Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.2433.190ON1651658091e-112
Suva_4.2393.190ON1651657501e-103
Smik_4.2243.190ON1651657411e-101
YDL008W (APC11)3.190ON1651657331e-100
ZYRO0A04906g3.190ON1601654531e-57
TDEL0H033703.190ON1531654303e-54
Kpol_1045.683.190ON1761764141e-51
SAKL0C10516g3.190ON1441653694e-45
KAFR0A012403.190ON1731643681e-44
AER016C3.190ON1471633616e-44
KLTH0G16082g3.190ON1351283572e-43
Ecym_53123.190ON1481633573e-43
Kwal_56.231123.190ON1351673502e-42
TPHA0H006403.190ON1801853524e-42
CAGL0I04576g3.190ON1491513495e-42
KNAG0J012503.190ON2021453441e-40
NDAI0A065203.190ON2061423423e-40
TBLA0A002603.190ON1841493264e-38
KLLA0E17711g3.190ON1621502922e-33
NCAS0I019203.190ON1281122624e-29
KLTH0F19228g3.28ON110671107e-07
KAFR0C017803.28ON118671073e-06
SAKL0C13178g3.28ON138671074e-06
Ecym_20293.28ON1141061046e-06
YOL133W (HRT1)3.28ON121671049e-06
Smik_15.203.28ON121671039e-06
TPHA0I005908.799ON1591621081e-05
NDAI0G038603.28ON123671031e-05
Skud_15.203.28ON121671031e-05
ADL181W3.28ON108671011e-05
Suva_15.263.28ON122671022e-05
Kwal_55.220543.28ON111671002e-05
ZYRO0C03058g3.28ON116671003e-05
NCAS0C044803.28ON109106984e-05
KLLA0C14344g8.799ON1518471044e-05
Kpol_1014.163.28ON10767984e-05
KNAG0A012803.28ON114106977e-05
NDAI0K007108.799ON159162991e-04
TBLA0I019603.279ON18474972e-04
Kpol_480.258.799ON157162992e-04
CAGL0E01567g3.28ON10267923e-04
SAKL0B06226g8.799ON155762973e-04
TDEL0B009808.799ON155962973e-04
TPHA0P014703.28ON11167923e-04
TBLA0D006508.799ON156862974e-04
KAFR0B036208.799ON156062964e-04
TDEL0A004703.28ON11867914e-04
NCAS0C006808.799ON156462964e-04
Suva_13.4328.799ON155962956e-04
YMR247C (RKR1)8.799ON156262956e-04
Skud_13.4198.799ON156462956e-04
Smik_13.4608.799ON156662956e-04
TBLA0B087103.28ON12267906e-04
KNAG0J005408.799ON156162957e-04
ZYRO0F12760g8.799ON155555957e-04
KLTH0E13992g8.799ON155062947e-04
Kwal_27.123278.799ON157462930.001
Ecym_74188.799ON154763920.002
KLLA0E07151g3.28ON11067870.002
ABL058C8.799ON154640890.003
KLTH0F18502gsingletonON26749880.004
AGL079C2.542ON50647870.006
NCAS0A082803.279ON11868830.006
Ecym_26583.279ON15943840.007
TPHA0C042502.542ON55664860.008
CAGL0H02651g8.799ON154462860.009
Ecym_42508.317ON65770850.009
AGR034W3.279ON15950830.011
ZYRO0B02244g2.542ON56362840.013
KNAG0A074303.405ON10231800.015
YDR143C (SAN1)8.317ON61054830.019
CAGL0H10274g3.279ON17565810.021
TBLA0G023102.542ON67464830.022
ZYRO0E06996g3.279ON17251810.023
Skud_4.4028.317ON61254820.026
KAFR0I020901.389ON146644820.027
KLLA0F18458g3.279ON14064780.034
NDAI0A074503.279ON17345790.035
TPHA0C042602.545ON75786810.038
Ecym_72442.542ON53247800.039
Ecym_26848.808ON38658800.040
Kpol_1036.668.317ON66828810.040
Smik_2.1963.279ON18541790.041
YBR062C3.279ON18053780.047
Kpol_1052.193.279ON10350760.050
Kwal_27.104198.808ON30055790.053
Smik_4.3878.317ON63454800.053
TBLA0F032803.405ON55555790.055
Suva_2.3048.317ON62456790.059
Kwal_27.105463.279ON10443750.059
Kwal_55.21206singletonON27562780.062
Kpol_1023.322.411ON117860790.063
Suva_4.3023.279ON15041770.063
TDEL0A031802.542ON56759790.067
SAKL0H15686g8.317ON59936790.069
KLLA0E07019g7.416ON27954770.081
KAFR0A019902.542ON56055780.081
CAGL0K02563g2.542ON58655780.083
KNAG0C056602.542ON50755780.089
TPHA0A039903.279ON17562760.096
NCAS0C033108.317ON57056770.10
AGL217W8.808ON41466770.10
YHL010C (ETP1)2.542ON58549770.10
Skud_12.992.411ON117169770.11
Skud_8.352.542ON58549770.11
Suva_8.422.542ON58549770.11
TDEL0C027707.416ON20873760.11
Smik_8.322.542ON58549770.12
KAFR0F007402.157ON51046760.14
TPHA0F018402.157ON52141760.14
SAKL0H17116gsingletonON54436760.15
SAKL0A09746g2.542ON54856760.15
YOL138C (RTC1)3.22ON134155760.16
TBLA0B012602.157ON88534760.16
SAKL0D02354g8.808ON33155750.16
CAGL0L03960g2.157ON60353750.18
NCAS0G025202.157ON51841750.21
NDAI0B018202.542ON62547750.21
TPHA0B036501.389ON157649750.22
YLR032W (RAD5)2.411ON116941750.24
KLTH0D07150g2.542ON54047740.24
ZYRO0B16258g2.157ON57932740.25
NDAI0G026308.317ON66128740.25
SAKL0E10824g2.157ON47541740.27
Kpol_1048.731.389ON154997740.28
Skud_2.1863.279ON17859720.30
Suva_10.1122.411ON116769740.30
KLTH0C05258g3.279ON15243710.33
NDAI0G052001.389ON158632730.36
TPHA0C008508.317ON78128730.37
Kpol_1002.82.542ON55847730.38
KAFR0C004603.279ON15755710.38
Skud_8.1762.157ON41341720.42
Suva_11.1892.545ON75858730.43
KAFR0B014602.545ON76158730.43
Smik_15.163.22ON132655730.43
TDEL0B052002.157ON52445720.46
Smik_11.2132.545ON75958720.49
Suva_15.3112.157ON26941710.50
TDEL0F044408.317ON55432720.51
KLTH0E09834g2.157ON47941720.53
KLTH0C04664g8.808ON30652710.57
ACR267C2.157ON46783710.61
KLLA0F25740g2.542ON51746710.62
Smik_13.4398.761ON103049710.62
Kwal_47.179042.157ON47041710.64
Kpol_1002.72.545ON75458710.65
KNAG0H035102.157ON55141710.65
KLLA0E04071g8.317ON70427710.66
KNAG0A060302.411ON115060710.68
Suva_13.4158.761ON102849710.70
TDEL0D034603.279ON14441690.70
CAGL0E01441g8.317ON71728710.74
TBLA0A039008.317ON69861710.74
KLLA0C15697g3.405ON30456700.78
YKL034W (TUL1)2.545ON75836700.81
NCAS0A04680singletonON27427700.84
CAGL0K08052g3.405ON30597700.84
KNAG0G023908.317ON68828700.89
CAGL0L01947g2.545ON75758700.91
SAKL0E04488g2.411ON112748700.93
Kwal_55.220763.22ON128653700.94
TDEL0B061701.389ON147093700.97
Kpol_505.182.157ON58534700.98
NCAS0A125502.542ON57247691.0
SAKL0D03058g3.279ON15542681.1
TBLA0C013301.389ON145227691.2
TPHA0F007204.129ON128335691.3
YHR115C (DMA1)2.157ON41641681.3
NCAS0A047602.545ON76136691.3
TPHA0J015708.761ON101848691.3
CAGL0G03553g7.416ON21054671.4
Kpol_1030.298.761ON101691691.4
Skud_15.163.22ON133255691.5
Kwal_26.80902.542ON52047681.5
Smik_8.1932.157ON41632681.5
NCAS0B069902.157ON52139681.5
Kwal_56.239008.317ON58956681.5
Ecym_54453.405ON32127681.6
KNAG0A070902.545ON76236681.7
CAGL0A03432g2.411ON115168681.7
Suva_16.4203.405ON29060671.7
Ecym_24906.332ON46567681.8
YLR247C (IRC20)1.389ON155691681.8
Ecym_30056.3ON873114681.9
Suva_1.694.129ON127134681.9
TBLA0I014902.545ON75036672.0
NDAI0K018102.545ON76230672.0
KAFR0B034208.761ON103648672.0
Suva_15.223.22ON133655672.1
KAFR0B030708.317ON64328672.1
Kpol_1035.506.45ON60142672.1
ZYRO0G13376g8.808ON44534672.2
Skud_15.1486.45ON54835672.2
Ecym_54282.157ON47438662.5
TDEL0G042506.45ON51727662.6
TPHA0A033403.405ON384135662.6
NDAI0F027702.157ON55432662.7
YMR231W (PEP5)8.761ON102949662.7
Smik_12.942.411ON117859662.8
NCAS0A113503.405ON42827662.8
Skud_1.604.129ON127534663.5
Smik_1.664.129ON127235653.7
Kpol_538.53.405ON33546653.7
TBLA0E013004.129ON144052654.0
TBLA0B005606.45ON49235654.0
YOL013C (HRD1)6.45ON55135644.5
AFR220W2.411ON108571654.6
YIL147C (SLN1)5.700ON122066654.8
KLTH0E02464g5.628ON32938644.8
NCAS0B009908.808ON39265644.9
KNAG0J008503.279ON16255634.9
Suva_15.1596.45ON55035645.3
YBR114W (RAD16)3.368ON79086645.8
TBLA0H002303.22ON133342645.8
Skud_4.6845.509ON89138645.8
TDEL0C054203.405ON9327605.9
YAL002W (VPS8)4.129ON127418646.1
NCAS0A041202.411ON113766646.2
NCAS0I010503.368ON772113636.5
KLTH0F11044g3.405ON29146636.8
YPR093C (ASR1)3.405ON28849636.9
Smik_15.1576.45ON55027637.0
Skud_11.1922.545ON75836637.0
TPHA0A030307.318ON369110637.3
KLLA0C05874g6.45ON55355637.4
Kwal_26.80992.545ON75058637.4
Kpol_1003.132.245ON32443627.5
ZYRO0C17424g3.405ON27348627.6
Skud_13.4008.761ON103037637.7
Skud_16.3793.405ON28846627.8
ABR104W3.405ON32827627.9
KAFR0D016708.808ON35740628.2
Suva_14.2232.157ON58038628.6
NDAI0E004408.808ON41632628.6
TBLA0B026708.808ON47836628.8
KLTH0D07216g2.545ON74736629.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.243
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   316   e-112
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   293   e-103
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   290   e-101
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   286   e-100
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   179   1e-57
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   170   3e-54
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   164   1e-51
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   146   4e-45
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   146   1e-44
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   143   6e-44
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   142   2e-43
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   142   3e-43
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   139   2e-42
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   140   4e-42
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   139   5e-42
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   137   1e-40
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   136   3e-40
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   130   4e-38
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   117   2e-33
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   105   4e-29
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    47   7e-07
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    46   3e-06
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    46   4e-06
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    45   6e-06
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    45   9e-06
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    44   9e-06
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    46   1e-05
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    44   1e-05
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    44   1e-05
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    44   1e-05
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    44   2e-05
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    43   2e-05
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    43   3e-05
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       42   4e-05
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    45   4e-05
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    42   4e-05
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    42   7e-05
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    43   1e-04
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    42   2e-04
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    43   2e-04
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    40   3e-04
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    42   3e-04
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    42   3e-04
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    40   3e-04
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    42   4e-04
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    42   4e-04
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    40   4e-04
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    42   4e-04
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    41   6e-04
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    41   6e-04
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    41   6e-04
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    41   6e-04
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    39   6e-04
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    41   7e-04
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    41   7e-04
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    41   7e-04
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    40   0.001
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    40   0.002
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    38   0.002
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    39   0.003
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    39   0.004
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    38   0.006
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    37   0.006
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    37   0.007
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    38   0.008
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    38   0.009
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    37   0.009
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    37   0.011
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    37   0.013
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    35   0.015
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    37   0.019
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    36   0.021
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.022
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    36   0.023
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    36   0.026
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    36   0.027
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    35   0.034
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    35   0.035
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    36   0.038
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    35   0.039
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    35   0.040
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    36   0.040
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    35   0.041
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    35   0.047
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    34   0.050
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    35   0.053
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    35   0.053
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    35   0.055
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    35   0.059
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    33   0.059
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    35   0.062
Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {...    35   0.063
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    34   0.063
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.067
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    35   0.069
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    34   0.081
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    35   0.081
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    35   0.083
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    35   0.089
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    34   0.096
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     34   0.10 
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    34   0.10 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    34   0.10 
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    34   0.11 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    34   0.11 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    34   0.11 
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    34   0.11 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    34   0.12 
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    34   0.14 
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    34   0.14 
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    34   0.15 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    34   0.15 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   0.16 
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    34   0.16 
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    33   0.16 
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    33   0.18 
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    33   0.21 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     33   0.21 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    33   0.22 
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    33   0.24 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    33   0.24 
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    33   0.25 
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     33   0.25 
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    33   0.27 
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    33   0.28 
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    32   0.30 
Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR03...    33   0.30 
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    32   0.33 
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    33   0.36 
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    33   0.37 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    33   0.38 
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   0.38 
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    32   0.42 
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    33   0.43 
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    33   0.43 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   0.43 
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    32   0.46 
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    32   0.49 
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    32   0.50 
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    32   0.51 
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    32   0.53 
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    32   0.57 
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    32   0.61 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    32   0.62 
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    32   0.62 
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    32   0.64 
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    32   0.65 
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    32   0.65 
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    32   0.66 
KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {...    32   0.68 
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    32   0.70 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    31   0.70 
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    32   0.74 
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    32   0.74 
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    32   0.78 
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    32   0.81 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      32   0.84 
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    32   0.84 
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    32   0.89 
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    32   0.91 
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    32   0.93 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    32   0.94 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    32   0.97 
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    32   0.98 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    31   1.0  
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    31   1.1  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    31   1.2  
TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4....    31   1.3  
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    31   1.3  
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    31   1.3  
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    31   1.3  
CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {O...    30   1.4  
Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {...    31   1.4  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    31   1.5  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    31   1.5  
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    31   1.5  
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    31   1.5  
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    31   1.5  
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    31   1.6  
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    31   1.7  
CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} simil...    31   1.7  
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    30   1.7  
Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar t...    31   1.8  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    31   1.8  
Ecym_3005 Chr3 complement(9078..11699) [2622 bp, 873 aa] {ON} si...    31   1.9  
Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W ...    31   1.9  
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    30   2.0  
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    30   2.0  
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    30   2.0  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    30   2.1  
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    30   2.1  
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    30   2.1  
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    30   2.2  
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    30   2.2  
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    30   2.5  
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    30   2.6  
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    30   2.6  
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    30   2.7  
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    30   2.7  
Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032...    30   2.8  
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    30   2.8  
Skud_1.60 Chr1 (118757..122584) [3828 bp, 1275 aa] {ON} YAL002W ...    30   3.5  
Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W ...    30   3.7  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    30   3.7  
TBLA0E01300 Chr5 (285940..290262) [4323 bp, 1440 aa] {ON} Anc_4....    30   4.0  
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    30   4.0  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    29   4.5  
AFR220W Chr6 (830237..833494) [3258 bp, 1085 aa] {ON} Syntenic h...    30   4.6  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...    30   4.8  
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    29   4.8  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    29   4.9  
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    29   4.9  
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    29   5.3  
YBR114W Chr2 (467248..469620) [2373 bp, 790 aa] {ON}  RAD16Prote...    29   5.8  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    29   5.8  
Skud_4.684 Chr4 (1211138..1213813) [2676 bp, 891 aa] {ON} YDR409...    29   5.8  
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    28   5.9  
YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}  VPS8Membr...    29   6.1  
NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {...    29   6.2  
NCAS0I01050 Chr9 complement(193390..195708) [2319 bp, 772 aa] {O...    29   6.5  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    29   6.8  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    29   6.9  
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    29   7.0  
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    29   7.0  
TPHA0A03030 Chr1 complement(664655..665764) [1110 bp, 369 aa] {O...    29   7.3  
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    29   7.4  
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    29   7.4  
Kpol_1003.13 s1003 (38682..39656) [975 bp, 324 aa] {ON} (38682.....    28   7.5  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    28   7.6  
Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR23...    29   7.7  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    28   7.8  
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    28   7.9  
KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {O...    28   8.2  
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    28   8.6  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    28   8.6  
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    28   8.8  
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    28   9.0  

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  316 bits (809), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 152/165 (92%), Positives = 152/165 (92%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           MKVKINEVHSVFAWSWHIPSISDEVIG             CGICRASYNGTCPSCKYPGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVPNENDEDEDVCGICRASYNGTCPSCKYPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
           RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  293 bits (750), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 138/165 (83%), Positives = 147/165 (89%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           MKVKIN+VHSVFAWSWHIP ISDE                CGICRASYNGTCPSCK+PGD
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTNENDDDEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQ FQLQKGLAINDAHI+KFV++VSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAHIRKFVEVVSR 120

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
           RREEMIEEGVAEDFV+FDEP+RQNTDSAI+RQQ+DTVLDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDSAIDRQQVDTVLDEDFLLR 165

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  290 bits (741), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 145/165 (87%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           MKVKINEVHSVFAW+W IPSISDE +              CGICRASYNGTCPSCK+PGD
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDKLNDNDENEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           QCPLVIGVCHHNFHDHCIYRWLDT  SKGLCPMCRQ FQLQKGLAINDAHIQKFV+IVSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
           RREEMIEEGVAEDFV+FDEP+RQNTD+AI+R Q+DTVLDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  286 bits (733), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 144/165 (87%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           MKVKINEVHSVFAWSWHIPS SDE                CGICRASYNGTCPSCK+PGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           QCPLVIG+CHHNFHDHCIYRWLDT  SKGLCPMCRQTFQLQKGLAINDAH+QKFV+IVSR
Sbjct: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
           RREEMIEEGVAE+FV+FDEP+RQNTD+ I RQQ+DT+LDEDFLLR
Sbjct: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  179 bits (453), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 106/165 (64%), Gaps = 5/165 (3%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           MKV I EVHSVFAW+WHIP  + +                CGICRASYN TCPSCKYPGD
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKDNKD-----GSLEADDDDDVCGICRASYNATCPSCKYPGD 55

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           +C LV+G C+HNFH HCIYRWLDT+ SKGLCPMCRQ FQL++GLAIND+ ++KF ++  R
Sbjct: 56  ECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQLEKFKELQLR 115

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
           +R     E   ED     E      D A    Q D ++D+  ++R
Sbjct: 116 KRTNTAGEFADEDDEEAIERAMAQQDQAEVDDQGDVIMDQGLVVR 160

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  170 bits (430), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 110/165 (66%), Gaps = 12/165 (7%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           MKVK+ EVHSVFAW+WHIP  S +                CGICRASYN TCP CK+PGD
Sbjct: 1   MKVKLREVHSVFAWTWHIPKESQDA--HAETIDDNDGDDVCGICRASYNATCPGCKFPGD 58

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
            CPLV+G C+HNFH HCIYRWLDT+ S+GLCPMCRQTFQL+KGLAIND+ I KF ++ ++
Sbjct: 59  GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
           + +   +E        F +  +Q+ ++     Q D ++D+  ++R
Sbjct: 119 QWQTRQQE--------FGD--QQDPETNPLEDQDDPMMDQGLIVR 153

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  164 bits (414), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 110/176 (62%), Gaps = 11/176 (6%)

Query: 1   MKVKINEVHSVFAWSWHIP--------SISDEVIGXXXXXX-XXXXXXXCGICRASYNGT 51
           MKV++ +VH VF+WSWHIP         + ++ IG              CGICRAS+N T
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHI 111
           CP+CK+PGD CPLVIG C HNFH HCIY WLDTS S+GLCPMCRQ FQL+KG++IND+HI
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 112 QKFVDIVSRRREEM--IEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
           ++F ++  +R++E    E  + +D         Q         Q D ++D+D ++R
Sbjct: 121 ERFRELAIKRQQEQNEFESNLDDDAAIARAIAEQEDTGRNVDNQGDIIMDQDLVVR 176

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  146 bits (369), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 74/165 (44%), Positives = 103/165 (62%), Gaps = 21/165 (12%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           MKV + +VH+V +WSWHIP       G             CGICR SYNGTCPSCKYPGD
Sbjct: 1   MKVVVKKVHAVCSWSWHIPRD-----GTHQHEAADTEEDVCGICRVSYNGTCPSCKYPGD 55

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           +CPLV+G C+HNFH HCI +WLDT+ S+GLCPMCRQ F L++G+AIND+ +  F  ++++
Sbjct: 56  ECPLVVGECNHNFHVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQLDHFAKLLNK 115

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
                +    A +  N          + +  +Q D ++++DFL+R
Sbjct: 116 -----VNRAGATELAN----------AGLAEEQ-DLMMEQDFLVR 144

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  146 bits (368), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 95/164 (57%), Gaps = 16/164 (9%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEV---IGXXXXXXXXXXXXXCGICRASYNGTCPSCKY 57
           MKV + +++ V+AWSW I +   E    +              CGICRASYNGTCPSCK 
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKSDVYSVLDKYRSEKDDVCGICRASYNGTCPSCKI 60

Query: 58  PGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDI 117
           PG  CPL++G C+HNFH HCI+RWL+T NSKGLCPMCRQ F+L K L IN  ++QKF  +
Sbjct: 61  PGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSDYLQKFEVL 120

Query: 118 VSRRREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDED 161
             + RE           +N DE      D+ I+   ID    ED
Sbjct: 121 ARKNRERRA--------LNVDEE-----DNGIDNMIIDAAGIED 151

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  143 bits (361), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (58%), Gaps = 17/163 (10%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           M+++IN +  V +W W +P    E+               CGICR SYNGTCP+CK PG+
Sbjct: 1   MQLQINNIQCVASWYWDVPK---ELKRDSPVYEDEDEEDVCGICRGSYNGTCPNCKLPGE 57

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
            CPL++G CHHNFH HCIY+WL+TS SKGLCPMCRQ F L++G+ IN+ H  KF  ++ +
Sbjct: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHRDKFEKVLMK 117

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFL 163
            R++ +      + V  D              Q D ++D++F+
Sbjct: 118 ARQQSVVSVAGANPVGPD--------------QDDVIIDQEFI 146

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  142 bits (357), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 11/128 (8%)

Query: 1   MKVKINEVHSVFAWSWHIPSI--SDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYP 58
           M+++  +V+ VF+WSW IP    +D  IG             CGICR SYNGTCP CKYP
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDDDADREIGDEDL---------CGICRVSYNGTCPGCKYP 51

Query: 59  GDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIV 118
           GD CPLVIG C+HNFH HCI +WL T  +KGLCPMCRQ F L++G+AIN+  ++K  +++
Sbjct: 52  GDNCPLVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEKLANLL 111

Query: 119 SRRREEMI 126
            + R   +
Sbjct: 112 LQPRPAAL 119

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  142 bits (357), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 70/163 (42%), Positives = 99/163 (60%), Gaps = 16/163 (9%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           M+++I  V  V +W W +P    E+               CGICRASYNGTCP+CK PG+
Sbjct: 1   MQLQIKNVQCVASWYWDVPK---ELKRDLHEGEDEDDEDVCGICRASYNGTCPNCKLPGE 57

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
            CPL++G CHHNFH HCIY+WL+TS SKGLCPMCRQ F L+ G+ IN+ H +KF  ++ +
Sbjct: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK 117

Query: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFL 163
            R++ +   V+   VN          +A    Q D ++D++F+
Sbjct: 118 ARQQNV---VSVSGVN----------AAGGVDQEDVMIDQEFI 147

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  139 bits (350), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 98/167 (58%), Gaps = 34/167 (20%)

Query: 1   MKVKINEVHSVFAWSWHIPS--ISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYP 58
           MK++  +V+ VF+WSW IP    +D+ IG             CGICR SYNGTCP C++P
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDEDL---------CGICRVSYNGTCPGCRFP 51

Query: 59  GDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIV 118
           GD CPLVIG C+HNFH HCI +WL+T+ +KGLCPMCRQ F L++G+AIN+  +     + 
Sbjct: 52  GDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKL- 110

Query: 119 SRRREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165
                                 + Q+  +A+  +  D ++D++F++R
Sbjct: 111 ----------------------LLQSQPAALTTEDQDMMMDQEFIVR 135

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  140 bits (352), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 104/185 (56%), Gaps = 25/185 (13%)

Query: 1   MKVKINEVHSVFAWSWHIP---------------SISDEVIGXXXXXXXXXXXXXCGICR 45
           MKV+I  V+ VFAW W IP               S SD                 CGICR
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHDQKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCGICR 60

Query: 46  ASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLA 105
           AS+   CP+CK+P D CP+VIG C HNFH HCI+ WL+T  S+GLCPMCRQ F+L+KG+ 
Sbjct: 61  ASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGVV 120

Query: 106 INDAHIQKFVDIVSRRREEMIE-EGVAEDFVNFDEPMRQNTDSAIERQQ----IDTVLDE 160
           IND H   F +++ +R++E  E E  AED    DE + +   +A E       +D +LD+
Sbjct: 121 INDLHYVTFKELILKRQKEQNEFEATAED----DEALARMI-AAQEGNNGDVPVDDILDQ 175

Query: 161 DFLLR 165
           D ++R
Sbjct: 176 DMVVR 180

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  139 bits (349), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 91/151 (60%), Gaps = 7/151 (4%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPGD 60
           M++++ EVH VF W W IP   D +               CGICRASY+  CP+C+YPG+
Sbjct: 1   MRIELTEVHGVFNWVWDIPKNEDRL----DESMADEDEDVCGICRASYHAPCPNCRYPGE 56

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
            C +V+G C HNFH HCI RW+DT  SKGLCPMCRQ FQL +   IN+ HI  F +I  +
Sbjct: 57  SCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHIPLFKEIEIK 116

Query: 121 RREEMIEEGVAEDFVNFDE---PMRQNTDSA 148
           R  ++ EE  A ++   +E   P R++ + A
Sbjct: 117 RYRQLQEEIEAGNYDALEEANIPPREDVEMA 147

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  137 bits (344), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 82/145 (56%), Gaps = 19/145 (13%)

Query: 1   MKVKINEVHSVFAWSWHI--PSISDEV-----------------IGXXXXXXXXXXXXXC 41
           MK+ I  V+ VF WSW    P+ + +                  +              C
Sbjct: 1   MKLDIKRVNPVFTWSWDTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDVC 60

Query: 42  GICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQ 101
           GICRASYNGTCPSCK PGD CPLV G+CHH+FH HCI+RWLDT+ SKGLCPMCRQ FQL 
Sbjct: 61  GICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQLN 120

Query: 102 KGLAINDAHIQKFVDIVSRRREEMI 126
             L IN  +++KF  I    RE + 
Sbjct: 121 SKLPINRPYLEKFESITKAIRERVF 145

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  136 bits (342), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 83/142 (58%), Gaps = 12/142 (8%)

Query: 1   MKVKINEVHSVFAWSWHIP------------SISDEVIGXXXXXXXXXXXXXCGICRASY 48
           MK+++  ++ + AWSW +P            + +D                 CGICRASY
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 49  NGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAIND 108
           NGTCP+CK+PG  CPLV+G C+HNFH HCIY+WL T  SKGLCPMCRQ F+L+    +N 
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNATVNT 120

Query: 109 AHIQKFVDIVSRRREEMIEEGV 130
            H+  F ++    R  +I EG+
Sbjct: 121 DHLGAFKELAITTRARLISEGL 142

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  130 bits (326), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 89/149 (59%), Gaps = 12/149 (8%)

Query: 1   MKVKINEVHSVFAWSWHIPSIS------DEVIG---XXXXXXXXXXXXXCGICRASYNGT 51
           MK+++  ++ VFAW W IP+ +      +  +G                CGICR +YN T
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHI 111
           CP+CK PG +CPLV+G C HNFH HCIY+WLDT+ SKGLCPMCRQ F+L++G+A+N +  
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 112 QKFVDI---VSRRREEMIEEGVAEDFVNF 137
             F  +    +R+R    +E V  D   F
Sbjct: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGF 149

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  117 bits (292), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 80/150 (53%), Gaps = 18/150 (12%)

Query: 1   MKVKINEVHSVFAWSWHIP--------SISDEVIGXXX----------XXXXXXXXXXCG 42
           M++++ +V  V  W+W IP         ++D+ +                        CG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 43  ICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK 102
           ICR  Y+ TCPSC YPG  CP+V+G+C+HNFH HCI +WL T  SKGLCP+CRQ FQL+ 
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 103 GLAINDAHIQKFVDIVSRRREEMIEEGVAE 132
            + IN  H  +F  ++   R+  I  G  E
Sbjct: 121 NVLINKMHHDEFQKLLMSVRQHNIPMGGGE 150

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  105 bits (262), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 5/112 (4%)

Query: 1   MKVKINEVHSVFAWSWHIPSISDE-----VIGXXXXXXXXXXXXXCGICRASYNGTCPSC 55
           MK+++ EV+ VF WSW I S +++                     CGICRA YN  CPSC
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNAVCPSC 60

Query: 56  KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAIN 107
            +PG  CP+V+G C H FH HC+  WL T+ ++G CPMCRQ F L     +N
Sbjct: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 47.0 bits (110), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T N+   CP+  
Sbjct: 44  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGACNHAFHLHCINKWLQTRNA---CPLDN 100

Query: 96  QTFQLQK 102
           QT+Q  K
Sbjct: 101 QTWQFAK 107

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKY-----PGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+      P ++C    GVC+H FH HCI +W+ T ++   CP+  
Sbjct: 52  CAICRNHIMEPCIECQPKAMTDPDNECVAAWGVCNHAFHLHCINKWIKTRDA---CPLDN 108

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 109 QPWQLAR 115

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T N+   CP+  
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNA---CPLDN 128

Query: 96  QTFQLQK 102
           Q +Q  K
Sbjct: 129 QPWQFAK 135

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 44.7 bits (104), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPG-- 59
           K +I +  +V  WSW I                      C ICR      C  C+     
Sbjct: 27  KFQIKKWTAVAFWSWDI------------------AVENCAICRNHIMEPCIQCQPNAMT 68

Query: 60  ---DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK 102
              ++C    G C+H FH HCI +WL T N+   CP+  +T+Q  K
Sbjct: 69  DTDNECVAAWGTCNHAFHLHCINKWLLTRNA---CPLDNKTWQFAK 111

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T ++   CP+  
Sbjct: 55  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDA---CPLDN 111

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 112 QPWQLAR 118

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 44.3 bits (103), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T ++   CP+  
Sbjct: 55  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDA---CPLDN 111

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 112 QPWQLAR 118

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC ++ +      K P   CP     C++ FH  C+Y+W  +SN+   CP+CR    L
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWFRSSNNN-TCPLCRSEIAL 1589

Query: 101  QK 102
            ++
Sbjct: 1590 RR 1591

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T ++   CP+  
Sbjct: 57  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIQTRDA---CPLDN 113

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 114 QPWQLAR 120

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T ++   CP+  
Sbjct: 55  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDA---CPLDN 111

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 112 QPWQLAR 118

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T N+   CP+  
Sbjct: 42  CAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNA---CPLDN 98

Query: 96  QTFQLQK 102
           +T+Q  K
Sbjct: 99  KTWQFAK 105

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T ++   CP+  
Sbjct: 56  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDA---CPLDN 112

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 113 QPWQLAR 119

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T N+   CP+  
Sbjct: 45  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNA---CPLDN 101

Query: 96  QTFQLQK 102
           Q +   K
Sbjct: 102 QPWSFAK 108

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T ++   CP+  
Sbjct: 50  CAICRNHIMEPCIECQPMAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDA---CPLDN 106

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 107 QPWQLAR 113

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 43/106 (40%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPG-- 59
           K +I +  +V  WSW I                      C ICR      C  C+     
Sbjct: 22  KFEIKKWTAVAFWSWDIA------------------VDNCAICRNHIMEPCIECQPKAMT 63

Query: 60  ---DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK 102
              ++C    G C+H FH HCI +W+ T ++   CP+  Q +QL +
Sbjct: 64  DTDNECVAAWGTCNHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 106

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 56   KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK 102
            K P   CP     C++ FH  C+Y+W  +S +   CP+CR  F L+K
Sbjct: 1477 KLPTKVCP----TCNNRFHGACLYKWFKSSGNN-TCPLCRGEFNLRK 1518

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +W+ T ++   CP+  
Sbjct: 41  CAICRNHIMEPCIECQPNAMTETDNECVAAWGTCNHAFHLHCINKWIKTRDA---CPLDN 97

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 98  QPWQLAR 104

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 42.0 bits (97), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 42/106 (39%), Gaps = 26/106 (24%)

Query: 2   KVKINEVHSVFAWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRASYNGTCPSCKYPG-- 59
           K +I +  +V  WSW I                      C ICR      C  C+     
Sbjct: 27  KFQIKKWTAVAFWSWDI------------------AVDNCAICRNHIMEPCIECQPKAMT 68

Query: 60  ---DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK 102
              ++C    G C H FH HCI +W+ T ++   CP+  Q +QL +
Sbjct: 69  DTDNECVAAWGACGHAFHLHCINKWIKTRDA---CPLDNQPWQLAR 111

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR    L
Sbjct: 1537 CAICYSVLHAV--DRKLPTKTCP----TCKNKFHGACLYKWFKSSGNN-TCPLCRSEIAL 1589

Query: 101  QK 102
            ++
Sbjct: 1590 RR 1591

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 15/74 (20%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTF 98
           C ICR         CK+  D  PL+I +  C H F   CI  WL  ++S   CP+CR   
Sbjct: 115 CSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS---CPICRNDV 162

Query: 99  QLQKGLAINDAHIQ 112
            L+K   I+D+ ++
Sbjct: 163 -LEKKFKIDDSQVE 175

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CPMCR    +
Sbjct: 1517 CAICYSILHAV--DRKLPTKTCP----TCRNKFHGACLYKWFRSSGNN-TCPMCRSEIAI 1569

Query: 101  QK 102
            ++
Sbjct: 1570 RR 1571

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +W+ T ++   CP+  
Sbjct: 36  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDA---CPLDN 92

Query: 96  QTFQLQK 102
           Q + L +
Sbjct: 93  QPWHLAR 99

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  +S +   CPMCR     
Sbjct: 1503 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWFRSSGNN-TCPMCRSEIPF 1555

Query: 101  QK 102
             +
Sbjct: 1556 NR 1557

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  +S +   CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWFRSSGNN-TCPLCRSEIPF 1557

Query: 101  QK 102
            +K
Sbjct: 1558 RK 1559

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C +    C+H FH HCI +W+ T ++   CP+  
Sbjct: 45  CAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKTRDA---CPLDN 101

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 102 QPWQLAR 108

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ +H  C+Y+W  +S +   CPMCR     
Sbjct: 1514 CAICYSILHAV--DRKLPSKTCP----TCNNKYHGACLYKWFRSSGNN-TCPMCRSEIPF 1566

Query: 101  QK 102
            ++
Sbjct: 1567 RR 1568

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1506 CAICYSILHAI--DRKLPSKTCP----TCKNRFHGACLYKWFRSSGNN-TCPLCRSEIPF 1558

Query: 101  QK 102
            +K
Sbjct: 1559 RK 1560

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +W+ T ++   CP+  
Sbjct: 52  CAICRNHIMEPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDA---CPLDN 108

Query: 96  QTFQLQK 102
           Q + L +
Sbjct: 109 QPWHLAR 115

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR    L
Sbjct: 1510 CAICYSILHAV--DRKLPTKTCP----TCKNKFHGACLYKWFRSSGNN-TCPLCRSEIPL 1562

Query: 101  QK 102
             +
Sbjct: 1563 HR 1564

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFRSSGNN-TCPLCRSEIPF 1557

Query: 101  QK 102
            ++
Sbjct: 1558 RR 1559

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1508 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFRSSGNN-TCPLCRSEIPF 1560

Query: 101  QK 102
            ++
Sbjct: 1561 RR 1562

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1510 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFRSSGNN-TCPLCRSEIPF 1562

Query: 101  QK 102
            ++
Sbjct: 1563 RR 1564

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1512 CAICYSILHAV--DRKLPSKTCP----TCKNRFHGACLYKWFRSSGNN-TCPLCRSEIPF 1564

Query: 101  QK 102
            ++
Sbjct: 1565 RR 1566

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPG-----DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C  C+          C    G C+H FH HCI +W+ T  +   CP+  
Sbjct: 56  CAICRNHIMEPCIECQPKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKTREA---CPLDN 112

Query: 96  QTFQLQK 102
           Q +QL +
Sbjct: 113 QPWQLAR 119

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1507 CAICYSILHAV--DRKLPNKTCP----TCKNRFHGACLYKWFRSSGNN-TCPLCRNEIPF 1559

Query: 101  QK 102
            ++
Sbjct: 1560 RR 1561

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 7/55 (12%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
            C IC +  +      K P   CP     C++ FH  C+Y+W  +S +   CP+CR
Sbjct: 1501 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGSCLYKWFRSSGNN-TCPLCR 1548

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  +S +   CP+CR     
Sbjct: 1496 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWFRSSGNN-TCPLCRSEIPF 1548

Query: 101  QK 102
            ++
Sbjct: 1549 RR 1550

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  +S +   CP+CR     
Sbjct: 1520 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWFRSSGNN-TCPLCRSEIPF 1572

Query: 101  QK 102
            ++
Sbjct: 1573 RR 1574

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 41   CGICRASYNGTCP-SCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQ 99
            C IC   Y+   P   K P   CP     C++ FH  C+Y+W  +S +   CP+CR    
Sbjct: 1493 CAIC---YSILHPVDRKLPTKVCP----TCNNRFHGACLYKWFRSSGNNS-CPLCRSEIP 1544

Query: 100  LQK 102
             ++
Sbjct: 1545 FRR 1547

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKYPGD-----QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C ICR      C +C+         +C    G C+H FH HCI +W+    S+ +CP+  
Sbjct: 44  CAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWI---KSRNVCPLDN 100

Query: 96  QTFQLQK 102
           + ++L +
Sbjct: 101 KPWKLAR 107

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 38.9 bits (89), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 5/40 (12%)

Query: 56   KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
            K P   CP     C + FH  C+Y+W  +S +   CP+CR
Sbjct: 1505 KLPSKVCP----TCSNRFHGACLYKWFKSSGNN-TCPLCR 1539

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 65  VIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQK 113
           V+G C H FH HCI RW+    +   CP+C++++ L  G     A+I+K
Sbjct: 125 VLG-CSHIFHSHCIDRWI--CRNSACCPLCKRSYSLPVGSCHVIAYIEK 170

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           TCP C  +   D   L+   C H FH  C+ +W D     G CP+CR
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKWKD-----GRCPVCR 252

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 49  NGTCP--SCKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           N  CP   CK+  D+ PL++ +  C+H F   CI  WL  S +   CP+CR    L+  L
Sbjct: 46  NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCRDNV-LEHKL 101

Query: 105 AINDAHIQ 112
            I+ +  +
Sbjct: 102 NIDTSKTE 109

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 37.0 bits (84), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 5/43 (11%)

Query: 55  CKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C Y  D  PLV+ +  C+H F   CI  WL  S++   CPMCR
Sbjct: 95  CVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST---CPMCR 134

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 37.7 bits (86), Expect = 0.008,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 12/64 (18%)

Query: 51  TCPSCKYPGDQCPLVIGV----CHHNFHDHCIYRWLDTSNSKGLCPMCRQT-FQLQKGLA 105
           TCP C    D   LV G+    C H FH  C+ +W    NSK  CP+CR T   + + L 
Sbjct: 240 TCPVCLEKMDS--LVTGLITIPCSHTFHCQCLDKW---KNSK--CPVCRHTNLNISRKLL 292

Query: 106 INDA 109
           I  A
Sbjct: 293 IEQA 296

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 37.7 bits (86), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C IC +  +      K P   C      C + FH  C+Y+W  +S +   CP+CR     
Sbjct: 1490 CAICYSILHAV--DRKLPTKTC----STCKNKFHGACLYKWFRSSGNN-TCPLCRSEINF 1542

Query: 101  QK 102
            ++
Sbjct: 1543 RR 1544

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 37.4 bits (85), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL--AINDAHIQKFVDIV 118
            CP  +  C H F   CI++W    NS   CP+CR      +GL  AIND+ +   +D  
Sbjct: 274 HCPTELP-CGHIFGRDCIFKWTKEHNS---CPICRSRIVEDEGLNHAINDSPV--VMDEF 327

Query: 119 SRRREEMIEE 128
            R+  E I +
Sbjct: 328 DRQSFERIRQ 337

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 55  CKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK 102
           C Y  D+ PLV+ +  C H F   C+  WL  S +   CPMCR    ++K
Sbjct: 95  CGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDVLVRK 141

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQLQKGLAIN 107
           TCP C  +   D   L+   C H FH  C+ +W    NSK  CP+CR  + +L +   + 
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKW---KNSK--CPVCRYSSLRLSRDSLLR 287

Query: 108 DA 109
           DA
Sbjct: 288 DA 289

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa]
          {ON} Anc_3.405 YPR093C
          Length = 102

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 69 CHHNFHDHCIYRWLDTSNS---KGLCPMCRQ 96
          CHH FH  CI +W  T+     + LCP CR+
Sbjct: 29 CHHKFHSDCIRKWHTTTTGEIRRPLCPFCRE 59

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 36.6 bits (83), Expect = 0.019,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 8/54 (14%)

Query: 51  TCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           T PS K+   + P     C H F   CIY+W    NS   CP+CRQ      G+
Sbjct: 244 TNPSYKHSPIKLP-----CGHIFGRECIYKWSRLENS---CPLCRQKISESVGV 289

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 35.8 bits (81), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 7/65 (10%)

Query: 49  NGTCPSC--KYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + TCP C   +  D+ PLV+ +  C H F   C+  WL T N+   CPMCR     +K L
Sbjct: 101 DDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWL-TKNT--TCPMCRDDVTHKKEL 157

Query: 105 AINDA 109
              D 
Sbjct: 158 PELDT 162

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 51  TCPSCKYPGDQ--CPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQLQKGLAIN 107
           +CP C    D     L+   C H FH  C+ +W    NSK  CP+CR  T ++ + L IN
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKW---KNSK--CPICRFSTLRISRDLVIN 336

Query: 108 DAHI 111
              +
Sbjct: 337 KKQV 340

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 35.8 bits (81), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 49  NGTCP--SCKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           + +CP   C Y  D  PLV  +  C+H F   CI  WL  S S   CP+CR
Sbjct: 100 DDSCPICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS---CPLCR 147

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 36.2 bits (82), Expect = 0.026,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 51  TCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           T PS K+   + P     C H F   CIY+W    NS   CP+CR       G+
Sbjct: 243 TNPSYKHSPIKLP-----CGHIFGRECIYKWSKLENS---CPLCRHKISESAGI 288

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 36.2 bits (82), Expect = 0.027,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 11/44 (25%)

Query: 62   CPLVIGV--------CHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
            CP+ +          C H F  HCI+ WL    +K +CP+C++T
Sbjct: 1151 CPICLNTIYMGSIIKCGHFFCKHCIFSWL---KNKSVCPICKKT 1191

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 34.7 bits (78), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 14/64 (21%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTF 98
           C IC+         C +  D  PLV  V  C+H F   C+  WL  +++   CPMCR   
Sbjct: 71  CAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHT---CPMCRDDL 118

Query: 99  QLQK 102
           + +K
Sbjct: 119 RSKK 122

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 35.0 bits (79), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 5/45 (11%)

Query: 55  CKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
           CK+  D+ PLV  +  C H F   CI  WL  S++   CP+CR +
Sbjct: 109 CKFLEDKYPLVAELPHCGHRFDLECISVWLSKSDT---CPLCRDS 150

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 35.8 bits (81), Expect = 0.038,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 10/86 (11%)

Query: 13  AWSWHIPSISDEVIGXXXXXXXXXXXXXCGICRAS---YNGTCPSCKYPGDQCPLVIGVC 69
            +S+H P +S E++              C IC +    Y    P   +  DQ   ++  C
Sbjct: 673 GYSYHKPVLSQELL---EHGASENHTVDCAICMSEVPVYVKDIPE-THAVDQQSYMVTPC 728

Query: 70  HHNFHDHCIYRWLDTSNSKGLCPMCR 95
           +H FH  C+  W+     K  CP+CR
Sbjct: 729 NHIFHTACLENWM---GYKLQCPVCR 751

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           TCP C  +   D   L+   C H FH  C+ +W       G CP+CR
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCR 275

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 65  VIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQLQKGLAINDAH-IQKFVDIVSR 120
           V+  C HN+  +CI  WL+ +N+  L CP CR T      L ++    ++  +D++ +
Sbjct: 5   VMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTIGAMPALNVSLLQTLESLIDVLDK 62

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 35.8 bits (81), Expect = 0.040,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
           CHH F   C+Y+W    N+   CP+CR 
Sbjct: 264 CHHIFGRECLYKWTRHENT---CPLCRH 288

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 35.0 bits (79), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 57  YPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           Y  D+ PLV+ +  CHH F   C+  WL  S +   CP+CR
Sbjct: 121 YLEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 158

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 34.7 bits (78), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 45  RASYNGTCPSCKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           +A+ N +     Y  D+ PLV+ +  CHH F   C+  WL  S +   CP+CR
Sbjct: 104 KATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 153

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 33.9 bits (76), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 55  CKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK 102
           C Y  D+ PL+  +  C HNF   C+  WL  + +   CPMCR      K
Sbjct: 39  CTYADDKYPLISKLPHCGHNFDYECLSIWLSKNKT---CPMCRDDITSHK 85

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 65  VIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQLQKGLAINDAHIQKFVDIV 118
           V+  C HN+   CI  WL ++N+  L CP CR   + Q  L   ++ +Q  ++ V
Sbjct: 5   VMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPLKEQPSL---NSALQNLLEFV 56

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 35.4 bits (80), Expect = 0.053,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 51  TCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           T PS K+   + P     C H F   CIY+W    NS   CP+CR       G+
Sbjct: 254 TNPSYKHSPIKLP-----CGHIFGRECIYKWSRLENS---CPLCRHKISENAGV 299

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 35.0 bits (79), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQ--LQKGL 104
           CP C          + VC HNFH +CI +W  TS S   CP+CR+     +QK L
Sbjct: 5   CPICLEDITDILGSLKVCQHNFHFNCIRQWHLTSKSLE-CPVCRRVSNIVIQKTL 58

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 35.0 bits (79), Expect = 0.059,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 8/56 (14%)

Query: 51  TCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAI 106
           T PS K+   + P     C H F   C+Y+W    NS   CP+CR       G+ +
Sbjct: 262 TNPSYKHSPIRLP-----CGHVFGRECLYKWSRLENS---CPLCRHKISESAGVPV 309

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa]
          {ON} YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 33.5 bits (75), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 5/43 (11%)

Query: 55 CKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          C Y  D+ PLV+ +  C+H F   C+  WL  S +   CP+CR
Sbjct: 40 CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPLCR 79

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 34.7 bits (78), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 12/62 (19%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
           C IC+  +N     C         ++G C+H FH +CI +W+    +   CP+C++++ L
Sbjct: 120 CAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCKRSYSL 167

Query: 101 QK 102
            +
Sbjct: 168 PR 169

>Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {ON}
           complement(68737..72273) [3537 nt, 1179 aa]
          Length = 1178

 Score = 35.0 bits (79), Expect = 0.063,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 52  CPSCKY-PGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQTFQLQKGLAIN 107
           CP C   P D   ++   C H F + C+  + D    K L   CP CRQ     + L +N
Sbjct: 925 CPICTTEPIDANNIIFTECGHCFCESCLQEYFDFQVQKKLETKCPNCRQIISTNRVLKLN 984

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 34.3 bits (77), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 57  YPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           Y  D+ PLV+ +  CHH F   C+  WL  S +   CP+CR
Sbjct: 86  YLEDKYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 123

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 8/59 (13%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQLQKGLAI 106
           TCP C  +   D   L+   C H FH  C+ +W    NS+  CP+CR  + +L +  A+
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKW---KNSR--CPVCRYSSIRLSRNSAV 286

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 35.0 bits (79), Expect = 0.069,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           C H F   CIY+W    NS   CP+CR     ++GL
Sbjct: 247 CGHRFGRMCIYQWTKEHNS---CPICRAEIVGREGL 279

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 34.3 bits (77), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKG----LCPMCRQTFQLQ 101
           CP C  P +    ++  C H F   C+Y  +++S   G    LC +CR+  +LQ
Sbjct: 212 CPICMEPPEAA--LVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKLQ 263

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 34.7 bits (78), Expect = 0.081,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQLQK 102
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR  +F++ +
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCRYSSFRISR 289

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 34.7 bits (78), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQLQK 102
           TCP C  +   +   L+   C H FH  C+ +W    NSK  CP+CR  +F+L +
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKW---KNSK--CPVCRLSSFRLSR 295

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQLQK 102
            CP C  +   +   L+   C H FH  C+ RW    NSK  CP+CR  +F+L +
Sbjct: 170 ACPVCLERMDSETTGLITIPCQHTFHCQCLNRW---KNSK--CPVCRYSSFRLSR 219

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 33.9 bits (76), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 5/62 (8%)

Query: 43  ICRASYNGTCPSCKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
           I  A  N +   CKY  D  PL+  +  C H+F   CI  WL  + +   CP+CR     
Sbjct: 99  IKAAHLNCSICYCKYTDDDYPLIAQLPHCGHHFDFECISIWLSKNET---CPICRDNLTS 155

Query: 101 QK 102
            K
Sbjct: 156 HK 157

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 34.3 bits (77), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 9/56 (16%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQ------TFQLQKGLAINDAHIQKFVDIV 118
           C H F   C+YRW    N+   CP+CR       T Q Q   A +D   ++  ++V
Sbjct: 235 CGHIFGRECLYRWCKLENT---CPLCRHVIAEVDTTQHQAQDAASDQAFERIRNLV 287

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 63  PLVIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQLQKGLAIN-DAHIQKFVDIVSR 120
           P++ G C HN+   CI  WL+ ++S  L CP CR +      L +    ++   ++++ +
Sbjct: 48  PVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRSSITSMPSLNVTLQQNLDALIEVLDK 106

Query: 121 RREEMI 126
              E+I
Sbjct: 107 AEPEVI 112

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W    NS+  CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW---KNSR--CPVCRHS 282

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 34.3 bits (77), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 13/69 (18%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQT 97
           C IC A           P D    +   C H+F + C++ ++D  N K L   CP CR +
Sbjct: 916 CSICTAE----------PIDLNKALFTECGHSFCEKCLFEYIDFQNGKKLCLKCPNCRDS 965

Query: 98  FQLQKGLAI 106
               + LA+
Sbjct: 966 IDGGRLLAL 974

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W    NS+  CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW---KNSR--CPVCRHS 282

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W    NS+  CP+CR +
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKW---KNSR--CPVCRHS 282

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 45  RASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTS---NSKGLCPMCRQTFQLQ 101
           +A  +  CP C  P +    VI  C H F   C+++ L++S      GLC +CR      
Sbjct: 132 KAVRDYQCPICFDPPENS--VITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCR------ 183

Query: 102 KGLAINDAHIQKF 114
           K +AI D  + K 
Sbjct: 184 KSVAIRDIKMIKL 196

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
           TCP C  +   +   LV   C H FH  C+ +W    NS+  CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKW---KNSR--CPVCRHS 282

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDA 109
           + I  C H++H HCI R +  S  + +CP CR +  L+  L   D 
Sbjct: 416 IFISPCSHSWHFHCIRRLVMVSYPQFVCPNCRASCDLEATLESEDG 461

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HCI R +  S  + +CP CR +  L+  L
Sbjct: 426 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDLEASL 466

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 33.9 bits (76), Expect = 0.15,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           C H F   CIY+W   +NS   CP+CR     ++GL
Sbjct: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGL 263

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 8/56 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT-FQLQKG 103
           +CP C  +   D   L+   C H FH  C+ +W D+      CP+CR +  +L +G
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKWKDSR-----CPVCRYSNLKLTRG 286

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.9 bits (76), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSK---GLCP 92
            C  C+   N +C  C+ P  +  +VI  C H  H  CI  W    N +   G CP
Sbjct: 1283 CDSCKKK-NTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 33.9 bits (76), Expect = 0.16,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
           + I  C H++H HCI R +     + +CP CR T
Sbjct: 782 IFISPCSHSWHFHCIRRLVMLQYPQFVCPNCRST 815

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 65  VIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQLQKGLAINDAHIQKFVDIV 118
           V+  C HN+   CI  WL+ +N+  L CP CR +  +   L ++   +Q+ V+ +
Sbjct: 5   VMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSVPPVLNVS---LQQLVNTL 56

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 33.5 bits (75), Expect = 0.18,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVD 116
           + I  C H +H  C+ R +  +  + +CP CR T  L+  L  +D+  +  +D
Sbjct: 528 IFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRSTCDLEASLDNSDSESESDLD 580

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HCI R +  S  + +CP CR    L+  L
Sbjct: 442 IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCRSACDLEAAL 482

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           TCP C  +   +   L+   C H FH  C+ +W D+      CP+CR
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCR 308

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 33.5 bits (75), Expect = 0.22,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 12/49 (24%)

Query: 62   CPLVIGV--------CHHNFHDHCIYRWLDTSNSKGLCPMC-RQTFQLQ 101
            CP+ +G+        C H F ++CI+ WL  +++   CP+C R T Q Q
Sbjct: 1271 CPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSN---CPLCKRDTTQSQ 1316

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 33.5 bits (75), Expect = 0.24,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGL---CPMCRQTFQLQKGLAI 106
           C H+F + C++ +++  NSK L   CP CR      + LA+
Sbjct: 932 CGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQIDACRLLAL 972

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           TCP C  +   +   L    C H FH  C+ +W D+      CP+CR
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDSR-----CPVCR 287

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 33.1 bits (74), Expect = 0.25,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           + I  C H++H  CI R + TS  + +CP CR
Sbjct: 506 MFISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 33.1 bits (74), Expect = 0.25,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
           C H F   C+Y+W    NS   CP+CR 
Sbjct: 246 CDHIFGRECLYKWSKLENS---CPLCRH 270

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H  C+ R + TS  + +CP CR +  L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTSYPQFVCPNCRSSCDLEASL 442

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 33.1 bits (74), Expect = 0.28,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 40/97 (41%), Gaps = 6/97 (6%)

Query: 69   CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQK--GLAINDAHIQKFVDIVSRRREEMI 126
            C H F   CI  WL   NS   CP+C+    L +       +   +        + +E+ 
Sbjct: 1241 CGHFFCKKCIQSWLKNKNS---CPLCKTETGLSEIYNFKFKEEDTEYSSYGSQPKSKEIS 1297

Query: 127  EEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFL 163
            +E    D +  DE M +  D  +  +  D++ +E F+
Sbjct: 1298 DECYENDRITDDE-MVKKEDELMNSRDSDSIFNEKFV 1333

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 32.3 bits (72), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 43  ICRASYNGT--CPSC--KYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           I R   N T  C  C   Y  D+ PLV+ +  C+H F   C+  WL  S +   CP+CR
Sbjct: 96  INRKKLNSTDNCSICYTNYLEDEYPLVVELPHCNHRFDLECLSVWLSRSTT---CPLCR 151

>Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR032W
           (REAL)
          Length = 1167

 Score = 33.1 bits (74), Expect = 0.30,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 13/69 (18%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQT 97
           C IC A           P D    V   C H+F + C++ +++  N K L   CP CR+ 
Sbjct: 914 CSICTAE----------PIDLDNAVFTECGHSFCEKCLFEYIEFQNGKQLSLKCPNCREP 963

Query: 98  FQLQKGLAI 106
               + LA+
Sbjct: 964 IDGGRLLAL 972

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 32.0 bits (71), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 55  CKYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C Y  D  PLV+ +  C H F   C+  WL  S +   CP+CR
Sbjct: 88  CGYLDDTHPLVVKLPHCSHRFDLECVAVWLSKSRT---CPLCR 127

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 32.7 bits (73), Expect = 0.36,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 69   CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQL 100
            C H F + CIY WL T   + +CP+C+    L
Sbjct: 1282 CGHFFCEDCIYDWLQT---RTICPICKHKASL 1310

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 32.7 bits (73), Expect = 0.37,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
           C H F   C+Y+W    N+   CP+CR 
Sbjct: 281 CKHIFGRECLYKWTRVQNT---CPLCRH 305

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           TCP C  +       L+   C H FH  C+ +W    NSK  CP+CR
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKW---KNSK--CPVCR 275

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 32.0 bits (71), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 5/55 (9%)

Query: 60  DQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQ 112
           D+ PLVI +  C H F   CI  WL   +S   CP+CR        L I+    +
Sbjct: 97  DEYPLVIELPHCSHKFDLQCISVWL---SSNSTCPVCRDKVNHNAKLDIDTTEAE 148

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HC+ R +  S  + +CP CR    L+  L
Sbjct: 335 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRSNCDLETTL 375

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 32.7 bits (73), Expect = 0.43,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 41  CGICRAS---YNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C IC +    Y    P   +  DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 699 CAICMSDVPIYIEEIPE-THKVDQHSYMVTPCNHVFHTSCLENWM---SYKLQCPVCR 752

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 32.7 bits (73), Expect = 0.43,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 41  CGICRAS---YNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C IC +    Y    P   +  DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 702 CSICMSEIPVYVEELPE-THKVDQHSYMVTPCNHIFHTSCLENWM---SYKLQCPVCR 755

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 32.7 bits (73), Expect = 0.43,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSK---GLCP 92
            C  C+   N  C  C+ P  +  +VI  C H  H  CI  W    N     G CP
Sbjct: 1268 CDSCKKK-NTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAIND 108
           + I  C H +H  CI R + TS  + +CP CR T  L+  L  +D
Sbjct: 449 MFISPCSHCWHFQCIRRLVMTSYPQFVCPNCRLTCDLEASLENSD 493

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 32.3 bits (72), Expect = 0.49,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 41  CGICRAS---YNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C IC +    Y    P   +  DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 700 CAICMSDVPIYIEEVPE-THKVDQHSYMVTPCNHVFHTPCLENWM---SYKLQCPVCR 753

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HC+ R +  S  + +CP CR    L+  L
Sbjct: 193 IFISPCAHSWHFHCVRRLVILSYPQFMCPNCRSNCDLEATL 233

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 32.3 bits (72), Expect = 0.51,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 65  VIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
           V+  C+H F   C+++W    NS   CP+CR 
Sbjct: 214 VVLPCNHVFGRECLFKWSQLENS---CPLCRH 242

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H  C+ R + T+  + +CP CR +  L+  L
Sbjct: 411 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 451

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 65  VIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQLQKGLAINDAHIQKFV 115
           V+  C HN+   CI  WL ++N+  L CP CR   +    L +   ++  +V
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRSPLKEPPALNVALQNLLNYV 56

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 12/83 (14%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL---------AINDAHIQKF 114
           + I  C H++H  CI R + T   + +CP CR +  L+  L            + H ++ 
Sbjct: 381 IFISPCSHSWHYQCIRRLVMTQYPQFICPNCRSSCDLEASLDSEDEEEDEVGKEGHYKEE 440

Query: 115 VDIVSRRREEM---IEEGVAEDF 134
             I SR R  +   I+E   ED 
Sbjct: 441 AAIESRTRSPLAAAIQEENEEDI 463

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 52  CPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           CP C  K   +   LV   C H FH  C+ +W       G CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCR 255

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 32.0 bits (71), Expect = 0.62,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDT-SNSKGL--CPMC 94
           N TC  C    D  P+V   C H +H HC+    DT  N + L  CP C
Sbjct: 926 NQTCFMCNLTLD-VPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC 973

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H  C+ R + T+  + +CP CR +  L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 442

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 32.0 bits (71), Expect = 0.65,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 7/58 (12%)

Query: 41  CGICRAS---YNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C IC +    Y    P+  +  D    +I  C+H FH  C+  W+     K  CP+CR
Sbjct: 695 CAICMSEVPVYVDDVPT-THKVDLDSFMITPCNHVFHTQCLENWM---GYKLQCPVCR 748

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HC+ R +  S  + +CP CR    L+  L
Sbjct: 464 IFISPCSHSWHFHCVRRLVMLSYPQFVCPNCRSACDLEATL 504

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 32.0 bits (71), Expect = 0.66,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C H F   C+Y+W    NS   CP+CR
Sbjct: 219 CGHVFGRECLYKWTTEHNS---CPICR 242

>KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1150

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 49  NGTCPSCKY-PGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQTFQLQKGL 104
           N  C  C   P D   L++  C H F D CI  ++     K L   CP+CR+      G+
Sbjct: 891 NLECSICTTEPIDPHKLILTDCGHPFCDKCILEYITYQKEKKLDVKCPICREMLDDTSGM 950

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 32.0 bits (71), Expect = 0.70,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKG---LCPMC 94
           N TC  C    D  P+V   C H +H HC+    DT  S+     CP C
Sbjct: 923 NQTCFMCNLTLD-IPVVFFKCGHTYHQHCLNEEEDTLESERKLFKCPKC 970

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 31.2 bits (69), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 57  YPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           Y  D  PLV+ +  C H+F   C+  W   S S   CP+CR
Sbjct: 82  YLNDGYPLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCR 119

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 32.0 bits (71), Expect = 0.74,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
           C H F   C+Y W    NS   CP+CR+
Sbjct: 295 CGHIFGRSCLYEWTRLENS---CPLCRK 319

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 32.0 bits (71), Expect = 0.74,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 11/61 (18%)

Query: 43  ICRASYNGTCPSCKYPGDQ-------CPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           +  +S + T P+   P +         P+ +  C H F   C+Y W    NS   CP+CR
Sbjct: 305 VAPSSMDSTIPTSSTPDENKKHEYHNSPVQLS-CKHIFCRSCLYEWSKLKNS---CPLCR 360

Query: 96  Q 96
           +
Sbjct: 361 K 361

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON}
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative alcohol-
          responsive signaling pathway accumulates in the nucleus
          under alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 11/56 (19%)

Query: 41 CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
          CGIC  S N T        DQ  L+   C H +H  CI +W   SN    CP CR+
Sbjct: 5  CGICLESMNET--------DQGELL--PCEHRYHVSCIRKWHLYSNDFK-CPTCRK 49

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   N K  CP+CR
Sbjct: 720 DQHSYMVTPCNHVFHTSCLENWM---NYKLQCPVCR 752

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C H+FH  CI  WL       LCP+CR
Sbjct: 231 CSHHFHFECIKLWLQ---KNSLCPLCR 254

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 22/97 (22%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCR---------------QTFQLQKGLAINDAHIQK 113
           C H +H  CI +W   +     CPMCR               +   LQKG A+N     +
Sbjct: 25  CGHEYHSDCIRKWHGHAEDLK-CPMCRIDAEELVVKLYGCAEKIIDLQKGFAVN-----Q 78

Query: 114 FVDIVSRRREEMIEEGVAEDFVNFDEPMRQNTDSAIE 150
            V+ V     ++I+E +AE   N        TD+ +E
Sbjct: 79  VVNHVINTEPDLIDE-LAEALDNNLHISELRTDTQVE 114

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 31.6 bits (70), Expect = 0.89,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
           C H F   CI++W    NS   CP+CR+
Sbjct: 340 CGHIFGRDCIFKWSHLENS---CPLCRK 364

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 31.6 bits (70), Expect = 0.91,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 7/58 (12%)

Query: 41  CGICRAS---YNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C IC A    Y    P   +  D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 698 CAICMAEFPVYVEELPE-THQVDKDSYMITPCDHMFHTSCLESWM---SYKLQCPVCR 751

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 31.6 bits (70), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQTFQLQKGLAIND 108
           ++   C H F +HC+  ++D    K L   CP CR++   ++ L + +
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKE 935

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 31.6 bits (70), Expect = 0.94,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRW-LDTSNSKGLCP 92
            C +C +  N  C  C+ P  +  + I  C H  H  C  RW +D   S+  CP
Sbjct: 1228 CDLC-SRMNTLCALCERPLKKLTMCILSCGHEGHPECFQRWFMDEEMSE--CP 1277

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 31.6 bits (70), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 14/93 (15%)

Query: 51   TCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT--------FQLQK 102
            +CP C   G      I  C H F   CI+ WL   NS   CPMC+ +        F+ Q 
Sbjct: 1153 SCPIC--LGKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMCKTSTSIMEVYNFKFQN 1207

Query: 103  GLA-INDAHIQKFVDIVSRRREEMIEEGVAEDF 134
              A +N+   +   D   + +   + + V +D+
Sbjct: 1208 DDAEVNEPQNESSQDFEKKPKSSALAKKVGDDY 1240

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 31.6 bits (70), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
           + I  C H++H HCI R +  S  + +CP CR +
Sbjct: 515 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSS 548

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSCKYPGD--QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           TCP C    D     L+   C H FH  C+ +W    NS+  CP+CR
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKW---KNSR--CPVCR 278

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 5/42 (11%)

Query: 56  KYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           KY  D  PLV+ +  C H F   C+  WL  +++   CP+CR
Sbjct: 92  KYNEDDYPLVVELPHCSHRFDLECLTPWLLKNST---CPLCR 130

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 69   CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
            C H +   CI+ WL+ S  K  CP+C+
Sbjct: 1152 CGHYYCQDCIWNWLEKSKKKN-CPICK 1177

>TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4.129
            YAL002W
          Length = 1283

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 60   DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMC 94
            D   LVI  CHH FH  C+ + L  +N K  C  C
Sbjct: 1238 DDLNLVIFSCHHGFHSKCL-KNLGQNNEKYYCLSC 1271

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL 104
           + I  C H++H HC+ R +  +  + +CP CR    L+  L
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMNYPQFMCPNCRTNCDLETTL 380

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           DQ   ++  C H FH  C+  W+     K  CP+CR
Sbjct: 723 DQHSYMVTPCDHIFHTDCLENWM---GYKLQCPVCR 755

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1018

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 49  NGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKG--LCPMC 94
           N  C  CK    + P++   C H +H+ C+ + LD ++     +CP C
Sbjct: 915 NEKCDYCK-ANLEIPIIYFQCGHTYHERCLNKELDQNSGDEVYVCPKC 961

>CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {ON}
           weakly similar to uniprot|P40072 Saccharomyces
           cerevisiae YER116c YEU6
          Length = 210

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSK---GLCPMCRQTFQLQK 102
           CP C  P D    ++  C H F   C+++ ++ S +    G+C +CR+T  +++
Sbjct: 146 CPICFEPPDVA--IMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQ 197

>Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {ON}
            complement(56650..59700) [3051 nt, 1017 aa]
          Length = 1016

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 49   NGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL--CPMCRQTFQLQKGLAI 106
            N  C  C+  G + P+V+  C HN+H  C+      ++   +  CP C    +  + LA 
Sbjct: 914  NVNCCMCE-AGLELPIVVFKCTHNYHQRCLNEEDKKTDGSIVYKCPKCIVDLESSERLAK 972

Query: 107  NDAHIQKFVDIVSRRREEMIEEG--VAEDFV 135
            +   ++  + +V     +  E+   V  DF+
Sbjct: 973  SQQEVKNNIKLVKMALNQGQEDSFKVVTDFI 1003

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 31.2 bits (69), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRW-LDTSNSK--GLCP 92
            C  C+   N  C  C+ P  +  +VI  C H  H  CI  W LD    +  G CP
Sbjct: 1274 CDSCKKK-NTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           TCP C  +   +   L    C H FH  C+ +W D       CP+CR
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWGDNR-----CPVCR 267

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           + I  C H++H HC+ R +  S  + +CP CR
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCR 371

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 11/39 (28%), Positives = 18/39 (46%)

Query: 63  PLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQ 101
           P+ I  C H++H  C+   +        CP C+  F L+
Sbjct: 357 PIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 7/56 (12%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL----AINDAHIQKFVDIVSR 120
           C H F   CI +W +  N+   CP+CR       GL    A++D   Q  ++ + R
Sbjct: 227 CSHVFGRECIRQWTNLHNT---CPICRANIVGADGLNNNFAMDDLEDQASLERIRR 279

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
          similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%)

Query: 69 CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          C H FH  CI +W  +  S   CP CR
Sbjct: 26 CQHEFHLSCIRKWYHSRISDRTCPNCR 52

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 724 DQYSYMVTPCNHIFHTECLENWM---SYKLQCPVCR 756

>CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032w RAD5
          Length = 1151

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 26/68 (38%), Gaps = 13/68 (19%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQT 97
           C IC A           P +    V+  C H F   C+  + +    K L   CP CR+ 
Sbjct: 897 CSICTAE----------PIESSSAVVTECEHVFCKECLEEYGNFQKEKSLQQKCPNCRRD 946

Query: 98  FQLQKGLA 105
             L + LA
Sbjct: 947 INLNRCLA 954

>Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 52  CPSCKYPGDQCPLVIG---VCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQLQKGLAIN 107
           CP C + GDQ     G   VC H FH +CI  W   S     CP+CR ++  L+ G   N
Sbjct: 4   CPIC-FEGDQDGEQFGCLEVCRHEFHLNCIREWHKYSIDLK-CPICRTESSHLKVGEGQN 61

>Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AAR049C
          Length = 465

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           Q P V+G C H F   CI  +L   N +  CP+C    +L++ +   +  + + V   SR
Sbjct: 41  QTP-VLGHCGHTFCSLCIRTYL---NKEARCPLC--LVELRQNMLQKEFLLGEIVASYSR 94

Query: 121 RREEMIE 127
            R  M+E
Sbjct: 95  IRGRMLE 101

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 23/91 (25%)

Query: 69   CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGL-AINDAHIQKFVDIVSRRREEMIE 127
            C H F   CI  WL  ++SK  CP+C       KG  +I++ +  KF +   +R +E+  
Sbjct: 1254 CGHYFCKSCILTWL-RAHSK--CPIC-------KGFCSISEVYNFKFKNSTEKREKEI-- 1301

Query: 128  EGVAEDFVNFDEPMRQNTDSAIERQQIDTVL 158
                       EP R+  DS+ +    ++++
Sbjct: 1302 ----------QEPRREGADSSQDNSNENSII 1322

>Ecym_3005 Chr3 complement(9078..11699) [2622 bp, 873 aa] {ON}
           similar to Ashbya gossypii ACR024W
          Length = 873

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 49/114 (42%), Gaps = 32/114 (28%)

Query: 71  HNFHDHCIYRWLDTSNSKGLCPMCRQTFQL----QKGLAINDAHIQKFVDIVSRRRE--- 123
           H FH +C   +L+            + F+L    + GL +N    Q F+ +++RR +   
Sbjct: 276 HKFHIYCSPTYLE------------RFFKLADINRNGL-LNLKEFQLFIKLLTRRNDITE 322

Query: 124 ---EMIEEGVAEDFVNF---------DEPMRQNTDSAIERQQIDTVLDEDFLLR 165
              ++ + G   DF  F         +   R  T+   E+  ID ++DED LL+
Sbjct: 323 IWRDISKPGSVLDFEKFYNFLIDIQGESISRHLTEKIFEKYSIDGIMDEDLLLK 376

>Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W
            (REAL)
          Length = 1271

 Score = 30.8 bits (68), Expect = 1.9,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 61   QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMC 94
            + PLVI  CHH FH  C+       N K  C +C
Sbjct: 1232 ETPLVIFKCHHGFHQTCLENLAQKPN-KYTCLIC 1264

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           D+   +I  C+H FH  C+  W+   + K  CP+CR
Sbjct: 712 DKDTYMITPCNHIFHTTCLENWM---SYKLQCPVCR 744

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 3/30 (10%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTF 98
           C+H FH  C+  W+     K  CP+CR + 
Sbjct: 733 CNHIFHTECLENWM---GYKLQCPVCRSSL 759

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
           YMR231W
          Length = 1036

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 49  NGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL--CPMC 94
           N TC  CK P    P+V   C H +H +C+     T  ++ +  CP C
Sbjct: 933 NQTCFMCKLPM-HLPMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKC 979

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSK---GLCP 92
            C  C+   N  C  C+ P  +  +V+  C H  H  CI  W      +   G CP
Sbjct: 1278 CDSCKKR-NSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWFLNEKERECPGGCP 1331

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQ 96
           C H F   C+++W    N+   CP+CR 
Sbjct: 304 CGHIFGRECLFKWSKVENT---CPLCRH 328

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 3/42 (7%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAH 110
           C H  H +C+  W++ S +   CP+CR      KG  +   H
Sbjct: 371 CGHILHLNCLKNWMERSQT---CPICRLPVFDDKGNVMPSTH 409

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
          {ON} some similarities with uniprot|Q12161
          Saccharomyces cerevisiae YOL054W PSH1 Nuclear protein
          putative RNA polymerase II elongation factor isolated
          as Pob3p/Spt16p- binding protein
          Length = 445

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%)

Query: 65 VIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTF 98
          V+  C HN+   C+  W D+++++  CP CR + 
Sbjct: 41 VMTQCGHNYCYDCLSSWFDSNSNELSCPQCRASI 74

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKG 103
           C H  H  C+  W++ S +   CP+CR +   +KG
Sbjct: 372 CGHILHLSCLKNWMERSQT---CPICRLSVFDEKG 403

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQ 101
           + I  C H++H  CI R + T   + +CP CR +  L+
Sbjct: 390 IFISPCSHSWHYQCIRRLVMTQYPQFVCPNCRSSCDLE 427

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C H  H +C+  W++ S +   CP+CR
Sbjct: 347 CGHVLHLYCLKNWMERSQT---CPICR 370

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 41/135 (30%)

Query: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR-QTFQ----------- 99
           C  C    D+    +  C+H +H  CI  W + SN    CP CR +T Q           
Sbjct: 19  CAICLDAIDKSIAKLEPCNHKYHIDCIRTWHNYSNDLN-CPTCRIETNQLSVNIYPEIQS 77

Query: 100 ------LQKGLAINDAHIQKFVDIVSRR-------------------REEMIEEGVAEDF 134
                 L+ G  IN   I+++ +++ R+                    E +I E ++++F
Sbjct: 78  PPVKITLKTGFNIN--KIEEYCELIRRQPMHGTTGIRRNDYHPLLNEEESVIYEAISDEF 135

Query: 135 -VNFDEPMRQNTDSA 148
             N+D  M  + D++
Sbjct: 136 EENYDSDMENDFDNS 150

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           + I  C H++H HCI R +  +  + +CP CR
Sbjct: 484 IFISPCAHSWHFHCIRRLVMLTYPQFVCPNCR 515

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}
           PEP5Component of CORVET tethering complex; peripheral
           vacuolar membrane protein required for protein
           trafficking and vacuole biogenesis; interacts with Pep7p
          Length = 1029

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKG---LCPMC 94
           N TC  C+   D  P+V   C H +H HC+    DT  S+     CP C
Sbjct: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972

>Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032W
           (REAL)
          Length = 1178

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 13/59 (22%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQ 96
           C IC A           P D   ++   C H+F + C++ +++    K L   CP CR+
Sbjct: 923 CSICTAE----------PIDIDKVLFTECGHSFCEKCLFEYIEFQKGKNLCLKCPNCRK 971

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
          {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 69 CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          C+H +H  CI RW   S++   CP+CR
Sbjct: 32 CNHKYHYDCIRRWHGYSDNSD-CPLCR 57

>Skud_1.60 Chr1 (118757..122584) [3828 bp, 1275 aa] {ON} YAL002W
            (REAL)
          Length = 1275

 Score = 30.0 bits (66), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%)

Query: 61   QCPLVIGVCHHNFHDHCIYRWLDTSNSKG--LCP 92
            + PLVI  CHH FH  C+       N     +CP
Sbjct: 1233 EMPLVIFKCHHGFHQTCLENLAQKPNEYSCLICP 1266

>Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W
            (REAL)
          Length = 1272

 Score = 29.6 bits (65), Expect = 3.7,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 61   QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
            + PLVI  CHH FH  C+       N    C +C+
Sbjct: 1233 KTPLVIFKCHHGFHQTCLENLAQRPNEY-FCLICQ 1266

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
          [1008 nt, 336 aa]
          Length = 335

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 5/46 (10%)

Query: 52 CPSC--KYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          C  C  ++  D+C L    CHH FH  CI  W   ++    CP CR
Sbjct: 6  CAICFEEFKEDRCAL--NPCHHTFHLECIRIWHSYADDLK-CPTCR 48

>TBLA0E01300 Chr5 (285940..290262) [4323 bp, 1440 aa] {ON} Anc_4.129
            YAL002W
          Length = 1440

 Score = 29.6 bits (65), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 9/52 (17%)

Query: 54   SCKYPGDQC--------PLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQT 97
            S  Y  D+C         L++  CHH FH +C+ R L    S   C  C +T
Sbjct: 1390 SQSYISDECLKAKFNNEKLIVFKCHHGFHANCL-RNLGQKGSAYSCLTCNKT 1440

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKG 103
           C H  H +C+  W++ S +   CPMCR     +KG
Sbjct: 352 CGHILHMNCLKNWMERSQT---CPMCRLPVFNEKG 383

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 29.3 bits (64), Expect = 4.5,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKG 103
           C H  H  C+  W++ S +   CP+CR     +KG
Sbjct: 377 CGHILHLSCLKNWMERSQT---CPICRLPVFDEKG 408

>AFR220W Chr6 (830237..833494) [3258 bp, 1085 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR032W (RAD5)
          Length = 1085

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 12/71 (16%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKG---LCPMCRQT 97
           C IC         +C+       +V   C H F + C+  ++   N KG   +CP CR  
Sbjct: 832 CSIC---------TCEAISPLTSVVFTRCGHPFCESCLLEYIQFQNKKGSETICPNCRAA 882

Query: 98  FQLQKGLAIND 108
            + +  L + D
Sbjct: 883 VESRYLLKLED 893

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 29.6 bits (65), Expect = 4.8,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 96   QTFQLQKGLAINDAHIQKFVDIVSRRREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQID 155
            Q   ++  + +  A + +   + S+ R     EG+    VN D P  Q+T +A   + I 
Sbjct: 1021 QEKNIKPSICLTGAEVNEQNSLSSKHRSR--HEGLGS--VNLDRPFLQSTGTATSSRNIP 1076

Query: 156  TVLDED 161
            TV D+D
Sbjct: 1077 TVKDDD 1082

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAI 106
           C H F   C+  W   S  +  CP+CRQT Q Q  L I
Sbjct: 294 CGHLFCWDCLLNW---SKERPECPLCRQTCQTQSILPI 328

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 65  VIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQLQKGL-AINDAHIQKFVDIVSRRR 122
           ++  C HN+   C+  W+ T++ K L CP CR        L       +Q  +D ++ ++
Sbjct: 41  MMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITDTPNLNPFIQQTLQLIIDTINEKK 100

Query: 123 EEMIE 127
           +++ E
Sbjct: 101 KKVSE 105

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 45  RASYNGTCPSC--KYPGDQCPLVIGV--CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           +     TC  C  ++  D  PL+  +  C H F   CI  WL   +++  CPMCR
Sbjct: 85  KVPLTDTCSICFERFGNDNYPLLAQLPHCGHIFDLQCISMWL---SNQVTCPMCR 136

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 29.3 bits (64), Expect = 5.3,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKG 103
           C H  H  C+  W++ S +   CP+CR     +KG
Sbjct: 375 CGHILHLSCLKNWMERSQT---CPICRLPVFDEKG 406

>YBR114W Chr2 (467248..469620) [2373 bp, 790 aa] {ON}  RAD16Protein
           that recognizes and binds damaged DNA in an
           ATP-dependent manner (with Rad7p) during nucleotide
           excision repair; subunit of Nucleotide Excision Repair
           Factor 4 (NEF4) and the Elongin-Cullin-Socs (ECS) ligase
           complex
          Length = 790

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 22/86 (25%)

Query: 57  YPGDQCPLVI-------------GVCHHNFHDHCIYRWLDT---SNSKGLCPMCRQTFQL 100
           +PGD   +VI               CHH F   CI  ++++   +N+K  CP+C      
Sbjct: 527 FPGDDIGVVICQLCNDEAEEPIESKCHHKFCRLCIKEYVESFMENNNKLTCPVC------ 580

Query: 101 QKGLAINDAHIQKFVDIVSRRREEMI 126
             GL+I+ +     VD+ S +++ ++
Sbjct: 581 HIGLSIDLSQPALEVDLDSFKKQSIV 606

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 29.3 bits (64), Expect = 5.8,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 41   CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWL 82
            C  CR   N  C  C+ P  +  + +  C H FH  C  +W 
Sbjct: 1275 CDSCRKP-NTLCVICEQPMKKLAICLLECGHEFHFECGQQWF 1315

>Skud_4.684 Chr4 (1211138..1213813) [2676 bp, 891 aa] {ON} YDR409W
           (REAL)
          Length = 891

 Score = 29.3 bits (64), Expect = 5.8,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 6/38 (15%)

Query: 91  CPMCRQTFQLQKGLAINDAHIQKFVDIVSRRREEMIEE 128
           CP+C      Q G+A+ +  I +FVD + R  EE +E+
Sbjct: 398 CPVC------QIGIALENLAISEFVDDILRNCEENVEQ 429

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
          Anc_3.405 YPR093C
          Length = 93

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%)

Query: 69 CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          C H FH  CI RW  T      CP CR
Sbjct: 26 CRHKFHKECIRRW-HTGAIDLKCPTCR 51

>YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}
            VPS8Membrane-binding component of the CORVET complex;
            involved in endosomal vesicle tethering and fusion in the
            endosome to vacuole protein targeting pathway; interacts
            with Vps21p; contains RING finger motif
          Length = 1274

 Score = 29.3 bits (64), Expect = 6.1,   Method: Composition-based stats.
 Identities = 10/18 (55%), Positives = 12/18 (66%)

Query: 61   QCPLVIGVCHHNFHDHCI 78
            + PLVI  CHH FH  C+
Sbjct: 1233 KTPLVIFKCHHGFHQTCL 1250

>NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {ON}
           Anc_2.411
          Length = 1137

 Score = 29.3 bits (64), Expect = 6.2,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 27/66 (40%), Gaps = 5/66 (7%)

Query: 52  CPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL---CPMCRQTFQLQKGLAIND 108
           C +   P D+  +V   C H F + CI  + +    K L   CP CR+     + L +  
Sbjct: 887 CTTDPIPLDK--IVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCREQINSNRLLTVEK 944

Query: 109 AHIQKF 114
              + F
Sbjct: 945 IEAETF 950

>NCAS0I01050 Chr9 complement(193390..195708) [2319 bp, 772 aa] {ON}
           Anc_3.368 YBR114W
          Length = 772

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 26/113 (23%)

Query: 65  VIGVCHHNFHDHCIYRWLDT----SNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120
           +   CHH F   CI  ++++    ++SK  CP+C        GL+I+ +     +D+ S 
Sbjct: 529 IASKCHHKFCRMCIKEYIESFMENNDSKLTCPVC------HIGLSIDLSQPSLEIDLDSF 582

Query: 121 RREEMIE--------------EGVAEDFVNFDEPMRQNTDSAIERQQIDTVLD 159
           +++ ++               E + E+      P+R  T  +I   Q  ++LD
Sbjct: 583 KKQSIVSRLNMKGTWQSSTKIEALVEELYKLRSPVR--TIKSIVFSQFTSMLD 633

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 291

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 51 TCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCR 95
          +CP C     +    +  C H +H +CI RW    +SK L CP CR
Sbjct: 3  SCPICFESLSKGACRLVECGHKYHFNCIRRW--HYHSKNLQCPTCR 46

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 9/49 (18%)

Query: 66  IGVCHHNFHDHCIYRWLDTS-NSKGLCPMCR------QTFQLQKGLAIN 107
           + VC H FH +CI  W   S N K  CP+CR      +  + Q  L+IN
Sbjct: 20  LNVCGHKFHLNCIREWHKYSINLK--CPICRVESTHLEVGEGQHALSIN 66

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 28.9 bits (63), Expect = 7.0,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C H  H  C+  W++ S +   CP+CR
Sbjct: 376 CGHILHLSCLKNWMERSQT---CPICR 399

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           DQ   ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 720 DQHSYMVTPCDHVFHTSCLENWM---SYKLQCPVCR 752

>TPHA0A03030 Chr1 complement(664655..665764) [1110 bp, 369 aa] {ON}
           Anc_7.318 YLR215C
          Length = 369

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 46/110 (41%), Gaps = 9/110 (8%)

Query: 59  GDQCPLVIGVCHHNFHDHCIY-RWLD-----TSNSKGLCPMCRQTFQL--QKGLAINDAH 110
            D  PLV      N  D C Y  W +     T  SK + P+     Q   Q G+ + + H
Sbjct: 2   SDYAPLVDITVSRNDIDQCKYSNWYELFKSLTPQSKIIKPLPPAFIQYLKQDGIKLAEEH 61

Query: 111 IQKFVDIVSRRREEMIEEGVAEDFVNFDEP-MRQNTDSAIERQQIDTVLD 159
              + + +S+  E    +   E+  +  E     N  S IE++Q+D ++D
Sbjct: 62  GSYYNEDLSKNEENEYSDWENEESDSDSEADNNSNKKSKIEKKQVDPIVD 111

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 6/55 (10%)

Query: 41  CGICRASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C +C   +    PS +   D   + I  C H  H  C+  W+  S +   CP+CR
Sbjct: 353 CIVCMEDF---LPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPT---CPICR 401

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 7/58 (12%)

Query: 41  CGICR---ASYNGTCPSCKYPGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           C IC    A Y    P   +  D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 691 CAICMSEVAVYVDDIPET-HKVDKDDYMITPCSHIFHTQCLESWM---SYKLQCPVCR 744

>Kpol_1003.13 s1003 (38682..39656) [975 bp, 324 aa] {ON}
           (38682..39656) [975 nt, 325 aa]
          Length = 324

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 24/43 (55%)

Query: 115 VDIVSRRREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTV 157
           +D+V+R + E  E+ +  + + FD     N DS +  Q+ID +
Sbjct: 161 IDLVNRNKLESSEDPIDIEVLKFDILQSNNIDSILSNQKIDIL 203

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
          {ON} weakly similar to uniprot|Q06834 Saccharomyces
          cerevisiae YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 273

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 4/48 (8%)

Query: 51 TCPSCKYPGDQCPLVIGV---CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          TCP C          IG    C+H FH  C+ RW   ++   +CP+CR
Sbjct: 4  TCPICLDDDRTNIESIGTLQPCNHKFHRDCLRRWHLYAHDL-VCPICR 50

>Skud_13.400 Chr13 (707700..710792) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 28.9 bits (63), Expect = 7.7,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%)

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDT-SNSKGL--CPMC 94
           + P+V   C H +H HC+    DT  N + L  CP C
Sbjct: 936 EIPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC 972

>Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa]
          {ON} YPR093C (REAL)
          Length = 288

 Score = 28.5 bits (62), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 3/46 (6%)

Query: 52 CPSCKY--PGDQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          CP C     GD+    + +C H FH +CI  W   S     CP+CR
Sbjct: 4  CPICLADDQGDERFGCLDICKHKFHLNCIREWHKYSIDLK-CPICR 48

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 14/27 (51%)

Query: 69 CHHNFHDHCIYRWLDTSNSKGLCPMCR 95
          C H +H  CI +W    +    CP+CR
Sbjct: 35 CGHEYHLACIRKWFHLHSGNRSCPVCR 61

>KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {ON}
           Anc_8.808 YOL054W
          Length = 357

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 10/40 (25%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 63  PLVIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQLQ 101
           P+++  C H +   C+  W   + ++ L CP CR + +++
Sbjct: 43  PMMVTPCGHTYCYECLLTWFKNNENRELNCPDCRVSIEVE 82

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQ 101
           + I  C H++H  C+ R +  S  + +CP CR +  L+
Sbjct: 504 IFISPCAHSWHFRCVRRLVMLSYPQFICPNCRSSCDLE 541

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
          YOL054W
          Length = 416

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%)

Query: 69 CHHNFHDHCIYRWLDTSNSKGL-CPMCRQTFQ 99
          C HNF   C+  W+ T  SK L CP CR T  
Sbjct: 45 CGHNFCYGCLNNWI-TGGSKDLNCPQCRSTIN 75

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON}
          Anc_8.808 YOL054W
          Length = 478

 Score = 28.5 bits (62), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 63 PLVIGVCHHNFHDHCIYRWLDTSNSKGL-CPMCRQT 97
          P+V   C H+F   C+  W  +SN  GL CP CR +
Sbjct: 40 PMVT-PCGHSFCYGCLCSWFSSSNVDGLSCPHCRTS 74

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCR 95
           D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 709 DKESYMITPCSHIFHTQCLESWM---SYKLQCPVCR 741

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,735,345
Number of extensions: 620179
Number of successful extensions: 2305
Number of sequences better than 10.0: 275
Number of HSP's gapped: 2309
Number of HSP's successfully gapped: 275
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)