjct: 632 ASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEK 691

Query: 672 QL 673
           ++
Sbjct: 692 RI 693

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/744 (50%), Positives = 482/744 (64%), Gaps = 102/744 (13%)

Query: 1   MVFSYEHYMNLLFHLDNSEE--IVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVD 58
           M  SYE+YMNLL+H+D+S E   V  E+AK+IVSNA++PV+ VTST L D H+QE Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSR 118
           S+YMLLRFFG CV+DRDQ NE +                               KG R R
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETETN----------------------------FKG-RPR 91

Query: 119 SNSLFQRDSTQSQYIRFTRPLGDLIETRDTN-DMLFNYHSLEVYLDNYLKLVTENTNETA 177
           SNSLFQR+S  S ++RFTRPL DL++ R ++  MLF+YHSLE++LD YL+LV    +   
Sbjct: 92  SNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT 149

Query: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
           PH LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN
Sbjct: 150 PHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKN 209

Query: 238 LNHNTE---NFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLW 294
           +N  T+   +FP F+N N++LPVFL+CYND S E+FE C           FVESI LPLW
Sbjct: 210 MNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLW 269

Query: 295 KESF-IDDENSSIKLHQPVMSSLEEILFF--LQAPTQTTLS--------------LPLIN 337
           ++S   D E     LH P+MSSLEE+L+F  L+AP +  +S              L L+ 
Sbjct: 270 RDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVE 329

Query: 338 SIYDILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN-PANGSHQHN 396
           +IYD L+ L+ +LMIPFMKRK+SFWEETILQPRKS+F  AKF ++F++K+ PA  +   N
Sbjct: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPIN 389

Query: 397 SLTRDR-QGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCI 455
           S +    Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C+
Sbjct: 390 SKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCL 449

Query: 456 EWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKC-SQIQRHKGKELSSSSVTEPVR 514
           EWCAVS+LMGAQSIVTVKMIKNDI+PLI ++L  YEKC S++      E  S   ++P +
Sbjct: 450 EWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQ 509

Query: 515 SYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRV 574
           SYETRCM+L++ELFLSLSDTWT+TPYAI+YLETIL  C LGP SQ+++WE+L+ CY LRV
Sbjct: 510 SYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRV 569

Query: 575 DPRIKHRVGVMKKSFKETEDL------RNGDEHYTDHFIEE------------------- 609
           DPR+ H     +    E E++      R    H   HF  E                   
Sbjct: 570 DPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEA 629

Query: 610 --------------------DILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDI 649
                               DI   GLTRRRKAAFFRLIAA KW EQK W+Q SW L+D+
Sbjct: 630 LSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDV 689

Query: 650 ESTYSEIKFLHCNDSILSKLKSQL 673
           ++ YS + F +    IL +L  ++
Sbjct: 690 DTVYSGLVFSYRKGLILERLVGEI 713

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/817 (46%), Positives = 502/817 (61%), Gaps = 145/817 (17%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           M FSYE+YMNLLFHLD + E +P +IAKRIV N+IAP+I+VT+TP  DKH+Q++YN+DSL
Sbjct: 1   MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61  YMLLRFFGGCVSDR--------------DQANE---GKVGPNEH--EVSDTSV------S 95
           YMLLR+FGGC+SDR              D  NE     + P+    E  DTS+      S
Sbjct: 61  YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISPDTSITETPDTSMDMLIDNS 120

Query: 96  MESLSKNQN-------------LGVPNA-------------------------------L 111
           M +L+K +              L  P                                  
Sbjct: 121 MNTLTKEETIISTTTGTPTPTILASPTTENTITKPHNKTTTIKKNTKEHYTTTHNYTHHH 180

Query: 112 KKGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTE 171
           ++ +R RSNSLFQRDSTQSQYIRFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 172 NTNETAPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDL 231
           NT    PH+ LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 232 LVNFKNLNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFL 291
           L+ FKN++  T NFP+++N N++LPVFL+CY+  S E+ +             F ESI L
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 292 PLWKESFIDDENSSIKLHQPVMSSLEEILFFLQ-------APTQTTLSLPLINSIYDILD 344
           PLW +   +++   +KLH+P+MSS++E L+FLQ         T   L L L+  IY+++ 
Sbjct: 361 PLWNDKIYNND-KFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419

Query: 345 YLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN---------------PA 389
            L  +L+IPFM+RK+ FW+ETILQPRKS+F   K FK FMN+N                +
Sbjct: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNS 478

Query: 390 NGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 449
              H H+ LT+D  G+EYFS+ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 479 ISKHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538

Query: 450 YLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEK----------------- 492
           Y+ASC+EW AVS+LMGAQ+IVT KM+KND++PLIE AL +YEK                 
Sbjct: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINS 598

Query: 493 ---CSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETIL 549
               S I      E+S       +RSYE RCM+L SELFLSLSDTWTSTPYA++YLETIL
Sbjct: 599 LNSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETIL 658

Query: 550 DECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGV--MKKSFKET------EDLRNGDEH 601
            + KLGPCSQ ++WERLS CY+LRVDPRIK +  +  + K  K T        ++  +E 
Sbjct: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718

Query: 602 YTDHFIEE------------------------DILSEGLTRRRKAAFFRLIAAKKWAEQK 637
           Y +   +E                        DILS+G TR+RKAAFF+LIAAKKW+EQK
Sbjct: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQK 778

Query: 638 HWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674
            WRQ+ WCLKDIE+ Y E+ F    D IL KLK QLN
Sbjct: 779 QWRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLN 815

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/711 (47%), Positives = 443/711 (62%), Gaps = 104/711 (14%)

Query: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60
           M FSYEHYMNLL HL+ + E VPP+IA+RIVS+A+APVITVTS+   D HI E+Y V S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120
           Y+L R FGGC+SDRDQ  E       + + D+S    +                 R RSN
Sbjct: 61  YLLFRLFGGCISDRDQLME------HYTLDDSSTGGRT-----------------RKRSN 97

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENT------- 173
           SLFQRD+TQSQ+IRF +PL DL+ +      LF+  SLE YL +YL  + + T       
Sbjct: 98  SLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKV 157

Query: 174 ---------------NETAPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALD 218
                           +  PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D
Sbjct: 158 EQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAID 217

Query: 219 ISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXX 278
           +S G+ YE  RDL+  FKNLN   E+FP+F+N N++LP+ ++CY+   + +   C     
Sbjct: 218 VSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQR 277

Query: 279 XXXXXXFVESIFLPLWKESFIDDENSSIKLHQPVMSSLEEILFFLQ-------------A 325
                 FV+SI L LW E   D E+  + LH+P+MSSL+EI+ F                
Sbjct: 278 KIKKCLFVDSIPLALWDE---DPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334

Query: 326 PTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAK-FFKKFM 384
            ++  L L +I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+
Sbjct: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394

Query: 385 NKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDL 444
            K          +  RD    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL
Sbjct: 395 GKT---------TTQRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445

Query: 445 DAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQIQRHKGKEL 504
              P YLASC+EWCAVSLL+GAQ+IVTVKMIK +I PLIERA+ATY       R +G+  
Sbjct: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATY-------RQQGRS- 497

Query: 505 SSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDEC-KLGPCSQIMIW 563
                     SYETRCMIL++ELFL+L DTWTSTPYAI+YLETIL +C +LG CSQ+MIW
Sbjct: 498 ----------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIW 547

Query: 564 ERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAA 623
           ERLSDCY  R DPR+   +     +       + G+E          IL++G TR+RKAA
Sbjct: 548 ERLSDCYQSRTDPRVASALS----TNTSPGSAQPGNE----------ILAQGFTRKRKAA 593

Query: 624 FFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674
           FFRLIAAKKWAEQ  WRQV WCL DI+  Y+          ++ +L +++ 
Sbjct: 594 FFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQ 644

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  500 bits (1287), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 289/685 (42%), Positives = 405/685 (59%), Gaps = 93/685 (13%)

Query: 2   VFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLY 61
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST   ++H++E + + SLY
Sbjct: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60

Query: 62  MLLRFFGGCVSDRDQANE---GKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSR 118
            LLR+FG  + DRDQ ++    K+ PN                              R R
Sbjct: 61  KLLRYFGDYIQDRDQLDDKISAKLQPN----------------------------NRRQR 92

Query: 119 SNSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAP 178
            NSLFQR+S  S+YIRF  PL D+I   D + + FN   LE  L  +LK + E+T   +P
Sbjct: 93  QNSLFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSP 148

Query: 179 HDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNL 238
            +LLK SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL
Sbjct: 149 CELLKHSIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNL 206

Query: 239 NHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESF 298
            +    FP F+NTN++LPVF++C++  S +++E             FVES+ LP+    F
Sbjct: 207 PNTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPI----F 262

Query: 299 IDDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRK 358
            +  + SI LH P+ +SL+E L+    P    L   L+  IYD ++ +V DLMIPFM RK
Sbjct: 263 TNFRDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRK 322

Query: 359 VSFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMR 418
           +SFW+ETILQPRKS+F+  K  K+F++K+  + +    S+     G  +F +SS+EFL+R
Sbjct: 323 ISFWDETILQPRKSIFHSNKLLKRFISKSSGSPT---ASMPTSPDG--HFLASSNEFLLR 377

Query: 419 KLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKND 478
           KLADW  MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA SIVT KMIKND
Sbjct: 378 KLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKND 437

Query: 479 INPLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTST 538
           I+PLI + L                    +V   +   + RCMI  +ELFLSLSDTWTS 
Sbjct: 438 IDPLIMKYL------------------DYAVNNIISLDQIRCMIYMTELFLSLSDTWTSA 479

Query: 539 PYAIQYLETIL--DECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLR 596
           P+AI+YLE IL  +  KLGP  + +IWER+S  Y LR+DPRI              +D  
Sbjct: 480 PFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRI------------HADDDS 527

Query: 597 NGDEHYTDHFIEED------------ILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSW 644
             D    DH +EE+            I ++G TR RK A F+L+AAKKW +    RQ +W
Sbjct: 528 TSD---CDHDLEEELYLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAW 584

Query: 645 CLKDIESTYSEIKFLHCNDSILSKL 669
            LK     Y ++ F +   ++LS+L
Sbjct: 585 SLKRCNRVYRDLPFANAEGTLLSRL 609

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  498 bits (1282), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 284/672 (42%), Positives = 410/672 (61%), Gaps = 72/672 (10%)

Query: 2   VFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLY 61
           + SYE YMNL+ + ++  + VP EI++R++ NA++P ++V ST   + H+ E ++  SLY
Sbjct: 1   MLSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSNS 121
           MLLR+F   V +R +    +VG         SVS                  G R R  S
Sbjct: 61  MLLRYFADYVRERGE----EVG---------SVS------------------GQR-RPGS 88

Query: 122 LFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHDL 181
           ++QR +  S+Y+RF RPL ++IET +   +  ++  LE  L  +L+ +   T   +P +L
Sbjct: 89  VYQRQT--SRYVRFQRPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSEL 144

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SI+H F ++   S+  LSPY T NHPI++L+ALD++ GE Y  AR+LLV FKNL   
Sbjct: 145 LKHSIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSK 202

Query: 242 TENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFIDD 301
           +  FP ++NTN++LPVF++C+++ S E++E             FVES+ LP+    F + 
Sbjct: 203 SSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPI----FTNY 258

Query: 302 ENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSF 361
           E+  + LH P+ +SL+E ++    P    L   L++ IY+ ++ +V DLMIPFM RK+SF
Sbjct: 259 ESDPVVLHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISF 318

Query: 362 WEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLA 421
           W+ETILQPRKS+F+G KF K+FMNK  ++ +    +L+    G  YF +SS+EFL+RKLA
Sbjct: 319 WDETILQPRKSIFHGNKFLKRFMNKTNSSAA---GTLSTSSDG--YFLASSNEFLLRKLA 373

Query: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINP 481
           DWS MLSD+KTAYS Y  L+ D + +P+YL+SC E+ A+SLLMGA SIVT KMIKNDI+P
Sbjct: 374 DWSFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDP 433

Query: 482 LIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYA 541
           LI + +                   S+V       + RC++  +ELFLSLSDTWTS P+A
Sbjct: 434 LIMKYM------------------DSTVASLNYLGKFRCLVYMAELFLSLSDTWTSAPFA 475

Query: 542 IQYLETIL--DECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKE--TEDLRN 597
           I+YLE IL  ++ KLGP S+ M+WER+S  Y LR+DPRI      +  +F E  TED   
Sbjct: 476 IKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYLSDNFMELTTEDDFC 535

Query: 598 GDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIK 657
            + +   H+    I S GLTR RK A FRL+AAKKW E  H RQ +W LK     Y  + 
Sbjct: 536 MNPNKLHHW---RIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLG 592

Query: 658 FLHCNDSILSKL 669
           F + + ++LS+L
Sbjct: 593 FANADGTLLSRL 604

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  459 bits (1181), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 260/690 (37%), Positives = 396/690 (57%), Gaps = 65/690 (9%)

Query: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62
           FSYE YMNL+ + ++    +P EI+K+++ N ++P I V S    D H+++ YN+DS+ M
Sbjct: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64

Query: 63  LLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSNSL 122
           L R+FG  + DRDQ                      +    +L  P ++  G R RS+SL
Sbjct: 65  LFRYFGDYIQDRDQ----------------------IPSTTDLKDPGSVSSG-RHRSDSL 101

Query: 123 FQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETA-PHDL 181
           FQR +  S+ +RFTR L DLI   D+ D +     ++ +L  YL+ +    NE   P  L
Sbjct: 102 FQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKL 158

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+ 
Sbjct: 159 LKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216

Query: 242 TENFPIFMNTNEMLPVFLICYNDESQEEFEKCXXXXXXXXXXXFVESIFLPLWKESFIDD 301
            ENFP F+N N++LPVF++CY++ S+E++E             FVES+ + L+      D
Sbjct: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPH---D 273

Query: 302 ENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSF 361
              S  LH P+  SL E +F +  PT   +   L+  IYD + ++V ++MIPFM RK+ F
Sbjct: 274 NQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVF 333

Query: 362 WEETILQPRKSLFNGAKFFKKFMN-KNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420
           W+ET+LQPRKS+F   KFF++F++ K+    +H+ N      +G+  F +SS EFL+RKL
Sbjct: 334 WDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKL 393

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ+I+T K IK +++
Sbjct: 394 ADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVD 453

Query: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540
           PL+ RA+  Y+K  Q ++H  + +               C++  S+L LSLSDTW S+P 
Sbjct: 454 PLMTRAIEQYKK--QDEKHSLRVI--------------HCILTFSDLLLSLSDTWVSSPL 497

Query: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRV-------------GVMKK 587
           A+ YL  I     LGP + ++I ER++  Y + +D R+                    + 
Sbjct: 498 AVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAEN 557

Query: 588 SFKETEDLRNGDEHY---TDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSW 644
           S K    L   D H     +  I+ ++ SEGLTR RK + ++L+AAKKW E     Q  W
Sbjct: 558 SKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKW 617

Query: 645 CLKDIESTYSEIKFLHCNDSILSKLKSQLN 674
           C+      Y ++      D +  +L  +L+
Sbjct: 618 CIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647

>NCAS0D00830 Chr4 complement(148296..150368) [2073 bp, 690 aa] {ON}
           Anc_2.330
          Length = 690

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 574 VDPRIKHRVGVMKKSFKETEDLRNGDEHYTDHFI-EEDILSEGLT----RRRKAAFFRLI 628
           ++P+ +H V +  K++ + EDL  GD    D F   E++L +  T     R++       
Sbjct: 465 LNPKARHPVIIHDKTYTQ-EDLPKGDTELEDTFFNSENMLLQAFTDIKAGRKRYQKLEES 523

Query: 629 AAKKWAEQKHWRQVSWCLK 647
            A++W E   WR+V   LK
Sbjct: 524 IARRWHEGMSWRKVVVALK 542

>NDAI0E01010 Chr5 complement(203904..205625) [1722 bp, 573 aa] {ON}
           Anc_8.709 YOR260W
          Length = 573

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 21/99 (21%)

Query: 506 SSSVTEPVRSYE----TRCMILASELF--LSLSDTWTSTPYAIQYLETILDECKLGPCSQ 559
           SSSV     SYE     +C I  S LF  + L D            + IL+ C +GP  +
Sbjct: 435 SSSVKLSTMSYEGIIGAKCRIAGSILFHGVQLDD------------DVILENCIIGPNVK 482

Query: 560 IMIWERLSDCY---NLRVDPRIKHRVGVMKKSFKETEDL 595
           I    +LS+CY   N  V+P+   +   + K   E ED+
Sbjct: 483 IGKKAKLSNCYVEGNYIVEPKGNFKGETLSKVALEEEDI 521

>Kwal_26.9594 s26 complement(1281082..1282782) [1701 bp, 566 aa]
           {ON} YGR278W (CWC22) - Protein required for cell
           viability [contig 363] FULL
          Length = 566

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 45  PLFDKHIQETYNVDSLYMLLRFFGGCVSDRDQANEGK-VGPNEHEVSDTSVSMESLSKNQ 103
           PL D   QE  N +     ++       DRDQ N  K +  + HE + T+ +    S +Q
Sbjct: 473 PLTDGMRQELDNCEGGNSTIQ------GDRDQGNPSKNIVSSSHESAVTNNNQPYRSTSQ 526

Query: 104 NLGVPNALKKGSRSRSNSLFQRDST 128
             G P+A  +G R RS S   R ST
Sbjct: 527 MHGTPDAGFRGMRRRSRSPTIRQST 551

>ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL180W (APG1)
          Length = 972

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 57/128 (44%), Gaps = 20/128 (15%)

Query: 472 VKMIKNDINPLIERALATYEKCSQIQRHKGKELSSSS-VTEPVRSYETRCMILASELFLS 530
           V+ I+   N  +E+A     K   IQ H G +LS+S+ V+EPV   +     L  +  L 
Sbjct: 837 VQWIRERFNECLEKAEFLRMKTQSIQLHNGNQLSASTMVSEPVFVEK-----LIYDRALD 891

Query: 531 LSDTWTSTPYAIQYLETILDECKLGPCSQIMIWERL------SDCYNLRVDPRIKHRVGV 584
           +S T        +YLE     C++   + + + E L       D YN   D  + H  GV
Sbjct: 892 ISKTAAKMEMQGEYLEG----CEVAYSTSLWMLEALLDDVSDEDNYN---DDNLGH-TGV 943

Query: 585 MKKSFKET 592
           + KS KE 
Sbjct: 944 LDKSDKEV 951

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 5/29 (17%)

Query: 42  TSTPLFDKHIQETYNVDSLYMLLRFFGGC 70
           TS PL  KHI+ T     LY+LLRFF  C
Sbjct: 341 TSNPLISKHIKAT-----LYILLRFFDMC 364

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,273,807
Number of extensions: 3591736
Number of successful extensions: 12550
Number of sequences better than 10.0: 62
Number of HSP's gapped: 12968
Number of HSP's successfully gapped: 65
Length of query: 698
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 581
Effective length of database: 40,065,477
Effective search space: 23278042137
Effective search space used: 23278042137
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)