Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.3688.254ON67267233590.0
Suva_2.2678.254ON67267228870.0
Smik_4.3538.254ON69067228840.0
YDR107C (TMN2)8.254ON67267228840.0
NDAI0B023708.254ON72266024540.0
NCAS0B049708.254ON66666124310.0
Smik_12.1428.254ON66366024280.0
YLR083C (EMP70)8.254ON66766624110.0
Suva_10.1678.254ON68468424020.0
Skud_12.1518.254ON66466623870.0
KAFR0B026808.254ON66465723660.0
KNAG0G019908.254ON66766622640.0
ZYRO0C01848g8.254ON64765822560.0
CAGL0B01683g8.254ON69168622310.0
Kpol_543.358.254ON65867322260.0
KLLA0F18931g8.254ON66565821770.0
SAKL0H17248g8.254ON66065821750.0
NCAS0B038908.254ON66366621460.0
TBLA0E043708.254ON67667321240.0
TBLA0H014508.254ON67366720850.0
KLTH0G13882g8.254ON68768820690.0
TPHA0A018408.254ON68568920500.0
Kwal_56.235778.254ON68367220350.0
NDAI0J014208.254ON61962719690.0
TDEL0F038108.254ON65665819670.0
AGR097W8.254ON65366618700.0
Ecym_43178.254ON60566014320.0
YER113C (TMN3)7.411ON7067123765e-37
Smik_5.2587.411ON7067193766e-37
NDAI0A015107.411ON6796943613e-35
NCAS0A145207.411ON6706953589e-35
TDEL0C027107.411ON6786953543e-34
Skud_5.2667.411ON7077123393e-32
Suva_5.2347.411ON7067173374e-32
SAKL0F12914g7.411ON7077383375e-32
KLLA0E20835g7.411ON6766943312e-31
ZYRO0B03784g7.411ON6586823294e-31
CAGL0G03487g7.411ON7047183214e-30
KNAG0C034307.411ON6807123117e-29
KAFR0K019507.411ON6646772948e-27
KLTH0C06226g7.411ON6945902191e-17
Kwal_27.107467.411ON6903522082e-16
Ecym_71437.411ON6767181993e-15
TBLA0I003307.411ON7135371951e-14
TPHA0K007307.411ON7335061781e-12
Kpol_1045.287.411ON6815761387e-08
AGL295C7.411ON6572791342e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.368
         (672 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...  1298   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...  1116   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...  1115   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...  1115   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   949   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   941   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   939   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   933   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   929   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   924   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   915   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   876   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   873   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   863   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   862   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   843   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   842   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    831   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   822   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   807   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   801   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   794   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   788   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   763   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   762   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   724   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   556   0.0  
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   149   5e-37
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   149   6e-37
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   143   3e-35
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   142   9e-35
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   140   3e-34
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   135   3e-32
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   134   4e-32
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   134   5e-32
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   132   2e-31
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   131   4e-31
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   128   4e-30
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   124   7e-29
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...   117   8e-27
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    89   1e-17
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    85   2e-16
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    81   3e-15
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    80   1e-14
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    73   1e-12
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    58   7e-08
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    56   2e-07

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score = 1298 bits (3359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/672 (94%), Positives = 636/672 (94%)

Query: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60
           MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS
Sbjct: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60

Query: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120
           DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK
Sbjct: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120

Query: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180
           GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG
Sbjct: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180

Query: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240
           DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS
Sbjct: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240

Query: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300
           YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY
Sbjct: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300

Query: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360
           LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS
Sbjct: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360

Query: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420
           HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG
Sbjct: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420

Query: 421 FVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLF 480
           FVGSYTSMGVYKFFHGPYWKAN                VAMNIFLLFAHSSGVIPAKSLF
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLF 480

Query: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540
           FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF
Sbjct: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFGF                    YHSLCLENWLWQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQW 600

Query: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660
           RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI
Sbjct: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660

Query: 661 FIRKIYYAVKVE 672
           FIRKIYYAVKVE
Sbjct: 661 FIRKIYYAVKVE 672

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/672 (79%), Positives = 587/672 (87%)

Query: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60
           M++ IWLAL  YI +AKAFSLPG+SPTTY +NDEIPLLVNRLTPSIYFQH+DENG D+SS
Sbjct: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60

Query: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120
           DKEHFLYSYDYYN++FHFC+PEHVEKQPESLGSVIFGDRIYNSPFQL+MLE+KECVALCK
Sbjct: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120

Query: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180
            TIPG+DA+FIN LI +GFFQNWLVDGLPAAR+VYDSRTKTNYYGTGFELGFTDV QTVG
Sbjct: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180

Query: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240
            +T+P+TMEE D + S  GATL  R PKNI+PN V+T+EL +FVNHF I VE+H+RGN +
Sbjct: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240

Query: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300
           YR+VGVTVNP+SIERSSPG+CS T +PLTL ED+DN+VYFTYSVKF+AS TVWATRWDKY
Sbjct: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300

Query: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360
           LH+YDPQIQWFSLI FS+IVILLSS VIHS+LRA++SD  RYNELNL+NEFHEDAGWKL 
Sbjct: 301 LHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLG 360

Query: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420
           HGDVFR PPKSM+LSVLVGSGIQLFLMIICSIFFAA GLVSP SRGSL TVMF+LYALFG
Sbjct: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420

Query: 421 FVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLF 480
           FVGSYTSMGVYKFFHGPYWKAN                VAMN FLLFAHSSGVIPA++LF
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480

Query: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540
           FIIFLWF VSIPLSF GS +AHKRC W+EHPTKTNQIARQ P QPWYLRT QAT++AGIF
Sbjct: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFGF                    YHSLCLENW WQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQW 600

Query: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660
           RSFIIGGLGCS+YMFIH+ILFTKFKLGGF+TVVLY+GYSFI+S LCCVVTGAIGFFSSMI
Sbjct: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660

Query: 661 FIRKIYYAVKVE 672
           FIRKIY  +KVE
Sbjct: 661 FIRKIYSRIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score = 1115 bits (2884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/672 (79%), Positives = 580/672 (86%)

Query: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60
           MKQSIWL L  YI + KAFSLPGLSPTTYH NDEIPLLVNRLTPSIYFQHQDENG DISS
Sbjct: 19  MKQSIWLLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISS 78

Query: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120
           DKEH+LYSYDYYNERFHFCRPEHVE+QPESLGS+IFGDRIYNSPFQLRMLE KECVALC+
Sbjct: 79  DKEHYLYSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCE 138

Query: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180
            TIPG+DA+FIN+LI SGFFQNWLVDGLPAAR V+DSRTKTNYYGTGFELG T V  T+ 
Sbjct: 139 NTIPGKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTID 198

Query: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240
            + +P+TMEE D + SN GA L  R PKNI+PN VKTVELPYFVNHF+I VEFH+RG+D+
Sbjct: 199 GKVIPSTMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDN 258

Query: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300
           YR+VGVTVNP+SIERSSP SCS+  KPL L E+ DNE+YFTYSVKFVAS TVWATRWDKY
Sbjct: 259 YRVVGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKY 318

Query: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360
           LHIYDPQIQWFSLI FSVI++LLSS V+HSLLRAL SDL+RYNELNL+NEFHED+GWKL 
Sbjct: 319 LHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLG 378

Query: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420
           HGDVFRTP KSMLLSVLVGSG+QLFLMIICSIF AA GLVSP+SRGSL TVMF+ YALFG
Sbjct: 379 HGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFG 438

Query: 421 FVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLF 480
           FVGSYTSMGVYKFFHGPYWKAN                VAMN FLLFAHSSGVIPA +LF
Sbjct: 439 FVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLF 498

Query: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540
           FIIFLWF VSIPLSF GS++AHK C+W+EHPTKTNQIARQ+P+QPWYLRT QAT++AGIF
Sbjct: 499 FIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIF 558

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQW 600
            FGSIAVELYFIYSSLWFNKIFYMFGF                    YHSLCLENW WQW
Sbjct: 559 CFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQW 618

Query: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660
           RSFIIGGLGCS+YMFIHSILFTKFKLGGFIT+VLY GYSFI+S LCCVVTGAIGFFS M+
Sbjct: 619 RSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCML 678

Query: 661 FIRKIYYAVKVE 672
           FIRKIY AVK+E
Sbjct: 679 FIRKIYSAVKIE 690

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score = 1115 bits (2884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/672 (79%), Positives = 577/672 (85%)

Query: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60
           MK+ +WL +  Y  + K FSLPGLSPTTYHS DEIPLLVNRLTPSIYFQHQDE GND+S 
Sbjct: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60

Query: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120
           DKEHFLYSYDYYN+RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQL MLEEKECVALCK
Sbjct: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120

Query: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180
            TIPG+DA+FIN LI SGFFQNWLVDGLPAAR  YDSRTKTNYYGTGFELGFTDV QTV 
Sbjct: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180

Query: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240
            + VP+TMEE   +ASN    L  R PKN++PN VKTVELPYFVNHF+I VEFH+RGND+
Sbjct: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240

Query: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300
           YR+VGV VNPVSIERSSPG+CS T KPL L ED+DNEVYFTYSVKFVAS TVWATRWDKY
Sbjct: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300

Query: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360
           LHIYDPQIQWFSLI FSVIVILLSS V+HSLLRALKSDL RYNELNL+NEFHED+GWKL 
Sbjct: 301 LHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLG 360

Query: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420
           HGDVFRTP KSMLLS+LVGSG+QLFLM++CSIFFAA GLVSP+SRGSL TVMF+LYALFG
Sbjct: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420

Query: 421 FVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLF 480
           FVGSY SMGVYKFF GPYWKAN                V MN FLLFAHSSGVIPA+SLF
Sbjct: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480

Query: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540
           FII LWF+VS+PLSF GS++AHK+C+W+EHPTKTNQIARQIP+QPWYLRT QAT++AGIF
Sbjct: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFGF                    Y+SLCLENWLWQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQW 600

Query: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660
           RSFIIGGLGCSIY FIHSILFTKFKLGG ITVVLYLGYS I+S LCCVVTGAIGFFSSM 
Sbjct: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660

Query: 661 FIRKIYYAVKVE 672
           FIRKIY A+KVE
Sbjct: 661 FIRKIYSAIKVE 672

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/660 (69%), Positives = 537/660 (81%), Gaps = 4/660 (0%)

Query: 13  IPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYY 72
           + + +AF LPG++PTTYH +DEIPLLVN LTPS+YFQH++E+G  + SDKE FLYSYDYY
Sbjct: 67  LSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYY 126

Query: 73  NERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFIN 132
            +RFHFC+PEH+EKQPESLGS+IFGDRIYNSPFQ+ ML++K CV+LCK TIPG+DA+FIN
Sbjct: 127 YDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFIN 186

Query: 133 RLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEAD 192
           +LI +GFFQNWL+DGLPAAR VYDSRTKT +YGTGFELGF DV+Q  G  T  N    A 
Sbjct: 187 KLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQ--GTTTGDNANTVAK 244

Query: 193 MDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVS 252
              +N G  L  R  KN++   +K  ELPYF NHF+I VE+H+RG ++YR+VGV VNPVS
Sbjct: 245 KPTTNEGLELDTRDAKNVQM--LKNFELPYFANHFDIQVEYHDRGENNYRVVGVIVNPVS 302

Query: 253 IERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFS 312
           I+RS+PG+C  +  PL L ED+DN+VYFTYSVKF+ S T+WATRWDKYLHIYDP IQWFS
Sbjct: 303 IKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFS 362

Query: 313 LIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSM 372
           LI FSV+V+LLSS VIHSLL+ALKSD  RYNELNL+++F E+AGWKL HGDVFR P +S+
Sbjct: 363 LINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSL 422

Query: 373 LLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYK 432
           LLSVLVGSG+QLFLMIICSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYTSMGVYK
Sbjct: 423 LLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYK 482

Query: 433 FFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIP 492
           FF GPYWK N                VA+NIFLLF HSSGVIPA +LFF+I LWFV SIP
Sbjct: 483 FFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIP 542

Query: 493 LSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFI 552
           L+  GS++AHK+C+W+EHPTKTNQIARQIP QPWYL+T  AT++AGIF FGSIAVELYFI
Sbjct: 543 LALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFI 602

Query: 553 YSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSI 612
           YSSLWFNKIFYMFGF                    YHSLCLENW+WQWR FIIGG+GC+I
Sbjct: 603 YSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAI 662

Query: 613 YMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           Y+FIHSILFTKFKLGGF T+VLY+GYS I+S+L C+VTGAIGF SSM FIRKIY ++KVE
Sbjct: 663 YVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/661 (67%), Positives = 525/661 (79%), Gaps = 7/661 (1%)

Query: 12  YIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDY 71
           ++ + +AF LPG++PTTYH  DEIPLLVN LTPS+YFQ  D NG   S +KEHFLYS+DY
Sbjct: 13  FLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDY 70

Query: 72  YNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFI 131
           Y +R HFC+PEH+EKQPESLGS+IFGDRIYNSPF+L+MLEEK CV+LCK TIPG+DA+FI
Sbjct: 71  YFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFI 130

Query: 132 NRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEA 191
           N+LI +GFFQNWL+DGLPAA  VYD +TK+ +YGTGFELGF +  Q + D   P T +  
Sbjct: 131 NKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAI-DGQAPATTKPK 189

Query: 192 DMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPV 251
               +N G  L  R  KN++   VK +E+ YFVNH++I VE+H+RG  +YR+VGV VNPV
Sbjct: 190 Q--TTNEGLELETREAKNVQM--VKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPV 245

Query: 252 SIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWF 311
           SI+RS+PG+C  T  PL L ED DN+VYFTYSVKFV S TVWATRWDKYLH YDP IQWF
Sbjct: 246 SIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWF 305

Query: 312 SLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKS 371
           SL+ FS+IV+LLSS VIHSL++ALKSD  RYNE NL ++F EDAGWKL HGDVFR P KS
Sbjct: 306 SLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKS 365

Query: 372 MLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVY 431
           MLLSVLVGSG+QLFLMI CSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYTSM VY
Sbjct: 366 MLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVY 425

Query: 432 KFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSI 491
           KFF GPYWK N                V +N FL+FAHSSGV+PA +LFF+I LWF+ SI
Sbjct: 426 KFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSI 485

Query: 492 PLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYF 551
           PL+F GS++AHK+C+W+EHPTKTNQIARQIP QPWYL+T  ATM+AGIF FGSIAVELYF
Sbjct: 486 PLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYF 545

Query: 552 IYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCS 611
           IY+SLWFNKIFYMFGF                    YHSLCLENW WQWR FI+GG+GC+
Sbjct: 546 IYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCA 605

Query: 612 IYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKV 671
           IY+F+HSILFTKFKLGGF T+VLY+GYS ++S+L CVVTGAIGF SS+IF+RKIY A+KV
Sbjct: 606 IYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKV 665

Query: 672 E 672
           +
Sbjct: 666 D 666

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/660 (67%), Positives = 526/660 (79%), Gaps = 9/660 (1%)

Query: 13  IPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYY 72
           +  AKAF LPG++PTTY  NDEIPLLVN LTPS+Y+QH+DE GN++S DKE+FLYSYDYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 73  NERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFIN 132
           N RFHFC+PE VEKQPESLGS+IFGDRIYNSPFQL+MLEEKECV+LCK TIPG DA+FIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 133 RLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEAD 192
           +LI +GFFQNWL+DGLPAAR+V D RTKT++YG GFELGF +V Q    E  PNT E   
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAE--- 189

Query: 193 MDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVS 252
              +N G  L  R   N+    V+T E PYF NH++I +E+H+RG  +YR+VGV VNPVS
Sbjct: 190 --TTNQGVELDTRDGHNM----VQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVS 243

Query: 253 IERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFS 312
           I+RS P +C     PL L E+ DNEVYFTYSVKFV S T WATRWDKYLH+YDP IQWFS
Sbjct: 244 IKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFS 303

Query: 313 LIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSM 372
           LI FS++V+LLSS VIHSLLRALKSD  RYNELNL+++F ED+GWKLSHGDVFR P +S+
Sbjct: 304 LINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSL 363

Query: 373 LLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYK 432
            LS+LVGSG+QLF M+ CSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYTSMG+YK
Sbjct: 364 TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYK 423

Query: 433 FFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIP 492
           FF GPYWKAN                +A+N FL+F HSSGVIPA +LFF++FLWF+ SIP
Sbjct: 424 FFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIP 483

Query: 493 LSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFI 552
           LSF GS++A K+C W+EHPTKTNQIARQIP QPWYL+T  AT++AG+F FGSIAVELYFI
Sbjct: 484 LSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFI 543

Query: 553 YSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSI 612
           Y+SLWFNKIFYMFGF                    YHSLCLENW WQWR FI+GG GC++
Sbjct: 544 YTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCAL 603

Query: 613 YMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           Y+FIHSILFTKFKLGGF T+VLY+GYS ++S+LCC+VTG+IGF SSM FIRKIY ++KV+
Sbjct: 604 YVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/666 (67%), Positives = 527/666 (79%), Gaps = 9/666 (1%)

Query: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66
           L L  ++   KAF LPG++PTTY  ND IPLLVN LTPS+ +QH+DE+GN++S DKE+FL
Sbjct: 11  LLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFL 70

Query: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126
           YSYDYY  RFHFC+PE VEKQPESLGSVIFGDRIYNSPFQL ML+EKEC +LCK  IPG 
Sbjct: 71  YSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGD 130

Query: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186
           DA+FIN+LI +GFFQNWL+DGLPAAR VYD RTKT++YG GF LGF  V Q    E  P 
Sbjct: 131 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPK 190

Query: 187 TMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGV 246
             E  D D       L  R+ +N+    VKT ELPYF NHF+I++E+H+RG  +YR+VGV
Sbjct: 191 GAETTDKDVE-----LETRNDRNM----VKTYELPYFANHFDIMIEYHDRGEGNYRVVGV 241

Query: 247 TVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDP 306
            V PVSI+RSSPG+C  T  PL L E  DNEVYFTYSVKF  SAT WATRWDKYLH+YDP
Sbjct: 242 IVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDP 301

Query: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366
            IQWFSLI FS++V+LLSS VIHSLLRALKSD  RYNELNL+++F ED+GWKL+HGDVFR
Sbjct: 302 SIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFR 361

Query: 367 TPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426
           +P +S+ LS+LVGSG+QLFLM+ CSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYT
Sbjct: 362 SPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 421

Query: 427 SMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLW 486
           SMG+YKFF+GPYWKAN                +A+N FL+F HSSGVIPA +LFF++FLW
Sbjct: 422 SMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLW 481

Query: 487 FVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIA 546
           F+ SIPLSF GS++A KRC W+EHPTKTNQIARQIP QPWYL+T  AT++AGIF FGSIA
Sbjct: 482 FLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 541

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIG 606
           VELYFIY+SLWFNKIFYMFGF                    YHSLCLENW WQWR FIIG
Sbjct: 542 VELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIG 601

Query: 607 GLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           G GC++Y+FIHSILFTKFKLGGF T+VLY+GYS ++S+LCC+VTG+IGF SSM+F+RKIY
Sbjct: 602 GAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIY 661

Query: 667 YAVKVE 672
            ++KV+
Sbjct: 662 SSIKVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/684 (65%), Positives = 531/684 (77%), Gaps = 19/684 (2%)

Query: 5   IWLALLSYI-PVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKE 63
           I L LL +I   A+AF LPG++PTTY  NDEIPLLVN LTPS+Y+QHQDE+GN++S DKE
Sbjct: 4   IQLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKE 63

Query: 64  HFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTI 123
           HFLYSYDYY ++FHFC+PEHVEKQPESLGS+IFGDRIYNSPF+L ML+EKECV+LCK  I
Sbjct: 64  HFLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVI 123

Query: 124 PGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDET 183
           PG DA+FIN+LI +GFFQNWL+DGLPAAR V+D RTKT++YG GF LGF +V Q V  ET
Sbjct: 124 PGDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSET 183

Query: 184 ---------------VPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFE 228
                               E     +SN G  L  R       N VKT E PYF NHF+
Sbjct: 184 EQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK---NMVKTREFPYFANHFD 240

Query: 229 IVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVA 288
           I +E+H+RG  +YR+VGV VNP+SI+RSSPG+C     PL L E  DNEVYFTYSVKF  
Sbjct: 241 IKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEE 300

Query: 289 SATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLN 348
           S T WATRWDKYLH+YDP IQWFSLI FS++V+LLSS VIHSLLRALKSD  RYNELNL+
Sbjct: 301 SPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLD 360

Query: 349 NEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSL 408
           ++F ED+GWKL+HGDVFR P +S++LS+LVGSG+Q+FLM+ CSIFFAA G +SP SRGSL
Sbjct: 361 DDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSL 420

Query: 409 QTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFA 468
            TVMF+LYALFGFVGSYTSMG+YKFF GPYWKAN                +A+N FL+F 
Sbjct: 421 ATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFV 480

Query: 469 HSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYL 528
           HSSGVIPA +LFF++FLWF+ SIPLSF GS++A K+C W+EHPTKTNQIARQIP QPWYL
Sbjct: 481 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL 540

Query: 529 RTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXY 588
           +T  AT++AGIF FGSIAVELYFIY+SLWFNKIFYMFGF                    Y
Sbjct: 541 KTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITY 600

Query: 589 HSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCV 648
           HSLCLENW WQWR F +GG+GC++Y+FIHSILFTKFKLGGF T+VLYLGYS ++S+LCC+
Sbjct: 601 HSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCL 660

Query: 649 VTGAIGFFSSMIFIRKIYYAVKVE 672
           VTG+IGF SSM FIRKIY ++KV+
Sbjct: 661 VTGSIGFISSMFFIRKIYSSIKVD 684

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/666 (66%), Positives = 527/666 (79%), Gaps = 8/666 (1%)

Query: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66
           L L  ++   KAF LPG++PTTY  NDEIPLLVN LTPS+Y+QH+DE GN +S DKE+FL
Sbjct: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66

Query: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126
           YSYDYY +RFHFCRP+HVEKQPESLGSVIFGDRIYNSPF+L ML+EKECV LC  TIPG 
Sbjct: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126

Query: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186
           DA+FIN+LI +GFFQNWL+DGLPAAR VYD RTKTN+YG GFELG  +V Q    +T P 
Sbjct: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186

Query: 187 TMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGV 246
             E      +N G  L  R+      + V+T E PYF NHF+I++E+H+RG   YR+VGV
Sbjct: 187 QAE-----TTNEGLELGTRAEDY---SIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGV 238

Query: 247 TVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDP 306
            VNP+SI+RS  G+C     PL L E+RDNEV FTYSVKF  SAT WATRWDKYLH+YDP
Sbjct: 239 IVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDP 298

Query: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366
            IQWFSLI FS++V+LLSS VIHSLLRALKSD  RYNELNL ++F ED+GWKL+HGDVFR
Sbjct: 299 SIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358

Query: 367 TPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426
            P  S+LLS+LVGSG+QLFLM+ CSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYT
Sbjct: 359 PPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 418

Query: 427 SMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLW 486
           SMG+YKFF+GPYWKAN                VA+N FL+  HSSGVIPA++LFF++FLW
Sbjct: 419 SMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLW 478

Query: 487 FVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIA 546
           F+ SIPLSF GS++A K+C W+EHPTKTNQIARQIP QPWYL+T  AT++AGIF FGSIA
Sbjct: 479 FLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 538

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIG 606
           VELYFIY+SLWFNKIFYMFGF                    YHSLCLENW WQWR FI+G
Sbjct: 539 VELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVG 598

Query: 607 GLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           G+GC++Y+FIHSILFTKFKLGGF+T+VLY+GYS+++S+LCC+VTG+IGF SSM F+R+IY
Sbjct: 599 GVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658

Query: 667 YAVKVE 672
            ++KV+
Sbjct: 659 SSIKVD 664

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/657 (67%), Positives = 528/657 (80%), Gaps = 7/657 (1%)

Query: 16  AKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNER 75
            +AF LPG++PTTYH  DEIPLLVN L+PS+Y+QH+++ G D+SSDK  +LYSYDYY +R
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 76  FHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLI 135
           FHFC+PE +EKQPESLGS++FGDRIYNSPFQL MLEEK+C +LCK TIPG DA+FIN+LI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 136 ISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDA 195
            +GFFQNWL+DGLPAA   +D+RT T++YG+GFELG  DV+Q V DET   T     + A
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAV-DETEART----KVAA 189

Query: 196 SNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIER 255
           +N GA L  R  KN++   +K VEL YFVNH++I +E+H+RGN  YR+VGV VNPVSI+R
Sbjct: 190 ANQGAELDARDAKNVKT--IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR 247

Query: 256 SSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLIG 315
           SSPGSC  T +PLTL ED DN+VYFTYSV FV S T WATRWDKYLH+YDP IQWFSL+ 
Sbjct: 248 SSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVN 307

Query: 316 FSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLS 375
           FS+IV+LLS+ V+HSLL+ALK+D  RYNE NL++EF EDAGWKL HGDVFR P KSMLLS
Sbjct: 308 FSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLS 367

Query: 376 VLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFH 435
           VLVGSG+QLF+MI  +IFFAA G +SP SRG L TVMF+LYALFGFVGSYTSMGVYKFF 
Sbjct: 368 VLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFR 427

Query: 436 GPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSF 495
           GPYWKAN                +AMN FL++ HSSGVIPAK+LFF++ LWFV SIP +F
Sbjct: 428 GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAF 487

Query: 496 VGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSS 555
            GS++A+K+C+WNEHPTKT QIARQIP QPWYL+T  AT +AGIF FGSIAVE+YFIY+S
Sbjct: 488 AGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTS 547

Query: 556 LWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSIYMF 615
           LW+NKIFYMFGF                    YHSLCLENW WQWRSFI+GG+GC+IY+F
Sbjct: 548 LWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVF 607

Query: 616 IHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           IHSILFTKFKLGGF TVVLYLGYS I+S+LCC+VTG+IGF SSM F+RKI+ ++KV+
Sbjct: 608 IHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/666 (64%), Positives = 521/666 (78%), Gaps = 8/666 (1%)

Query: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66
           LALL       AF LPG++PTTY +NDEIPLLVN L+PS+Y+QH+ E+G ++  DK  +L
Sbjct: 10  LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYL 69

Query: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126
           YSYDYY +RFHFC+PE + K+PESLGS+IFGDRIYNSP+Q++MLEEK CV LC   IPG+
Sbjct: 70  YSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGK 129

Query: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186
           DAEFIN+LI +GFFQNWL+DGLPAAR V+D  T +++YG GFELG  +V+Q V       
Sbjct: 130 DAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQA---K 186

Query: 187 TMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGV 246
           T  + D   S   A L  R  KN++   +K VELPYF NH +I VE+H+RG  + R+VGV
Sbjct: 187 THPKEDDSGS---AKLSTRDAKNVQM--LKNVELPYFANHHDITVEYHDRGEGNLRVVGV 241

Query: 247 TVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDP 306
           TV+P+SI+RSSPG+C  +  PL L E  DNEVYFTYSV+FVAS TVWATRWDKYLH YDP
Sbjct: 242 TVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDP 301

Query: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366
            IQWFSL+ FS++V+LLSS VIH LL+AL+SD  RYNELNL+NEF ED+GWKL+HGDVFR
Sbjct: 302 TIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFR 361

Query: 367 TPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426
            P KSMLLS+LVGSGIQLFLMI  SIFFAA G +SP SRGSL TVMF+LYALFGFVGSYT
Sbjct: 362 IPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYT 421

Query: 427 SMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLW 486
           SMGVYKFF GPYWKAN                V +N+FLL AHSSG IPAK+LFFI+ LW
Sbjct: 422 SMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLW 481

Query: 487 FVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIA 546
           FV+S+P +  GS++AHK+CSW+EHPTKTNQ+ARQ+P QPWYL+T  AT +AGIF FGSIA
Sbjct: 482 FVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIA 541

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIG 606
           VELYFIY+SLW+NKIFYMFGF                    YHSL LENW WQWRSFI+G
Sbjct: 542 VELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVG 601

Query: 607 GLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           G+GC+IYMF+HSILFTK KLGGF+T+VLY+GYS ++S+LCC+VTG+IGF SSM F+R+IY
Sbjct: 602 GVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIY 661

Query: 667 YAVKVE 672
            ++KVE
Sbjct: 662 SSIKVE 667

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/658 (65%), Positives = 504/658 (76%), Gaps = 25/658 (3%)

Query: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74
           + KAF LPG++PTTYHSNDEI LLVN LTPS+ FQH+DE+GN +  DKEH+LYSYDYY  
Sbjct: 15  LVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYYS 74

Query: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134
           +FHFC+PE+V +QP SLGSVIFGDRI+NSPF+L MLEEKECV LC   IPG DA+F+N+L
Sbjct: 75  KFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKL 134

Query: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMD 194
           I +GF QNWL+DGLPA R ++DSRT +N+YGTGF+LGF DV +   D    N  E+  M 
Sbjct: 135 IKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDS---NDEEKKIM- 190

Query: 195 ASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIE 254
                                KT+E+PY  NH++I +E+H+RGND+YR+VGVTV+PVSI+
Sbjct: 191 ---------------------KTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIK 229

Query: 255 RSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLI 314
           RSS  SC      LTL E  +NEV+FTYSVKF+ S TVWATRWDKYLH+YDP IQWFSLI
Sbjct: 230 RSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLI 289

Query: 315 GFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLL 374
             SVIV+ LSS V+H LLRALK+DL+RYNE NL+NEFHED+GWKLSHGDVFR PP+S+LL
Sbjct: 290 NCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLL 349

Query: 375 SVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFF 434
           S+LVGSG+QLFLMI CSI FAA G +SP SRGSL TVMFLLYALFGFVGSYTSM +YKFF
Sbjct: 350 SILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFF 409

Query: 435 HGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLS 494
            GP WK N                + +N FL+F  SSG IPA +LF II LWFV SIPLS
Sbjct: 410 KGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLS 469

Query: 495 FVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYS 554
           F GS++AHKRC  + HPTKTNQIARQIP QPWYL+T   +++AG+F F SIAVELYFIY+
Sbjct: 470 FAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYT 529

Query: 555 SLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSIYM 614
           SLWFNKIFYMFGF                    YHSLCLENW WQWRSFIIGG GC+IY+
Sbjct: 530 SLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYV 589

Query: 615 FIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           FIHSILFTKFKLGGF TVVLYLGYS ++SVLCC+VTG+IGF SSM FIRKIY +VKV+
Sbjct: 590 FIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/686 (59%), Positives = 500/686 (72%), Gaps = 20/686 (2%)

Query: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66
           L L  ++     F LPG +P TY   D IPLLVN LTPS+ FQH D++GN+I  DK   L
Sbjct: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65

Query: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126
           Y YDYYNE+ HFC+PE +EKQPESLGSVIFG++IYNSPF ++MLE+ ECV LC  TIPG+
Sbjct: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125

Query: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186
           DA+FIN+LI +GF QNWL+DGLPAAR ++DSRT T +YG GFELGF +V Q VG + V  
Sbjct: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185

Query: 187 TMEEADMDASNAG-------------------ATLHIRSPKNIRPNPVKTVELPYFVNHF 227
           + +E  +   +A                    + L +R  KN+  N V  VE+P F NHF
Sbjct: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245

Query: 228 EIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRK-PLTLHEDRDNEVYFTYSVKF 286
           +I VE+H+RGN  +R+VGV VNPVS++     SC+   +  L L E++DNEV FTYSVKF
Sbjct: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305

Query: 287 VASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELN 346
             S T WATRWDKYLHIYDP+IQWFSLI FSVIV+LLSS  IHSLLRALKSD++RYNE N
Sbjct: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365

Query: 347 LNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRG 406
           L +EF ED+GWKL HGDVFRTP  SMLLSVLVGSGIQLFLMI  SI  +A G++SP SRG
Sbjct: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRG 425

Query: 407 SLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLL 466
           SL T MF+ YA+FGFVGSYTSMG+YKFF GPYWKAN                + MN+ L 
Sbjct: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485

Query: 467 FAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPW 526
           F  SS VIP  +L F++FLW + SIPL+F GS++++K+C+W+EHPTKTN+I RQIP QPW
Sbjct: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545

Query: 527 YLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXX 586
           +L+T  AT++ G+ SFGSIAVELYFIYSSLWFNKIFYMFGF                   
Sbjct: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605

Query: 587 XYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLC 646
            Y +LC ENW WQWRSF IGGLGCSIY+FIHSILFT+FKLGGF T+VLY+GYSF++S L 
Sbjct: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665

Query: 647 CVVTGAIGFFSSMIFIRKIYYAVKVE 672
           C+VTGAIGF  SM F+R+I+ ++KV+
Sbjct: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/673 (61%), Positives = 507/673 (75%), Gaps = 17/673 (2%)

Query: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60
           M ++I+  L  Y+ +  AF LPG++PTTY   DEIPLLVN LTPS+ FQH+D+ GNDI  
Sbjct: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61

Query: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120
           +KEHFLYS+DYY  + HFC+PEHVEKQPESLGS++FGDRIYNSPF ++MLE +EC +LCK
Sbjct: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121

Query: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180
            TIP  DA+FIN+LI +GFFQNWL+DGLPAAR ++D +TK+++YGTGF LG   V Q VG
Sbjct: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181

Query: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240
                  +  + ++  N       R  KN+  N V  VE+P+  NH++I VE+H+RG  +
Sbjct: 182 G------LASSKLNLENPA-----REAKNVN-NMVHNVEIPFLFNHYDINVEYHDRGEGN 229

Query: 241 YRIVGVTVNPVSIERSSPGS-CSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDK 299
           YR+VGVTV+P    +SS G  C++    L L E  DNEV F+YSV+F+ S TVWATRWDK
Sbjct: 230 YRVVGVTVDP----KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDK 285

Query: 300 YLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKL 359
           YLH+YDP IQWFSLI FSV+VILLS  VIHSL+RALKSD  RY E NL++ F +D+GWKL
Sbjct: 286 YLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKL 345

Query: 360 SHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALF 419
            HGDVFR P KSMLLS+LVGSG QLFLM+  SIFFAA G++SP SRGSL + MF+LYALF
Sbjct: 346 GHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALF 405

Query: 420 GFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSL 479
           GF GSY SMGVYKFF+GPYWKAN                V +N FLLF+ SSG IP  +L
Sbjct: 406 GFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTAL 465

Query: 480 FFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGI 539
            F+I LWF++SIPLS  GS++A+K+C+W EHPTKTN+IARQIP QPWYL+T  AT++AG+
Sbjct: 466 IFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGL 525

Query: 540 FSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQ 599
           F FGSIAVELYFIYSSLWFNKIFYMFGF                    Y+SL LENW WQ
Sbjct: 526 FPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQ 585

Query: 600 WRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSM 659
           WRSFI+GG+GC+ Y+F+HSI+FTKFKLGGF T+VLY+GYS I+S LC VVTGAIGF SSM
Sbjct: 586 WRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSM 645

Query: 660 IFIRKIYYAVKVE 672
           +F++KIY +VKV+
Sbjct: 646 LFVKKIYSSVKVD 658

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/658 (59%), Positives = 492/658 (74%), Gaps = 11/658 (1%)

Query: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74
           + +AF LPG++PTTYH  D++PLLVN LTPS +++H D + +D + DKE FLYSYDYY +
Sbjct: 19  LVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYK 77

Query: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134
           +FHFC+P  ++KQPESLGS+IFGDRIYNSPF+L++L+  EC +LCK  IPG+DA+FIN+L
Sbjct: 78  KFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKL 137

Query: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMD 194
           I++GFFQNW++DGLPAAR + D++T   +YG GFELG  DV+             E D  
Sbjct: 138 ILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDY----------EPDTR 187

Query: 195 ASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIE 254
           + +    L + + KN+     K  E+PYFVNH++I +E+H+RG ++YRIVGVTVNP SI+
Sbjct: 188 SLHDELELQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIK 247

Query: 255 RSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLI 314
           R SP SC  T K L L E  DNEVYFTYSVKF+ S TVWATRWDKYLH+YDP+IQWFSLI
Sbjct: 248 RDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLI 307

Query: 315 GFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLL 374
            FS IV+LLSS ++HSL  ALK+DL RYNELNL+ +F E+ GWKL HGDVFR+P K++LL
Sbjct: 308 NFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLL 367

Query: 375 SVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFF 434
           SVLVGSG QL LM+  +I FA  G +SP SRGSL TVMFLLYA+FG  GS+TSM  YKFF
Sbjct: 368 SVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFF 427

Query: 435 HGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLS 494
           +G  W+ N                + +N FL+F HSSG IP +++  ++ LWFV+SIPLS
Sbjct: 428 NGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLS 487

Query: 495 FVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYS 554
            +GSV+A K+C+WNEHPTKTNQIARQIP QPWYL+T    ++AGIF FGSIAVELYFIYS
Sbjct: 488 AIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYS 547

Query: 555 SLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSIYM 614
           SLWFNKI+YMFGF                    YHSLC+ENW WQWRSF+IGG GC+ Y+
Sbjct: 548 SLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYV 607

Query: 615 FIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           F HSILFTKF+LGG  T+VLYLGYS ++S LCC+VTGAIGF SS+I +RKIY  VKV+
Sbjct: 608 FCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/658 (61%), Positives = 487/658 (74%), Gaps = 9/658 (1%)

Query: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74
           +A AF LPG++PTTYH  DEIPLLVN LTPS YFQH D+ G+ +S DKE FLYSYDYY +
Sbjct: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71

Query: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134
           +FHFCRPE++ KQPESLGS+IFGDRIYNSPF+L MLE K CV LCK  IP  DA+FIN+L
Sbjct: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131

Query: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMD 194
           I +GFF NWLVDGLPAAR ++D RT + +YG GFELGF DV+ T+ D       E   ++
Sbjct: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIE 191

Query: 195 ASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIE 254
            ++A   L  RS         K  EL YF+NHF+I +E+H+RG D+YR+VGV+V P SI+
Sbjct: 192 IADADKELKERS--------AKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK 243

Query: 255 RSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLI 314
           R S  SC    +PL L ED DN V+FTYSV FV S T+WATRWDKYLH+YDPQIQWFSLI
Sbjct: 244 RDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLI 303

Query: 315 GFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLL 374
            FS+IVILLSS ++HSL RALK+DL+RYNELNL++EF E+ GWKL HGDVFRTP ++MLL
Sbjct: 304 SFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLL 363

Query: 375 SVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFF 434
           SVLVGSG QLFLM   +I FA  GL+SP SRGSL TVMF+LYALFG  GSYTSM VYKFF
Sbjct: 364 SVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFF 423

Query: 435 HGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLS 494
           +G  WK N                + +N FL+F HSSG IP  ++  I+ LWFV SIPLS
Sbjct: 424 NGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLS 483

Query: 495 FVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYS 554
             GS+++ K+  W + PT TNQIARQIP QPWYL+T  A+++AG F FGSI VELYFIYS
Sbjct: 484 VAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYS 542

Query: 555 SLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSIYM 614
           SLWFNKIFYMFGF                    Y+SLC+ENW WQWR F IGG GC+ Y+
Sbjct: 543 SLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYV 602

Query: 615 FIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           F+H+ILFTKFKLGG  TVVLYLGYS ++S LCC++TGA+GF SS+ F+RKIY ++KV+
Sbjct: 603 FVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/666 (57%), Positives = 496/666 (74%), Gaps = 8/666 (1%)

Query: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66
           L+LL  + V +AF+LPGL P TY   D+IPLLVN LTPS++F H++E G DIS+ K++ +
Sbjct: 6   LSLLFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVV 65

Query: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126
           +SYDYY E+FHFC+P H+EK   S+GS++FGDRIYNSPFQL MLE K CV LC+  IPG+
Sbjct: 66  HSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGK 125

Query: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186
           DAEFIN+LI +G++QNW +DGLPAAR VYD RTK+++YG GFELG  ++ QT GD+ +P+
Sbjct: 126 DAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPD 185

Query: 187 TMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGV 246
           ++ +         + L  R  KN+  N +K VE+PYFVNHF+IV+E+HERGN +YR+VG 
Sbjct: 186 SVHDI--------SDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGA 237

Query: 247 TVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDP 306
           TVNPVSI R S G C+ T K LTL+E+ DN V+ TYSV FV S T W TRWDKYLH+YDP
Sbjct: 238 TVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDP 297

Query: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366
           +IQWFSLI FS+IVILLS  +I+SLL+ALKSD  RYN +NL+++  E++GWKL HG VFR
Sbjct: 298 KIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFR 357

Query: 367 TPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426
            P   M+LS+LVGSG QLFL+I+C++F AA  ++SPI RG+L T M +LY LFGF+ SY 
Sbjct: 358 IPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYV 417

Query: 427 SMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLW 486
           SMGVYKFF GPYWK N                +A+N+FL+F+ SS V+PAK++  +I LW
Sbjct: 418 SMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLW 477

Query: 487 FVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIA 546
           F VSIPLS  GS++A K+C W+EHPT TNQIA+ IP Q WYL+T  A+++ G+FSFGSI+
Sbjct: 478 FAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSIS 537

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIG 606
           V+LYFIY+SLWFN IFYM+GF                    YHSLC ENW WQWR F IG
Sbjct: 538 VQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIG 597

Query: 607 GLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           GLGCSIY+ +HS+ F + KLGGF  ++LY+GYS +++ L  +VTG++GF SSM FI++I+
Sbjct: 598 GLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIF 657

Query: 667 YAVKVE 672
            +VKV+
Sbjct: 658 SSVKVD 663

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/673 (59%), Positives = 496/673 (73%), Gaps = 9/673 (1%)

Query: 4   SIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKE 63
           SI L  LS   V   F LPG++PTTYH  D IPLLVN LTPS++F+H+D +GN++SSDKE
Sbjct: 9   SICLITLS---VTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKE 65

Query: 64  HFLYSYDYYNERFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKG 121
           +FLYSYDYY  + HFC+P    ++KQPESLGS++FGDRIYNSPF+L+ML ++ C  LC  
Sbjct: 66  NFLYSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCST 125

Query: 122 TIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGD 181
            IPG DA+FIN LI SGF QNWL+DGLPAAR +YD  TK+++YG+GFELG  ++IQ V D
Sbjct: 126 NIPGDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVV-D 184

Query: 182 ETVPNTMEEADMDASNAGATLHIRSPKNIRPNP--VKTVELPYFVNHFEIVVEFHERGND 239
           E   +T  +  +        L        R N   V +VE  YF NHF+I +E+H+RGN+
Sbjct: 185 EAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNN 244

Query: 240 SYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDK 299
            YRIVGVTVNP+S++R S   C      L L E  D +V FTYSV F  S TVWATRWDK
Sbjct: 245 EYRIVGVTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDK 303

Query: 300 YLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKL 359
           YLHIYDP IQWFSLI F+VIV++LS  V+H L +ALK+D  RYNE NLN+ F ED+GWKL
Sbjct: 304 YLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKL 363

Query: 360 SHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALF 419
           +HGDVFR P KSMLLS+ VGSG QLF MI   +  AA G +SP +RGSL T+MF+LYA+F
Sbjct: 364 AHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVF 423

Query: 420 GFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSL 479
           GFVGSYTSMGVY+FF+GPYWKAN                ++MN+FL+F HSS V+P  +L
Sbjct: 424 GFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTL 483

Query: 480 FFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGI 539
             ++ LW V+S+PLSF GS+++ KRC+W +HPTKTN++ RQIP QPWYL+T  AT++ GI
Sbjct: 484 SLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGI 543

Query: 540 FSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQ 599
           F FGSIAVELYFIYSSLWFNKIFYMFGF                    YHSLCLENW WQ
Sbjct: 544 FPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQ 603

Query: 600 WRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSM 659
           WRSFIIGG+GCSIY+FIHSILFT+FKLGGFIT+VLY+GYS ++++LC +VTGAIGF S+M
Sbjct: 604 WRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNM 663

Query: 660 IFIRKIYYAVKVE 672
            F++KIY ++KVE
Sbjct: 664 FFVKKIYSSIKVE 676

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/667 (56%), Positives = 489/667 (73%), Gaps = 3/667 (0%)

Query: 7   LALLSY-IPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHF 65
           L L+S+ I  + AF +PG+S  TYH  D I L VNRLTPS+YF+H DENG  +++DKEHF
Sbjct: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68

Query: 66  LYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPG 125
           LYSYDYY ++FHFCRPE VE++ ESLGSV+FGDRIYNSPF+L MLE KECV LCK TIP 
Sbjct: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128

Query: 126 RDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVP 185
            DA+FIN+LI +GFF NWL+DGLP+AR +YDS+T++ +Y +GF LG   V    G   V 
Sbjct: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKV- 187

Query: 186 NTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVG 245
            T+       + A      R  KN+    +   E+ YF NHF I +E+H+RGN++YR+VG
Sbjct: 188 -TIPGVSKLVNEAVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVG 246

Query: 246 VTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYD 305
           VTV+P+SI+R    SC+ T   L L+E+ +N+V FTYSV F+ S T WATRWDKYLH YD
Sbjct: 247 VTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYD 306

Query: 306 PQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVF 365
           P IQWFSLI F+++V+LLS+ VIH+LLRALK D++RY +LNL+N F ED+GWKL+HGDVF
Sbjct: 307 PSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVF 366

Query: 366 RTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSY 425
           R P K+M+LS+ VGSG+QLFLMI+C +  AA G +SP  RG+L T MF+LYA+FGFVGSY
Sbjct: 367 RMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSY 426

Query: 426 TSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFL 485
           TSMGVYKFFHGPYWKAN                + +N FLL  HSSG IPA ++  +I L
Sbjct: 427 TSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICL 486

Query: 486 WFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSI 545
           W +VS+PLSF+GS +A K+C+WN++PT  N+I R+IP QPWY+R+    +++GI  FG+I
Sbjct: 487 WLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAI 546

Query: 546 AVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFII 605
           AVELYFIYSSLW+NKIFYMFGF                    YHSLCLENW WQWRSF+ 
Sbjct: 547 AVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVA 606

Query: 606 GGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKI 665
           GGLGC+ Y+F++SI FT+FK  GF++++LY+GYS ++ V+ C++TGA+ F  +M F+++I
Sbjct: 607 GGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRI 666

Query: 666 YYAVKVE 672
           + ++KV 
Sbjct: 667 FTSIKVH 673

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/688 (57%), Positives = 491/688 (71%), Gaps = 17/688 (2%)

Query: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60
           M  +I L  + +      F LPG++PTTYH  D IPLLVN LTP++Y+QH DE+GND+  
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG- 59

Query: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120
           DKE  LYSYDYY  +FHFCRPE +EKQ ESLGS+IFGDRIYNSPFQ+ ML+ KEC +LC 
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTV- 179
            +IP  DA+FIN+LI +GFFQNWLVDGLPAAR   D RTK+ +Y  GFELG+  +  +  
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSEL 179

Query: 180 ----------GDET----VPNTMEEAD-MDASNAGATLHIRSPKNIRPNPVKTVELPYFV 224
                     GD++        + E+D +DA  A  +L  R   +     VK +E PYF 
Sbjct: 180 RMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFA 239

Query: 225 NHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSV 284
           NHFEI V++H+RGN +YR+VGV VNP SI+R SP +C +T + L L E    EV+F+YSV
Sbjct: 240 NHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSV 299

Query: 285 KFVASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNE 344
           KF  S TVWATRWDKYLH+YDP+IQWFSLI FS++V+ LS+ +IH L   L  DL+RYN+
Sbjct: 300 KFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQ 359

Query: 345 LNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPIS 404
           +NL+++F E+ GWKL HGDVFRTP +S++LSVLVGSG QLFLM  C+I FA  GL+SP S
Sbjct: 360 INLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSS 419

Query: 405 RGSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIF 464
           RGSL TVMF+LYALFG  GSYTSM  YKFF GPYWK N                +A+N F
Sbjct: 420 RGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFF 479

Query: 465 LLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQ 524
           L+   S+G IP  ++  I+ LWF+ SIPLS  GS++A K+C W+EHPTKT QI RQIP Q
Sbjct: 480 LVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQ 539

Query: 525 PWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXX 584
           PWYL+T  A+++AGIF FGSIAVELYFIYSSLWFNKIFYMFGF                 
Sbjct: 540 PWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITV 599

Query: 585 XXXYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSV 644
              Y+SLCLENW WQWR F IGG GC++YMFIH+ILFTKF+LGGF T+VLY+GYS +MS+
Sbjct: 600 LLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSL 659

Query: 645 LCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           L C++TG +GF SS+ F+R+IY +VKV+
Sbjct: 660 LSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/689 (56%), Positives = 481/689 (69%), Gaps = 30/689 (4%)

Query: 6   WLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHF 65
           +L + + +    AF LPG++P+TY+  DE+PLLVN LTPS+ +Q +D+ G  + S +E  
Sbjct: 5   YLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKM 63

Query: 66  LYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPG 125
           LYS+DYY  + HFC+PE + KQP+SLGS++FGDRIYNSPF ++ML+ +  V LC  TIPG
Sbjct: 64  LYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPG 123

Query: 126 RDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVP 185
            DA+FIN+LI +GFFQNWL+DGLPAAR +YDS T T +Y  GF LGF ++ + VG   +P
Sbjct: 124 SDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIP 183

Query: 186 NTMEEAD----------------------MDASNAGATLHIRSPKNIRPNPVKTVELPYF 223
              +  D                       + SN       R PK I    V  VE PY 
Sbjct: 184 MDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEK---REPKRIS-KLVHNVEFPYL 239

Query: 224 VNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYS 283
            NH+ I VE H+RG  +YR+VGVTV+P S   S+          L L E +DNEV F+YS
Sbjct: 240 ANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYS 296

Query: 284 VKFVASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYN 343
           V F+ S TVWATRWDKYLH Y+P IQWFSL+ FS+IV+LLS+ V +SLL+ALKSD  RY 
Sbjct: 297 VNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYE 356

Query: 344 ELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPI 403
           E NL+N F+ED+GWKL HGDVFR P +SMLLS+LVGSG QLFLMII SIF AA G++SP 
Sbjct: 357 EFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPS 416

Query: 404 SRGSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNI 463
           SRGSL + MF  YALFGF GSY SM VYKFF GPYWKAN                + +N 
Sbjct: 417 SRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNF 476

Query: 464 FLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPH 523
           FLLF HSSG IP  +L  I+ +WFV+S+PLSF+GS+LA+KR +W EHPTKTNQIARQIP 
Sbjct: 477 FLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPF 536

Query: 524 QPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXX 583
           Q WYL+T  A ++AGIF FG+IAVELYFIY+SLWFNKIFYMFGF                
Sbjct: 537 QSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVT 596

Query: 584 XXXXYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMS 643
               Y SLC+ENW WQWRSF IGG+GCS+Y+FIHSILFTKFKLGGF T++LY+GY+ ++S
Sbjct: 597 VLITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLS 656

Query: 644 VLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           +L C+VTGA+GF SSMIF+RKIY  V+V+
Sbjct: 657 ILSCIVTGAVGFISSMIFVRKIYSNVRVD 685

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/672 (58%), Positives = 486/672 (72%), Gaps = 22/672 (3%)

Query: 17  KAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERF 76
           + F LPG++PTTYH  D IPLLVN LTPS+YF+H D++G D + D+E FLYSYDYY ++F
Sbjct: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYYYDKF 76

Query: 77  HFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLII 136
           HFC+PE +EKQ ESLGS+IFGDRIYNSPF+L ML++KEC ALC   IP  DA+FIN+LI 
Sbjct: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136

Query: 137 SGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDAS 196
           +GFFQNWLVDGLPAAR   D RTK+ +Y  GFELGF DV    G   +     + + DA 
Sbjct: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDV----GGAKL-RMDGQGEEDAH 191

Query: 197 NAGATLHI---------------RSPKNIRPNP-VKTVELPYFVNHFEIVVEFHERGNDS 240
             GAT  +               +  K + P   VK +E  YF NHF I V++H+RGN  
Sbjct: 192 PKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGD 251

Query: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300
           YR+VGV VNP SI+R S  SC+ T + L L E+ +  V+F+YSVKF  S TVWATRWDKY
Sbjct: 252 YRVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKY 311

Query: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360
           LH+YDP+IQW+SLI FS++VI+LSS VIHSL R L+ DL+RYN+LNL+++F E+ GWKL 
Sbjct: 312 LHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLV 371

Query: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420
           HGDVFRTP KS+LLSVLVGSG QLF+M  C+I FA  GL+SP SRGSL TVMF+LYALFG
Sbjct: 372 HGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFG 431

Query: 421 FVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLF 480
            +GSYTSM  YKFF G YWK N                + +N FL+   S+G IP  ++ 
Sbjct: 432 SLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMC 491

Query: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540
            I+ LWFV SIPLS  GS++A K+C WNEHPTKT QI RQIP QPWYL+T  A ++AGIF
Sbjct: 492 AIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIF 551

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQW 600
            FGSIAVELYF+YSSLWFNKIFYMFGF                    Y+SLCLENW WQW
Sbjct: 552 PFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQW 611

Query: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660
           R F IGG GC++Y+F+H+ILFTKFKLGGF+T+VLY+GYS ++S+L C++TGA+GF SS+ 
Sbjct: 612 RGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLW 671

Query: 661 FIRKIYYAVKVE 672
           F+R+IY ++KV+
Sbjct: 672 FVRRIYSSIKVD 683

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/627 (56%), Positives = 458/627 (73%), Gaps = 8/627 (1%)

Query: 46  IYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPF 105
           +++ H+++ G DIS+D +  +YSYDYY E+ HFC+PEHVEK   S+GSV+FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 QLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYG 165
           QL ML+ K C  LC  TI GRDA+FIN+LI +G++QNWL+DGLPAAR VYD+RTK+N+YG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 TGFELGFTDVIQTVGDETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVN 225
            GFELG  ++ QT G++ +PN        +++    LH R  KNI  N ++ +E+PYFVN
Sbjct: 121 NGFELGLVEIRQTTGEKLLPN--------SADTFRDLHKRDAKNIVQNLMQDIEVPYFVN 172

Query: 226 HFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVK 285
           HF+I +E+H+RGND+YR+VGVTVNPVSI+RS  G C  T K L+L E   N ++FTYSV+
Sbjct: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232

Query: 286 FVASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNEL 345
           F+ S T W TRWDKYLH+YDP IQW S++ FS++VI+LS AV  SLL+ALKSD +RY EL
Sbjct: 233 FIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGEL 292

Query: 346 NLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISR 405
           NL+    EDA WKL HGDVFR P   MLLS+LVGSG+QLFLMIIC+IF  A GL++P SR
Sbjct: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352

Query: 406 GSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFL 465
           G+L TVMFLLY  F F+ S+ SMGVYKFF+G  W  N                + +NIFL
Sbjct: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFL 412

Query: 466 LFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQP 525
           +F HSSGVIP  +   +I LWF + +PLS  GS++A K C W+ HPTKTN +++ IP Q 
Sbjct: 413 IFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472

Query: 526 WYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXX 585
           WYL+T  A+++ G+FSFGS++VELYF+Y+SLWFNKIFYM+GF                  
Sbjct: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVL 532

Query: 586 XXYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVL 645
             Y+SL  ENW WQWRSF+I GLGCS Y+F+HS+LFT+ KLGGF   +LY+GYSF+++ L
Sbjct: 533 FTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592

Query: 646 CCVVTGAIGFFSSMIFIRKIYYAVKVE 672
             VVTGA+GF SSM+F+R IY AVKV+
Sbjct: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/658 (55%), Positives = 464/658 (70%), Gaps = 15/658 (2%)

Query: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74
           V++A  LPG+SPT Y +  EI L VN LTPS +FQH+D++GN+I SDKEH+LYSYDYYN 
Sbjct: 14  VSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNS 73

Query: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134
           + HFC+PE+V +Q ESLGSV+FGDR+YNSPF+L MLE+K CV+LCK  IPG DA FIN+L
Sbjct: 74  KLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKL 133

Query: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMD 194
           I +GF  NWLVDGLPA   + + R  + +   GF LG  +++Q V +  +    EE  + 
Sbjct: 134 IKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGIS 193

Query: 195 ASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIE 254
           A  +              N V  +ELP+  NH++I +++HE     YRIVGV V P SI+
Sbjct: 194 AHGS--------------NVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIK 239

Query: 255 RSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLI 314
           ++S  SC  T + ++L ED+DNEV +TYSV++V  +  WATRWD Y   YD  +QWFSLI
Sbjct: 240 QTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLI 298

Query: 315 GFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLL 374
              ++VI LSS V+H LLRALKSD  RYNELNL++EFHE++GWKLSHGDVFR P KS+LL
Sbjct: 299 SCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLL 358

Query: 375 SVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFF 434
           SVLVGSG+QL L+ +  I  AA    +  SR  L T+ F+LYALFGFVGSY SMGVY+FF
Sbjct: 359 SVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFF 418

Query: 435 HGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLS 494
            GPY K N                +++N FLL AHSS  IP  +LF ++ LW ++S+PLS
Sbjct: 419 KGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLS 478

Query: 495 FVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYS 554
             GS+ A K CSW++HPTKTNQIARQIP QPWYL+T  A +VAGIF F SIAVELYFIY+
Sbjct: 479 LAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYN 538

Query: 555 SLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSIYM 614
           SLWF++ FYMFGF                    YHSLCLENW WQWRSFI+GGLG ++Y+
Sbjct: 539 SLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYI 598

Query: 615 FIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           FIHSI FT+FKL GF T+VLY+GYS ++S+LCC+ TGA+GFFSSM  +RKI+ +VKV+
Sbjct: 599 FIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/666 (53%), Positives = 471/666 (70%), Gaps = 17/666 (2%)

Query: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66
           +A ++++ +A+ F LPG +PTTY   D IPLLVN +TP+++    D  G D   DKE +L
Sbjct: 5   VAWVAWLGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYL 62

Query: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126
           Y+YDYY  R H CRP+ +EK  ESLGS+IFGDR++NSPF+L+MLEEK CVALC+ T+P  
Sbjct: 63  YAYDYYYPRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAE 122

Query: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186
           DA+FIN+LI SGFF NWLVDGLPA R ++D+RT T +YGTGFELG   VI+   D    N
Sbjct: 123 DAKFINQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDR---N 177

Query: 187 TMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGV 246
             E  +++         +++ + ++P     V +PYF+NHFEI V++H+R  D  R+VGV
Sbjct: 178 QEEPGEIE---------LQTRRVLQPGE-SVVAVPYFINHFEITVDYHKRAEDELRVVGV 227

Query: 247 TVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDP 306
           +V P S++      C+ +   L L E  D +V FTYSV+F  S   WATRW KYLH+YDP
Sbjct: 228 SVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDP 287

Query: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366
           ++QW+SLI FS++V+LLSS ++HSL RALK+DL RYN+ NL+NEF ED GWKL H DVFR
Sbjct: 288 KVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFR 347

Query: 367 TPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426
           +P K++LLSV VGSG QLFLM  C++F A  G +SP SRGSL T+MF+LYA+FG  GSY 
Sbjct: 348 SPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYL 407

Query: 427 SMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLW 486
           SM  YK F G  WK N                + MN FL+   SSG +P  ++  I+ LW
Sbjct: 408 SMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLW 467

Query: 487 FVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIA 546
           FV+SIP+S +GS+ A K+ +W++HPTKT+QIA+QIP QPWYLRT  A  +AG+F FG+IA
Sbjct: 468 FVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIA 527

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIG 606
           VELYFIY+S+WFN +FYMFGF                    Y+SLC+ENW WQWRSFIIG
Sbjct: 528 VELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIG 587

Query: 607 GLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           G+GCS Y+FI+SILFTKF+LGGF+T+VLY+GYS ++S L C+VTG IGF SS+ F+RKIY
Sbjct: 588 GIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIY 647

Query: 667 YAVKVE 672
            ++KV+
Sbjct: 648 SSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/660 (45%), Positives = 404/660 (61%), Gaps = 69/660 (10%)

Query: 15  VAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNE 74
           V+  F  PG+SP TYH  DEIPLLVN L                SSD   FL++ DYY++
Sbjct: 13  VSYGFYFPGVSPVTYHIGDEIPLLVNYL----------------SSD---FLWNIDYYSD 53

Query: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRL 134
               C+P  +++Q ESLGSVIFGDR+YNSPF++ ML+  ECV LC  TI   D    N  
Sbjct: 54  SIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTF 110

Query: 135 IISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFEL--GFTDVIQTVGDETVPNTMEEAD 192
               +  NWLVDGLP      D  +  N Y    EL  G+                 +AD
Sbjct: 111 FGYRYSYNWLVDGLPVLG--IDGTSDANGYHNNSELFMGY-----------------QAD 151

Query: 193 MDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVS 252
                                     E  Y  NHF+I + +++RG   YR+V     P+S
Sbjct: 152 --------------------------EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPIS 185

Query: 253 IERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFS 312
           + R+    CS+  KP+ +       + FTYSV F  S   W+TRWD+YLH+YD  IQ   
Sbjct: 186 LPRTGSELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAE 245

Query: 313 LIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSM 372
           LI FS++V+LLSS ++HSL R LK D+  Y+E NL++EF +D  WK+ HG+VFR+P K++
Sbjct: 246 LISFSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKAL 305

Query: 373 LLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYK 432
           LLSV VGSG QLF M +C++   + G +SP +RGSL TVMF+LYALFG VGSYTSM +YK
Sbjct: 306 LLSVFVGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYK 365

Query: 433 FFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIP 492
           FF G  WK N                V +N FL++A SSG +P  ++  II LWF++S+P
Sbjct: 366 FFGGQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVP 425

Query: 493 LSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFI 552
           +S +GS+L+ K   W+EHP KTNQIARQ+P QPWY++T  AT +AG+F FG++AVELY+I
Sbjct: 426 VSIIGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYI 485

Query: 553 YSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENWLWQWRSFIIGGLGCSI 612
           Y+S+W   IF+M+GF                    Y+SLC+ENW WQWRSFIIGG+GCS+
Sbjct: 486 YASIWGEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSV 545

Query: 613 YMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           Y+F+HS+ F KFK  GF+++VLYLGYS ++S++CC+VTG+IGF +++ F+RKIY  +KV+
Sbjct: 546 YVFLHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  149 bits (376), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 167/712 (23%), Positives = 280/712 (39%), Gaps = 130/712 (18%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           ++P  Y   D + L+VN+                + SD     Y+Y        F  P  
Sbjct: 52  ITPNFYRKGDPLELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
           + K+P   SL  +I GDR + S ++L+  E+  C  LC         + +++L+  G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVV 151

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPAA +   +     YY +GF LGF D                          
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFID-------------------------- 185

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPG 259
                      P+  KT    Y  NH  +V+ FH   ND   IVG  V P S+ +   PG
Sbjct: 186 -----------PDTDKT----YLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPG 230

Query: 260 SCSRTRK-PLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYD------PQIQ 309
           +     +  + + ED +   Y  FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFH 290

Query: 310 WFSLIGFSVIVILLSSAVIHSLLRALKSD---------LTRYNELNLNNEFHEDAGWKLS 360
           W SL     IV+ +S   +   +R + +D         +     +   ++  +D   K S
Sbjct: 291 WMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYS 350

Query: 361 HGDVFRTPPKS--------MLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVM 412
              V +   ++         +L +LV  G+Q    II S+  +         R S+ T+ 
Sbjct: 351 VYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMA 410

Query: 413 FLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXX-------------XV 459
            L + L  F+ S+    +         KAN                             V
Sbjct: 411 ILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIV 470

Query: 460 AMNIFLL----FAH-SSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHK---------RC 505
            ++ FLL    +AH S+  +P K++ F + ++F+V IPLS  G ++A+            
Sbjct: 471 MVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGI 530

Query: 506 SWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNK--IFY 563
           + +E  +  N +        +         + GIF    I VE+ ++Y SLW  K   +Y
Sbjct: 531 TKDESNSDGNGLFVPKSRAKFNPLVYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYY 590

Query: 564 MFGFXXXXXXXXXXXXXXXXXXXXY--HSLCLENWL----WQWRSFIIGGLGCSIYMFIH 617
            +GF                    Y     C E+ +    W+W+ F +G  G  +YM ++
Sbjct: 591 FYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELY 649

Query: 618 SI--LFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYY 667
           S+  +F    + GF ++++ + YS I +V+C +  GA+ + ++  FI KIY+
Sbjct: 650 SLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIYH 701

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  149 bits (376), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 171/719 (23%), Positives = 288/719 (40%), Gaps = 135/719 (18%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           ++P  Y + D + L+VN+                + SD     Y+Y        F  P  
Sbjct: 52  ITPNFYKNGDPLELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
           + K P   SL  +I GDR + S ++L   E+  C  LC         + +++LI  G+  
Sbjct: 92  MHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVV 151

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPAA +   +     YY +GF LGF D                          
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFMD-------------------------- 185

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGS 260
                      P+  KT    Y  NH  +V+ FH   N    IVG  V P S+       
Sbjct: 186 -----------PDTGKT----YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPG 230

Query: 261 CSRT--RKPLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYD------PQIQ 309
            S+T  +  +T+ ED +   Y  FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFH 290

Query: 310 WFS-------LIGFSVIVILLSSAVIHSLLRALKSDLTRYN------ELNLNNEFHEDAG 356
           W S       ++  S+I +++   V+H+      S+    N      E  LNN+ +    
Sbjct: 291 WMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNS 350

Query: 357 WKLSHGDVFRTPPKSML----LSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVM 412
             +   D  +     +     L VLV  G+Q    +I S+  +         R S+ T+ 
Sbjct: 351 VYMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMA 410

Query: 413 FLLYALFGFVGSYTS-----MGVYKFFHGPYWKANXXXXXXXXXX--------XXXXXXV 459
            L + +  F+ S+       +   + F+  Y+  N                        +
Sbjct: 411 ILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMI 470

Query: 460 AMNIFLL----FAH-SSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHK---------RC 505
            ++ FLL    +AH S+  +P K++ F I ++F+V IPLS  G ++A+            
Sbjct: 471 MISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGI 530

Query: 506 SWNEHPTKTNQIARQIPHQPWYLR--TTQATMVAGIFSFGSIAVELYFIYSSLWFNKI-- 561
           + +E  +K N++   +P  P            + G+F    I VE+ ++Y SLW  K   
Sbjct: 531 TIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTF 588

Query: 562 FYMFGFXXXXXXXXXXXXXXXXXXXXY--HSLCLENWL----WQWRSFIIGGLGCSIYMF 615
           +Y +GF                    Y     C E+ +    W+W+ F +G  G  +YM 
Sbjct: 589 YYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYME 647

Query: 616 IHSI--LFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672
           ++S+  +F    + GF ++++ + YS + +++C +  GA+ + ++  FI KIY+ VKV 
Sbjct: 648 LYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIYH-VKVN 705

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  143 bits (361), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 165/694 (23%), Positives = 282/694 (40%), Gaps = 115/694 (16%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           L P  Y   DE+ L+VN+                + SD     Y+Y        F  P  
Sbjct: 41  LQPNFYFQGDEVELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 80

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
           + K+P   SL  +I GDR + S + L+  ++  C  LC         +   +L+  G+  
Sbjct: 81  MHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVV 140

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPAA +   +  +  YY +GF LGF D          P+T +           
Sbjct: 141 QWLIDEELPAATTFISTIDQKKYYASGFPLGFVD----------PDTGK----------- 179

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGS 260
                                Y   H  +V+ ++    + + IVG  V P S+       
Sbjct: 180 --------------------VYLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPG 219

Query: 261 CSRTRKP--LTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYD------PQIQ 309
            S+  +P  + + E+ D+  +  FTYSV +     V W  RWD YL+  +       Q  
Sbjct: 220 ASKNYEPYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFH 279

Query: 310 WFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVF--RT 367
           W SL   + IV L+S  V   LLR+ KS      ++N + E      ++++   +   RT
Sbjct: 280 WISLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINERT 339

Query: 368 PPKSMLLSVLVGSGIQLFLMIICSIFFA-AFGLVSPISRGSLQTVMFLLYALFGFVGSYT 426
           P  ++L+ + V  G+Q    ++ S+  + +   +  I   S+ T+  L + L  F+ SY 
Sbjct: 340 PLANLLI-LFVSMGVQFLFTVLGSLTISCSLNKLHDIG-DSVLTMAVLCFVLGAFMSSYI 397

Query: 427 SMGVYKFFHGPYWKANXXXXXXXXXXXXXXXX----VAMNIFLLF-----AH-SSGVIPA 476
              + +  +    K                      + M + LL      AH S+  +P 
Sbjct: 398 GSVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPF 457

Query: 477 KSLFFIIFLWFVVSIPLSFVGSVLAHK---RCSWNEHPTKTNQIARQI------PHQPWY 527
           K++   I ++F+V IPLS +G  +A+    + S  +    T++   ++      P +  +
Sbjct: 458 KTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIF 517

Query: 528 L--------RTTQATMVAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXX 577
           L        +     +++GIF F  I VEL ++Y S+W  K   +Y +GF          
Sbjct: 518 LFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCI 577

Query: 578 XXXXXXXXXXYHSLCL---ENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLG--GFITV 632
                     Y  L +    N  W+W SF +G   C+ YM ++S+ +  F L   GF ++
Sbjct: 578 VVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSI 636

Query: 633 VLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
            + + Y  + + LC    G+I   +S  F+ K+Y
Sbjct: 637 FISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  142 bits (358), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 168/695 (24%), Positives = 275/695 (39%), Gaps = 124/695 (17%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           L P  Y   D + L+VN+                + SD     Y+Y        F  P  
Sbjct: 42  LRPNYYSKGDPVELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 81

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
           + K+P   SL  +I GDR + S + L   E+ +C  LC         +    L+ +G+  
Sbjct: 82  MHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVV 141

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPA  +   +     YY +GF LGF D                          
Sbjct: 142 QWLIDDELPAVTTFISTTDHKKYYASGFPLGFVD-------------------------- 175

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVS-IERSSPG 259
                      P   KT    Y   H  IV+ ++    + + I G  + P S ++   PG
Sbjct: 176 -----------PETGKT----YLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPG 220

Query: 260 SCSRTRK-PLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYD------PQIQ 309
           +     +  L + E+ D+  +  FTYSV +     V W  RWD YL+  +       Q  
Sbjct: 221 ASKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFH 280

Query: 310 WFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAG--------WKLSH 361
           W SL     IV L+SS     L R  K  ++R +  +++ E  +D G        W L+ 
Sbjct: 281 WISLANSFGIVFLISSITAVILYRTFK--ISRRSFSDISKE-EDDKGSIYVVARKWLLNE 337

Query: 362 GDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGF 421
               +TP  ++L+ + V  G+Q    ++ S+  +         R S+ T+  L +    F
Sbjct: 338 ----QTPLANVLI-IFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAF 392

Query: 422 VGSYTSMGVYKFFH----------GPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSS 471
           + S+T   + K               Y+                   + +N  +    S+
Sbjct: 393 MASFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDST 452

Query: 472 GVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIA---------RQIP 522
             +P  ++ F+I ++FVV IPLS +G  +A K  S N  P+ +  I          + I 
Sbjct: 453 HALPFGTVLFLISVYFVVCIPLSLLGGYIAVK--STNSKPSFSFSIGNYSDRIFVYKTIT 510

Query: 523 HQPWYL----RTTQATMVAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXX 576
             P  L     ++ A +  G+F F  I VEL ++Y SLW  K   +Y +GF         
Sbjct: 511 MSPSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLC 570

Query: 577 XXXXXXXXXXXY---HSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLG--GFIT 631
                      +   +S    +  W+W SF IG   C+ YM ++S+ +  F L   GF +
Sbjct: 571 IVICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSS 629

Query: 632 VVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           + + + Y  + +++C   TG+I   +S  F++KIY
Sbjct: 630 IFISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  140 bits (354), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 158/695 (22%), Positives = 277/695 (39%), Gaps = 116/695 (16%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           L P  Y   D + LLVN+                + SD   F   Y YY+    F  P  
Sbjct: 41  LQPNVYRWGDHVELLVNK----------------VESDLTQF--PYGYYD--LPFTCPPT 80

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
            +K+P   SL  +I GDR + S ++L+  ++  C ALC              L+  G+  
Sbjct: 81  EDKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPAA +   +     YY +GF LGF D          P+T             
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD----------PDT------------- 177

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPG 259
                             E  Y   H  +V+ ++    +++ IVG  V P S+ +   PG
Sbjct: 178 ------------------EKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPG 219

Query: 260 SCSRTRK-PLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLH------IYDPQIQ 309
           +     +  L + E+ D   Y  FTYSV +     V W+ RW+ +L+          +  
Sbjct: 220 ASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFH 279

Query: 310 WFSL---IGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366
           W +L   +G S +++L+  A ++ ++R      +   +   +     D+ + ++   + +
Sbjct: 280 WMTLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQ 339

Query: 367 TPPKSM---LLSVLVGSGIQLFLMIICSIFFA-AFGLVSPISRGSLQTVMFLL----YAL 418
           T   S+   +L++ V  G+Q    II S+ F+ +   +  I    L    F L    Y  
Sbjct: 340 TDSSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLW 399

Query: 419 FGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXX--XXXXXXVAMNIFLLFAHSSGVIPA 476
             FVG++  +       G   +                      +N  +    SS  +P 
Sbjct: 400 HLFVGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPF 459

Query: 477 KSLFFIIFLWFVVSIPLSFVGSVLAHK--RCSWNEHPTKTNQIARQIPHQPWYLRTTQAT 534
           +++   + ++FV+ IPLS +G  ++H+  R      P  ++  AR I  +P    TT A 
Sbjct: 460 RTIVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTLAP 517

Query: 535 --------------MVAGIFSFGSIAVELYFIYSSLWFNKI--FYMFGFXXXXXXXXXXX 578
                          + G   F  I VEL +IY S+W  K   +Y++GF           
Sbjct: 518 RKISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIV 577

Query: 579 XXXXXXXXXY-----HSLCLENWLWQWRSFIIGGLGCSIYMFIHSI--LFTKFKLGGFIT 631
                    Y     H        W+W+ F++G   C+ YM ++S+  +F   K+ GF +
Sbjct: 578 VCEVSFLGCYVMMRKHKRVATFDSWRWKCFMMGT-SCAWYMELYSLYYIFHTLKMTGFPS 636

Query: 632 VVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           + + + YS I +++C    G++G+ +S   + +++
Sbjct: 637 IFISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVF 671

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  135 bits (339), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 165/712 (23%), Positives = 284/712 (39%), Gaps = 130/712 (18%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           ++P  Y  ND + L+VN+                + SD     Y+Y  Y+    F  P  
Sbjct: 53  ITPNFYKKNDFLELIVNK----------------VESDLTQLPYAY--YD--LPFTCPPT 92

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
           + K+P   SL  +I GDR + S ++LR  E+  C  LC      +  + +++L+  G+  
Sbjct: 93  MHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVV 152

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPAA +   +     YY +GF LGF D                          
Sbjct: 153 QWLIDDELPAATTFISTTDHKKYYASGFPLGFVD-------------------------- 186

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPG 259
                      P+  KT    Y  NH  +V+ FH  G+D   +VG  V P S+ +   PG
Sbjct: 187 -----------PDTDKT----YLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPG 231

Query: 260 SCSRTRK-PLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYD------PQIQ 309
           +     +  + + ED  +  Y  FTYSV +     V W  RW+ +L+  +       Q  
Sbjct: 232 ASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFH 291

Query: 310 WFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYN-------------ELNLNNEFHEDAG 356
           W SL     IV+ +S       +R +++D    +             E +L+++ +    
Sbjct: 292 WMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNS 351

Query: 357 WKLSHGDVFRTPPKSM----LLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVM 412
             +   D  +     +    +L VLV  G+Q    II S+  +         R S+ T+ 
Sbjct: 352 VYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMA 411

Query: 413 FLLYALFGFVGSY--TSMGVY---KFFHGPYWKANXXXXX--------XXXXXXXXXXXV 459
            L + L  F+ S+  T +G+    +  +  Y   N                        V
Sbjct: 412 ILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMV 471

Query: 460 AMNIFLLF----AH-SSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHK---------RC 505
            +  FLL     AH S+  +P +++ F I ++FVV IPLS  G ++A+            
Sbjct: 472 MIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGI 531

Query: 506 SWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMF 565
           + +E     +++ +      +         + GIF    I VE+ ++Y SLW  K  + F
Sbjct: 532 TKDETDGNGSKLFKPKSRTRFNPLVHCGVYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYF 591

Query: 566 GFXXXXXXXXXXXXXXXXXXXXYHSL----CLENWL----WQWRSFIIGGLGCSIYMFIH 617
            +                       L    C ++      W+WR F +G  G  +YM ++
Sbjct: 592 FYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELY 650

Query: 618 SI--LFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYY 667
           S+  +F    + GF ++++ + YS + ++LC +  GA+   ++  FI +IY+
Sbjct: 651 SLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIYH 702

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  134 bits (337), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 173/717 (24%), Positives = 283/717 (39%), Gaps = 138/717 (19%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           ++P  Y   D + L+VN+                + SD     Y+Y        F  P  
Sbjct: 52  ITPNFYKKGDPLELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
           + K+P   SL  +I GDR + S + L   E+  C  LC         + +++L+  G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLVREGYVV 151

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPAA +   +     YY +GF LGF D                          
Sbjct: 152 QWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD-------------------------- 185

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPG 259
                      P+  KT    Y  NH  +V+ FH   ND   IVG  V P S+ +   PG
Sbjct: 186 -----------PDTGKT----YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPG 230

Query: 260 SCSRTRK-PLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYD------PQIQ 309
           +     +  + + ED +   Y  FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFH 290

Query: 310 WFSLIGFSVIVILLS--SAVIH--SLLRALK-SDLTRY--------NELNLNNEFHEDAG 356
           W S      IV+ +S  +AVI+   + R  K +D T+Y         E NL+++ +    
Sbjct: 291 WMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNS 350

Query: 357 WKLSHGDVFRTPPKSM----LLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVM 412
             +   D  +    +M    +L VLV  G+Q    +I S+  +         R S+ T+ 
Sbjct: 351 VYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMA 410

Query: 413 FLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXX-------------XV 459
            L + L  F+ S+    +         + N                             V
Sbjct: 411 ILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLV 470

Query: 460 AMNIFLL----FAH-SSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLA-------HKRCSW 507
            ++ FLL    +AH S+  +P +++ F I ++F+V IPLS  G  +A       H     
Sbjct: 471 MVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGI 530

Query: 508 NEHPTKTNQIARQIPHQPWYLRTTQATMV------AGIFSFGSIAVELYFIYSSLWFNKI 561
            +  T  N     +P      RT    +V       G+F F  I VEL ++Y S+W  K 
Sbjct: 531 TKDETCGNSSRLFVPRS----RTKFNPLVYCGIYLCGLFPFLVIYVELQYVYKSVWLEKT 586

Query: 562 --FYMFGFXXXXXXXXXXXXXXXXXXXXYHSL--CLENWL----WQWRSFIIGGLGCSIY 613
             +Y +GF                    Y  +  C E+      W+W+ F +G  G  +Y
Sbjct: 587 TFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVY 645

Query: 614 MFIHSI--LFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYA 668
           M ++S+  +F    + GF + ++ + YS + +++C +  G + + ++  FI KIY++
Sbjct: 646 MELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  134 bits (337), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 170/738 (23%), Positives = 276/738 (37%), Gaps = 175/738 (23%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           + P  Y  ND + ++VN+                I SD   F Y+Y  Y   F  C P +
Sbjct: 56  IRPNVYEENDPVEIIVNK----------------IESDLTQFPYAY--YELPFT-CPPTN 96

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQN 142
           V+K    SL  +I GDR + S + L   +++ C+ LC            + LI  G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 143 WLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGAT 201
           WL+D  LPAA +   ++    YY +GF LGF D                      + G T
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMD---------------------KDTGKT 195

Query: 202 LHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSC 261
                               Y  NH  +V+ +H    + + IVG+ V P S+        
Sbjct: 196 --------------------YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGA 235

Query: 262 SRTRKPLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYD------PQIQWFS 312
           S+      ++ +     Y  FTYS+ +     V W  RW+ +++  +       Q  W S
Sbjct: 236 SKNFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWIS 295

Query: 313 LIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSM 372
           L    VIV L++  V   L +++ +D T     +        + W + H  +        
Sbjct: 296 LANSVVIVTLMTLVVALILAKSVSTDETVSTSTS-----QVASQWVVQHSYLLNH----- 345

Query: 373 LLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVM--FLLYALFGFV-GSYTSMG 429
            L+V    G+Q    I+ S+  +        S   L  +    L  AL  F+ G+YTS  
Sbjct: 346 -LNVFTAMGVQFLFTILGSLIISC-------SMNKLHNIRNSVLTMALMCFISGAYTSS- 396

Query: 430 VYKFFHGPYWKANXXXXXXXXXXX-------XXXXXVAMNIFLLFAHSSGVIPAKSLFFI 482
               F G    AN                       + +N  +    S+  +P  ++  +
Sbjct: 397 ----FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLL 452

Query: 483 IFLWFVVSIPLSFVGSVLA---HKRC-----------------SWNEHPTKTNQIARQIP 522
           I ++F+V IPLS +G V A    ++C                  +++ P   N++   +P
Sbjct: 453 ITVYFIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKV--HLP 510

Query: 523 H------QPWYLRT-TQATMVAGIFSFGSIAVELYFIYSSLWFNKI--FYMFGFXXXXXX 573
                   P  LR     T+++GI  F  I VEL F+Y SLW  K   +Y++GF      
Sbjct: 511 RISGNSKLPLMLRQPVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIV 570

Query: 574 XXXXXXXXXXXXXXYHSL----------------------------------C---LENW 596
                         Y +L                                  C   L   
Sbjct: 571 LLCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMT 630

Query: 597 LWQWRSFIIGGLGCSIYMFIHSILF--TKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIG 654
            W+W+SF IGG   + Y+  +S+ +  T  K+  F +++L+  YS + + LC    GA+G
Sbjct: 631 QWRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALG 689

Query: 655 FFSSMIFIRKIYYAVKVE 672
           + S   F+ +I+   K E
Sbjct: 690 YLSCCWFVNRIHTNSKKE 707

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  132 bits (331), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 158/694 (22%), Positives = 268/694 (38%), Gaps = 133/694 (19%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           LSP  Y   D++ + VN+                + SD  HF  SY YY+  F     + 
Sbjct: 57  LSPNFYEYGDKVDITVNK----------------VESDLTHF--SYGYYDLHFTCPPSQD 98

Query: 84  VEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQNW 143
           ++  P +   +++G++ + S +QL   ++++CV LC     G   +    LI   +   W
Sbjct: 99  MKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQW 158

Query: 144 LVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGATL 202
           L D  LP A +  +++ K  YY +GF LG  D          P T E             
Sbjct: 159 LADDDLPGATTYLNTKDKKKYYSSGFPLGQYD----------PETDE------------- 195

Query: 203 HIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCS 262
                              Y  NH  IV+ +H        IVG  V P S+        S
Sbjct: 196 ------------------AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGAS 237

Query: 263 RTRKPLTLHEDRDNE----VYFTYSVKFVASATV-WATRWDKYLH---IYDPQIQWFSLI 314
           +   P  +  D  NE    + FTY+V +     V W  RW+ +++   + +     F  I
Sbjct: 238 KDYTPYKI--DPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWI 295

Query: 315 GFSVIVILLSSA--VIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSM 372
            F+  +I+ S    ++ ++L+  ++D +   +L         A W  +   +F       
Sbjct: 296 TFANGIIVTSCLLLIVIAILKRQETDGSITTQL--------AAEWSKARVPLF------F 341

Query: 373 LLSVLVGSGIQ-LFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVY 431
            L++LV  GI  LF  +   I   +      I    L   +FL  +     GS+TS  + 
Sbjct: 342 QLNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFIS-----GSFTSSFIG 396

Query: 432 KFFHGPYWK---ANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSLFFIIFLWFV 488
               G   +    N                + +N  L   +++  +P  ++  +   +F+
Sbjct: 397 ALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFI 456

Query: 489 VSIPLSFVGSVLAHKRCSWNEHPTKTNQIA----RQIPHQPWYLRTTQA----------- 533
           V +P+S +G   A +    N   T  N  A     +   +P Y+ +  +           
Sbjct: 457 VCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAI 516

Query: 534 TMVAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXYHSL 591
           T+  G+  F  I VEL F Y SLW  K  ++Y++GF                    Y  L
Sbjct: 517 TLTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHL 576

Query: 592 CLEN------W------------LWQWRSFIIGGLGCSIYMFIHSILFTKF--KLGGFIT 631
              N      W             W+W++F +GG   + YM  +SIL+  F  +   FI+
Sbjct: 577 NYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFIS 635

Query: 632 VVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKI 665
             L++ YS + ++LC    G++ + SS+ FI K+
Sbjct: 636 SFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  131 bits (329), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 158/682 (23%), Positives = 276/682 (40%), Gaps = 110/682 (16%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           L P  Y   D + L+VN +   I          DI          + YY+    F  P  
Sbjct: 41  LKPNVYSIGDPLELVVNTVESEI---------TDIP---------FGYYD--LPFTCPPT 80

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
            EK+P   SL  +I GDR + S ++L + ++  C  LC         +    LI SG+  
Sbjct: 81  PEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMV 140

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            W++D  LPAA +   +     YY  GF LG  D                          
Sbjct: 141 QWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD-------------------------- 174

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGS 260
                 P++ R          +F NH  +V+ ++   +D   IVG    P S+       
Sbjct: 175 ------PRSSRV---------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPG 219

Query: 261 CSRTRKPLTLHEDRDNEVYF---TYSVKFVASATV-WATRWDKYLH---IYDPQ---IQW 310
            S+  KP  + +    E+ +   TYSV +   A + W+ RW  Y++   + D       W
Sbjct: 220 ASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHW 279

Query: 311 FSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPK 370
            +L     IV+ ++  VI +L+   ++     NE  L ++ +ED+    +  + +    +
Sbjct: 280 MALANSVGIVLFVTFIVIVNLIMIFRNP----NE-QLESKENEDSSDIFNVANNWLRARQ 334

Query: 371 SMLLS---VLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYA----LFGFVG 423
              L+   V V  GIQ+  MI+  +  +         + S+ T+  L +     +  FVG
Sbjct: 335 GFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVG 394

Query: 424 SYTSM----GVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSL 479
           ++  M      Y F++  +                    +++N  +    S+  +P  ++
Sbjct: 395 TWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTM 450

Query: 480 FFIIFLWFVVSIPLSFVGSVLAHK--RCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVA 537
              +  +FVV I +S +G  +A +  R   ++ P  T    R++  +   +       +A
Sbjct: 451 VVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLA 510

Query: 538 GIFS----FGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXYHSL 591
           G+ S    F  I VEL ++Y S+W  K  ++Y++ F                       +
Sbjct: 511 GLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLM 570

Query: 592 CLENWL-----WQWRSFIIGGLGCSIYMFIHSILFTKF--KLGGFITVVLYLGYSFIMSV 644
            L +       W+WR F+I   GCS YM I+S+ +  F   + G   V + + YSFI +V
Sbjct: 571 KLNHKFINDQNWRWRCFVIST-GCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNV 629

Query: 645 LCCVVTGAIGFFSSMIFIRKIY 666
           LC + TG++G+ +S  F++KI+
Sbjct: 630 LCGLATGSLGYLTSSWFVKKIH 651

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  128 bits (321), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 168/718 (23%), Positives = 281/718 (39%), Gaps = 145/718 (20%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           ++P  Y   D + L+VN+                + SD     Y+Y  Y+  F  C P  
Sbjct: 51  VNPNLYKIGDHVELIVNK----------------VESDLTQLPYAY--YDLPF-ICPPTK 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
            EK+P   SL  +  GDR + S ++L    +  C  LC              L+  G+  
Sbjct: 92  -EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVT 150

Query: 142 NWLVD-GLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            WL+D  LPAA +   S     YY  GF +G+ D      D T               G 
Sbjct: 151 QWLIDESLPAATTFISSTNHNKYYAAGFPVGYVD------DRT---------------GK 189

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPG 259
           T                    +  NH  +V+ +H    + + IVG  V P S+ +   PG
Sbjct: 190 T--------------------FLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPG 229

Query: 260 SCSRTRKPLTLHEDRDNEVYF---TYSVKFVASATV-WATRWDKYLHIYD------PQIQ 309
           +     K   +  ++D+E+ F   TYSV +     V W  RW+ +L+  +       Q  
Sbjct: 230 ANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFH 289

Query: 310 WFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNE-----LNLNNEFHEDAGWKLSHGDV 364
           W S +  SV +  +++ ++  +L  + S   R +       NL  +  +D   K+S G V
Sbjct: 290 WMSFLN-SVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKIS-GSV 347

Query: 365 FRTP---------PKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLL 415
           F            P    L  L   GIQ    I+ S+  +         R ++ T+  + 
Sbjct: 348 FVNAKTWITVGKIPYWKALICLTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLIC 407

Query: 416 Y----ALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXV---------AMN 462
           +    A+ G++GS   +  Y+   G Y +                  +         ++N
Sbjct: 408 FICGAAISGYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSLN 465

Query: 463 IFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPT-------KTN 515
             +L   S+  +P K+  F++ ++FV  IPLS +G VLA   C  + + T       + N
Sbjct: 466 CIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNCKVDSYNTLKRITSLRRN 524

Query: 516 QIARQ------------------IPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLW 557
            I+R+                  I H  +   TT   +  G FSF  I VEL ++Y S+W
Sbjct: 525 TISRKSRSDFTKKVSLYQRLVFDIKHDSF---TTFGALAGGFFSFIIIWVELQYVYKSVW 581

Query: 558 FNKI--FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLEN-----WLWQWRSFIIGGLGC 610
             K   +Y +GF                    Y  L  +N       W W+SF++G   C
Sbjct: 582 LEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SC 640

Query: 611 SIYMFIHSILFTKFKLG--GFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           + YM ++S+ +  F L   GF ++ + + YS + + +C    G++ + +S + + +IY
Sbjct: 641 AWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY 698

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  124 bits (311), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 156/712 (21%), Positives = 279/712 (39%), Gaps = 139/712 (19%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           L+PT Y   D + ++VN+                I SD       Y YY+    F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNK----------------IESDATQL--PYGYYD--LPFTCPPT 72

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
           V+K+P   SL  VI GDR + S ++L   ++ EC  LC           +++ I   +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            W +D  LPAA +   +  +  YYG+GF LGF D      +ET               G 
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFVD------EET---------------GK 171

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGS 260
                                Y  NH  +V+ +H   + ++ IVG  + P S+   S   
Sbjct: 172 V--------------------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSV---SDYH 208

Query: 261 CSRTRKPLTLHE-------DRDNEVYFTYSVKFVASATV-WATRWDKYLHIYD------P 306
           C    K    +E       + D  + FTYSV +     V W  R++ +    +       
Sbjct: 209 CPGASKDYDQYEVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSR 268

Query: 307 QIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFR 366
           +  W SL   + I  L++  V  SL+    + +   N L    E  + + + ++    + 
Sbjct: 269 KFHWISLANSASIAFLMTFIV--SLIFIKITGIP--NRLETKKESPKASIFVIARNWFYD 324

Query: 367 TPP-KSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSY 425
             P    L   +V  G+     +I S+  +         R S+ T+  L + L  F+ S+
Sbjct: 325 DRPVMPHLFICIVSMGVHFLFTVIGSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMASF 384

Query: 426 TSMGVYKFFHGPYWKANXXXXXXXXXX------------XXXXXXVAMNIFLLFAHSSGV 473
               +    +    +                              + +N  +    S+ V
Sbjct: 385 VGGTLLIENNKLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNV 444

Query: 474 IPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHP------------TKTNQI---- 517
           +P  ++  ++F++F+V IPLS +G  +A  + S  E+             T+ N+I    
Sbjct: 445 LPFATIMKLLFIYFIVCIPLSVLGGSIAANKDS-EEYSRLRSDSIKRISRTRANKIMDED 503

Query: 518 -------ARQIPHQ-PWYLR-------TTQATMVAGIFSFGSIAVELYFIYSSLWFNKI- 561
                   R++ ++  W L+       T  + + +GIF F  I VEL F+Y S+W+ K  
Sbjct: 504 QGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTT 563

Query: 562 -FYMFGFXXXXXXXXXXXXXXXXXXXXYHSLCLENW----LWQWRSFIIGGLGCSIYMFI 616
            +Y +GF                    Y  + + +      W+W++F +    C+ YM  
Sbjct: 564 FYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEA 622

Query: 617 HSI--LFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIY 666
           +SI  +F    +  F ++++ + YS + + LC +  G+IG+ +S+ F++++Y
Sbjct: 623 YSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVY 674

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score =  117 bits (294), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 168/677 (24%), Positives = 274/677 (40%), Gaps = 105/677 (15%)

Query: 40  NRLTPSIYFQHQDEN--GNDISSDKEHFLYSYDYYNERFHFCRPEHVEKQP--ESLGSVI 95
           NRLTP+IY +  D     N I SD       Y YY+  F  C P + +++P   SL  ++
Sbjct: 35  NRLTPNIYRKGDDVELIVNKIESDLTKL--PYGYYDLPF-ICPPTN-QRKPLHMSLTEIL 90

Query: 96  FGDRIYNSPFQLRMLEEKECVALC-KGTIPGRDAEFINRLIISGFFQNWLVDG-LPAARS 153
            GDR + S + L   ++ +C  LC + T P    + IN L+   +   W +D  LPA+ +
Sbjct: 91  RGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQWSIDNDLPASTT 149

Query: 154 VYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGATLHIRSPKNIRPN 213
              +     YY  GF LGF D          P+T                          
Sbjct: 150 FISTSENRKYYIPGFSLGFVD----------PDT-------------------------- 173

Query: 214 PVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHED 273
                E  Y  NH  +V+ +H   ++ + IVG+ V P S+        SR  +   L  +
Sbjct: 174 -----ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVAN 228

Query: 274 RDNEVY---FTYSVKFVASATV-WATRWDKYLH-------IYDPQIQWFSLIGFSVIVIL 322
            D EV    FTYSV +     V W  R+  + +       I D + +W  L   S + + 
Sbjct: 229 DDEEVTYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITD-KFRWILLANSSGLALF 287

Query: 323 LSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGI 382
           +S  V    LR  K +    + +       +    K    D  RT   + L+ VLV  G+
Sbjct: 288 ISMIVSVIFLRISKKNKNENSAIESKKGSMDVIARKWLRND--RTIHFNFLI-VLVSFGV 344

Query: 383 QLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKAN 442
                ++ S+  +         R S+ T++ L + L GF+ S+    +    +   +K +
Sbjct: 345 HFAFTLLGSLAISCSLQKFDNIRNSVLTLVLLFFVLGGFMASFVGTCLIMQKNKTMYKGS 404

Query: 443 XXXX------XXXXXXXXXXXXVAMNIFL---LFAH-SSGVIPAKSLFFIIFLWFVVSIP 492
                                 + + IFL   ++AH SS  +P K++ F+I ++F+V IP
Sbjct: 405 LKRLHYSPLFAMCCGSLLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIP 464

Query: 493 LSFVGSVLAHKRC-----------SWNEHPTKTNQIARQIP---HQPWYLRTTQATMVAG 538
           LS +G   A   C           +  +     + +AR I      P+   +     + G
Sbjct: 465 LSLLGGSYASDICQKRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPF---SGLLASIGG 521

Query: 539 IFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXY---HS--L 591
           +F F  I VEL  +Y  +W  K   +Y+  F                    Y   HS   
Sbjct: 522 LFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRS 581

Query: 592 CLENWLWQWRSFIIGGLGCSIYMFIHSI--LFTKFKLGGFITVVLYLGYSFIMSVLCCVV 649
            LEN  W+WRSF I    C+ YM ++S+  +F      GF +++L +  S + + LC   
Sbjct: 582 SLEN-SWRWRSFQISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCA 639

Query: 650 TGAIGFFSSMIFIRKIY 666
            G+IG+ ++  F+ ++Y
Sbjct: 640 LGSIGYLATCWFVGRVY 656

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 141/590 (23%), Positives = 219/590 (37%), Gaps = 136/590 (23%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           + P  Y   D++ L VN++        + E  N            Y YY+ RF  C P  
Sbjct: 44  IKPNVYKRGDKVDLTVNKV--------ESEITN----------LPYGYYDLRF-VCPPSE 84

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLRMLEEKECVALC-KGTIPG--RDAEFINRLIISGF 139
            +K    SL  VI GDR + S + L     ++C  LC + T+P   R A+   RLI   +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQAD---RLIRENY 141

Query: 140 FQNWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNA 198
             +WL+DG LPAA +   +R+   +Y  GF LG  D               E D      
Sbjct: 142 MVHWLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD--------------HETD------ 181

Query: 199 GATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSP 258
              LH                     NH  +V+ +     + Y IVG  V P S+     
Sbjct: 182 KTHLH---------------------NHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQC 220

Query: 259 GSCSRTRKPLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLH----IYDPQIQ-- 309
              S++ +P  ++ +     Y  FTYSV +   + + W+ RW+ +      + +  +   
Sbjct: 221 PGASKSFEPYVINTEETEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFF 280

Query: 310 -WFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTP 368
            W SL   +++V L++  +    L+    D        L  E+     + L+        
Sbjct: 281 YWISLANSAIVVALMTLFIALIFLKIRADDFVG----TLAFEWASQPVYYLTQ------- 329

Query: 369 PKSMLLSVLVGSGIQ-LFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTS 427
                L++    GIQ LF +I  S    +   V  I    L T      A+   +G+YTS
Sbjct: 330 -----LNLAASMGIQFLFSIIGSSTISCSLCKVHNIRSWELSTA-----AICFVLGAYTS 379

Query: 428 MGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLL---FAHSSGVIPAKSLFFIIF 484
             V      P  K N                V + +F        SS  +P  +L  ++ 
Sbjct: 380 SLVGSLL-APGPKMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLT 438

Query: 485 LWFVVSIPLSFVGSVLAHKRCS-------------------------WNEHPTKTNQIAR 519
            +FV+ +PLSF+G   A K  S                         +N  P    +   
Sbjct: 439 SYFVICLPLSFLGGFSARKLRSAPANGLNYEQSKVPFSFLLSIEYHEYNLLPAGQEKEIP 498

Query: 520 QIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGF 567
            I   P+ L     T+V G   F     EL F+Y SLW  K  ++ ++GF
Sbjct: 499 AILSNPFLL-----TIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGF 543

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 40/67 (59%), Gaps = 3/67 (4%)

Query: 598 WQWRSFIIGGLGCSIYMFIHSILFTKF--KLGGFITVVLYLGYSFIMSVLCCVVTGAIGF 655
           W+W++F+ G    + Y  ++S+ +  F   L  F +++L++ Y+ + +++C    GA+G+
Sbjct: 619 WRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGY 677

Query: 656 FSSMIFI 662
            + + F+
Sbjct: 678 LTCLWFL 684

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/352 (22%), Positives = 141/352 (40%), Gaps = 78/352 (22%)

Query: 5   IWLALLSYIPV---AKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSD 61
           +W  L    PV   ++++    + P  Y   D++ +++N++                   
Sbjct: 18  LWTVLRPKRPVTRFSQSYDFGWIKPNVYKKGDKVDVIINKVV------------------ 59

Query: 62  KEHFLYSYDYYNERFHFCRPEHVEKQPE--SLGSVIFGDRIYNSPFQLRMLEEKECVALC 119
            E   + Y YY+ +F  C P   +K+P   SL  +I GDR + S + L   E  +C+ LC
Sbjct: 60  SETARFPYGYYDLQF-VCPPSD-KKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLC 117

Query: 120 KGTIPGRDAEFINRLIISGFFQNWLV-DGLPAARSVYDSRTKTNYYGTGFELGFTDVIQT 178
                    +  + LI  G+  +WL+ D LPAA +   +++   +Y  GF LG       
Sbjct: 118 DRKTKPEGLKQADALIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLG------- 170

Query: 179 VGDETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGN 238
                        ++DA      L+                     NH  +VV +     
Sbjct: 171 -------------EVDAVTGKTRLY---------------------NHLMLVVRYQTVDV 196

Query: 239 DSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVY--FTYSVKFVASATV-WAT 295
           + + I+G  V P S+  +     ++  +P  ++ +     Y  FTYS+ +   + + W+ 
Sbjct: 197 NKHTIIGFEVYPKSVSDAHCPGANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSH 256

Query: 296 RWDKYLH-------IYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLT 340
           RW+ ++H              W SL   S IV++L S  I ++   +K+D T
Sbjct: 257 RWNFFIHDDTSSHSKRQSLFHWISLAN-SAIVVVLMSLFIATIFVKIKNDDT 307

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 55/136 (40%), Gaps = 32/136 (23%)

Query: 459 VAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHK--------------- 503
           + +N  +    SS  IP  ++   +  +F++S PLS +G   A K               
Sbjct: 409 LVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAKLAPANAISK 468

Query: 504 -------RCSWNEHPTKTNQIARQIP---HQPWYLRTTQATMVAGIFSFGSIAVELYFIY 553
                    S++        + +  P     P  L     T++AGI  F  I VEL+++Y
Sbjct: 469 SPFSFLLTLSYDTRSWPATALGKPFPIALSNPILL-----TILAGIAPFVVICVELFYVY 523

Query: 554 SSLWFN--KIFYMFGF 567
            S+W      +Y++GF
Sbjct: 524 KSMWLQTTNFYYLYGF 539

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 598 WQWRSFIIGG-LGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFF 656
           W+W+SF+ GG +   + ++    L     L    +++L++ Y+ + + +C    GA+G+ 
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYL 674

Query: 657 SSMIFIRKIYYAVKVE 672
           S + F+  I  + K  
Sbjct: 675 SCLWFLSHISSSSKAH 690

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 156/718 (21%), Positives = 268/718 (37%), Gaps = 157/718 (21%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           + P  Y   +E+ +L+N++               +    E    SY YY+ +F  C P  
Sbjct: 40  VRPRIYQDGEEVEMLLNQV---------------VGKPGE---LSYGYYDLQFT-CTPTK 80

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLRMLEEKECVALC-KGTIPGRDAEFINRLIISGFFQ 141
             +    SL  V  GDR + S ++L    E +C  LC + T P    E  + LI   +  
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE-ADSLIRQNYTV 139

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
             L+D  +PA+++    R    YY  GF LGF D          P T             
Sbjct: 140 QLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD----------PET------------- 176

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPG 259
                             ++ Y  NHF +V+ ++    + Y IVG  V P S+ +   PG
Sbjct: 177 ------------------DVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPG 218

Query: 260 SCSRTRKPLTLHEDRDNEVY--FTYSVKFVASATV-WATRWDKYLHIYDPQIQ---WFSL 313
           S S+  +   ++    + V+   TYSV +     V W  RW+ YL   D  +     F  
Sbjct: 219 S-SKDYENYAVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVNKSLCFRG 277

Query: 314 IGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSML 373
           I  +++ I+L+       L +L   ++R   L   + F       ++   V R  P  + 
Sbjct: 278 IKVTMVFIILT-------LMSLAIIVSRLG-LGTGSMFIT----AVASEWVRRGAPCLLF 325

Query: 374 LSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTV---MFLLYALFGFVGSYTSMGV 430
           L+  V  GIQ+       IF A   L+   S G L  +   +  + AL    G + S   
Sbjct: 326 LNTFVSMGIQV-------IFAAPATLLLICSMGKLHNISNFLVCIAALCYMTGIFMSAFG 378

Query: 431 YKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVI------PAKSLFFIIF 484
                G                      + + + +L    + +I      P + +  ++ 
Sbjct: 379 GILLSGNLLDNKAQIRKYSVLYGSALPALTVAVLVLANSIAWIIERGKEMPFRDITLLLA 438

Query: 485 LWFVVSIPLSFVGSVLAHKRCSWNEH----------------PTK-------------TN 515
           L+F+VS+PLS +G   A  +   ++H                P+K             T 
Sbjct: 439 LYFMVSLPLSLLGGTSASYKLK-DQHFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTP 497

Query: 516 QIA-RQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFN--KIFYMFGFXXXXX 572
             A  QIP   W  +    T + GI  F +I +++ FI+  LW +   +F ++       
Sbjct: 498 ACAHEQIPM--WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGM 555

Query: 573 XXXXXXXXXXXXXXXY--------HSLCLENWL-----------WQWRSFIIGGLGCSIY 613
                          Y           C ++             W+W++F +GG   + Y
Sbjct: 556 ILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKAFYMGG-AAAWY 614

Query: 614 MFIHSILFTKF--KLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAV 669
              +S+ +  F  +L  F +++LYL Y  +++V      G+IG+ +   F+ K+ Y +
Sbjct: 615 WEAYSLYYMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCWFLNKLTYKI 672

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 116/537 (21%), Positives = 194/537 (36%), Gaps = 127/537 (23%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           + P  Y   D++ +  N+  P           +D +  +    Y YD       F  P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP-----------DDPAVSQPALCY-YD-----LPFVCPPS 102

Query: 84  VEKQP--ESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQ 141
             K+P   SL  +  GD +  S + L   +++ C  LC      +  +    LI + +  
Sbjct: 103 DTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 142 NWLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGA 200
            W VD  LP   +   ++     Y  GF LG+ D           N   +A         
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD-----------NQTGQA--------- 202

Query: 201 TLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPG 259
                                Y   H   VV +H   +D++ IVG+ V P SI + + PG
Sbjct: 203 ---------------------YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPG 241

Query: 260 SCSRTRKPLTLH--EDRDNEVY--FTYSVKFVASATV-WATRWDKY------LHIYDPQI 308
           + S+   PL +   E+ D+  Y  F+YSV +     + W  RWD +      L   D   
Sbjct: 242 A-SKDFIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSF 300

Query: 309 QWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTP 368
            W+SLI  + I +     VI  L   +  +  R     L N+  +     ++     R P
Sbjct: 301 HWYSLINSNSITV----GVITFLCLVISMNRMRI----LYNKSWKKRQLSITTTTTTRYP 352

Query: 369 PKSMLLSVLVGSGIQLFLMIICSI--------------------FFAAFGLVSPISRGSL 408
               + ++ + SGIQ F ++I S+                    FF AFG++  +  G+L
Sbjct: 353 N---IFTICITSGIQFFFLLISSVLITFQISKFHQIKDTIIVALFFIAFGIIVSVFIGTL 409

Query: 409 QTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFA 468
               F+L                  F   Y+  N                  +N  +  +
Sbjct: 410 IQRTFILTN----------------FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLS 453

Query: 469 HSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQP 525
             +   P K   +    +F++SIPLS +  VL+ +  S+ ++P      +R +P  P
Sbjct: 454 EKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRFISFPKYP------SRSLPTSP 504

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 112/506 (22%), Positives = 196/506 (38%), Gaps = 88/506 (17%)

Query: 26  PTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEHVE 85
           P TY   D + ++VN++      Q +D  G+           SY Y++  +  C P + +
Sbjct: 48  PNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG------VSYKYHDLPY-ICPPTNTK 95

Query: 86  KQ-PESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQNWL 144
           K    SL  +  GD    S + L+   + +C ALC              +I   +  NW 
Sbjct: 96  KSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVNWF 155

Query: 145 VDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGATLH 203
           +D  LPAA +   S T+   Y  GF LG+ D          P T                
Sbjct: 156 IDDYLPAATTYISSVTRKKKYFEGFSLGWKD----------PETGSY------------- 192

Query: 204 IRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSR 263
                             Y  NH  +V+ ++   ++ + IVG  V P SI         R
Sbjct: 193 ------------------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARR 234

Query: 264 TRKPLTLHEDRDNEVY----FTYSVKFVASATV-WATRWDKY-------LHIYDPQIQ-- 309
                 L +  +N+ +    F+YSV +       W TRW  +       L   D  +Q  
Sbjct: 235 GHGHYELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLG 294

Query: 310 -------WFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHG 362
                  W+S   ++ ++I     ++  L+  L  D+  +  + ++N       W  +  
Sbjct: 295 FISNLLHWYS--PYTTVIIF---TILLFLVSLLVLDINSHKLVFMSNP-KTVIAWATTAN 348

Query: 363 DVFRTPPKSMLLSVLVGSGIQ-LFLMIICSIFFAAFGLVSPISR-GSLQTVMFLLYALF- 419
            + +T  K++LL++LV  G Q LF+ +   +  ++   +  IS    LQ + ++  +L  
Sbjct: 349 KLNKTW-KNILLNILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLV 407

Query: 420 -GFVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAM-NIFLLFAHSSGVIPAK 477
             FVG++  M +++    P +                   V + N    F   +   P +
Sbjct: 408 GSFVGTWLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFR 467

Query: 478 SLFFIIFLWFVVSIPLSFVGSVLAHK 503
            L ++IF++F+ SIP+S +G  LA K
Sbjct: 468 KLSWLIFVYFIFSIPMSLIGGSLAVK 493

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 113/576 (19%), Positives = 213/576 (36%), Gaps = 105/576 (18%)

Query: 24  LSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEH 83
           L P  Y   D + LLVN+   ++            ++D    L  Y Y++  F  C P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL------------NAD----LKPYIYHDLPF-VCPPTS 89

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQN 142
           V K       S+  GD +  S ++L+  ++ EC  LC              +I   +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 143 WLVDG-LPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGAT 201
           W +D  LP +     + T+   Y  GF LG                    D D +     
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLG------------------RFDKDKNKV--- 188

Query: 202 LHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSI-ERSSPGS 260
                               Y  NH  +V+ ++   +D + IVG  V   S+ +   PG+
Sbjct: 189 --------------------YLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGA 228

Query: 261 CSRTRK-PLTLHEDRDNEVY--FTYSVKFVASATV-WATRW---DKYLHIYDPQIQWFSL 313
                +  L + E+ D+  +  FTYSV +     + W +RW   D  +   DP++   S+
Sbjct: 229 SKNYEEYELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKLINKSM 288

Query: 314 IG----------FSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGD 363
           +           F + +I+ S  ++  +    K+  T   +L           W  S+  
Sbjct: 289 LSNIMQPTRTGLFLLPLIIFSIIIVKVVENGEKNKFTTEAQL-------ASKCWIESNNI 341

Query: 364 VFRTPPKSMLLSVLVGSGIQ-LFLMIICSIFFAAFGLVSPISRGSLQTV-MFLLYALFG- 420
             ++   + +L++++  G+Q +F +I   I   +   +  IS   L  + ++ +  +   
Sbjct: 342 NLKSSFSASILTLVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILAS 401

Query: 421 -FVGSYTSMGVYKFFHGPYWKANXXXXXXXXXXXXXXXXVAMNIFLLFAHSSGVIPAKSL 479
            F+G++  M +       Y                      ++  +    SS   P K+L
Sbjct: 402 SFLGTWLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTL 461

Query: 480 FFIIFLWFVVSIPLSFVGSVLAHK-RCSW----------NEHPTKTNQIARQIPHQPWYL 528
             +I  ++++ +P S +G  LA K R  +          NE+     +   +  H+P  +
Sbjct: 462 TMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSI 521

Query: 529 RTTQA-----TMVAGIFSFGSIAVELYFIYSSLWFN 559
              +      +++  I  F  I  ELY+I+++ W N
Sbjct: 522 NKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLN 557

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 96/279 (34%), Gaps = 65/279 (23%)

Query: 25  SPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFHFCRPEHV 84
            P+ Y   + + LLV+                +I +D+E     + YY   F    P   
Sbjct: 38  QPSAYTRGERVQLLVD----------------NIWTDRE----VWGYYETLFTCPPPAEA 77

Query: 85  EKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIISGFFQNWL 144
                SLG V   +  + S + L +  E +C  LC   +       + ++I  G    W 
Sbjct: 78  RAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWT 137

Query: 145 VDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDASNAGATLHI 204
           +DGLPAA + Y  R  +  Y  GF+LG                    ++DA      LH 
Sbjct: 138 LDGLPAA-TTYPDRQSSYRYEAGFKLG--------------------EVDAETGHVRLH- 175

Query: 205 RSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRT 264
                               NH  +VV +    +  Y IVG    P S+           
Sbjct: 176 --------------------NHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTE 215

Query: 265 RKPLTLHEDRDNEVY--FTYSVKF-VASATVWATRWDKY 300
            +   L+ D    +   FTY+V +   SA  W  RW  Y
Sbjct: 216 YEHFWLNPDAQAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,926,299
Number of extensions: 3042949
Number of successful extensions: 10184
Number of sequences better than 10.0: 49
Number of HSP's gapped: 10218
Number of HSP's successfully gapped: 84
Length of query: 672
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 556
Effective length of database: 40,180,143
Effective search space: 22340159508
Effective search space used: 22340159508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)