Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.2243.164ON40840820220.0
Suva_4.2223.164ON41641615740.0
Smik_4.2083.164ON41741713950.0
YDL027C3.164ON42041913750.0
ZYRO0B04862g3.164ON4083413641e-38
TDEL0D045903.164ON3763522982e-29
SAKL0C07392g3.164ON3613102822e-27
Kwal_33.141793.164ON3742652551e-23
KLTH0F06512g3.164ON3703422481e-22
NCAS0I020703.164ON4232672384e-21
KAFR0F022103.164ON3573092223e-19
Kpol_1045.433.164ON3822611862e-14
TPHA0P006703.164ON3803371354e-08
KLLA0C03872g3.164ON3763621168e-06
KNAG0K017303.164ON329371950.003
CAGL0K01639g3.164ON403379940.005
SAKL0G00616g5.679ON33053722.3
Ecym_40415.679ON33079695.3
Suva_8.4237.14ON21639676.8
TDEL0B074402.649ON57084687.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.224
         (408 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON...   783   0.0  
Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON...   610   0.0  
Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON...   541   0.0  
YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON} P...   534   0.0  
ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly...   144   1e-38
TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.1...   119   2e-29
SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {...   113   2e-27
Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {...   102   1e-23
KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {...   100   1e-22
NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.1...    96   4e-21
KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.1...    90   3e-19
Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa] ...    76   2e-14
TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3....    57   4e-08
KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {...    49   8e-06
KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.1...    41   0.003
CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa] ...    41   0.005
SAKL0G00616g Chr7 complement(59495..60487) [993 bp, 330 aa] {ON}...    32   2.3  
Ecym_4041 Chr4 complement(90697..91689) [993 bp, 330 aa] {ON} si...    31   5.3  
Suva_8.423 Chr8 (763701..764351) [651 bp, 216 aa] {ON} YOR367W (...    30   6.8  
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    31   7.3  

>Skud_4.224 Chr4 complement(398578..399804) [1227 bp, 408 aa] {ON}
           YDL027C (REAL)
          Length = 408

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/408 (94%), Positives = 387/408 (94%)

Query: 1   MFRLPLGLTSWTRAVSNNIPCNSAGIFNRCSLRQLGTSYRALPKHGMEGFQSYKLSLISH 60
           MFRLPLGLTSWTRAVSNNIPCNSAGIFNRCSLRQLGTSYRALPKHGMEGFQSYKLSLISH
Sbjct: 1   MFRLPLGLTSWTRAVSNNIPCNSAGIFNRCSLRQLGTSYRALPKHGMEGFQSYKLSLISH 60

Query: 61  KYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFF 120
           KYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFF
Sbjct: 61  KYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFF 120

Query: 121 IIFATASLFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFYKDILSSLPRTE 180
           IIFATASLFTFILTST                     KQFKKWQKNIFYKDILSSLPRTE
Sbjct: 121 IIFATASLFTFILTSTIIVIPFVLHFFFPLLIIFIFFKQFKKWQKNIFYKDILSSLPRTE 180

Query: 181 LKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVL 240
           LKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVL
Sbjct: 181 LKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVL 240

Query: 241 ESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSM 300
           ESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSM
Sbjct: 241 ESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSM 300

Query: 301 KNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTH 360
           KNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTH
Sbjct: 301 KNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTH 360

Query: 361 NMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLRG 408
           NMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLRG
Sbjct: 361 NMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLRG 408

>Suva_4.222 Chr4 complement(394220..395470) [1251 bp, 416 aa] {ON}
           YDL027C (REAL)
          Length = 416

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/416 (72%), Positives = 339/416 (81%), Gaps = 10/416 (2%)

Query: 1   MFRLPLGLTSWTRAVSNNIPCNSAGIFNRCSLRQLGTSYRALP---------KHGMEGFQ 51
           M RLPLGL    RAV+N  P NS  +FN CS RQL  S + LP           G+EG +
Sbjct: 1   MSRLPLGLVIRARAVANIQPFNSTRLFNPCSFRQLSVSSKVLPLLRLPSTCTSSGIEGHK 60

Query: 52  SYKLSLISHKYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPLV 111
           SYKLS +SH   SY  + V +PV+SIFK T+KR FHSS  A+IKFMFS RSPKNGDKP+V
Sbjct: 61  SYKLSSLSHNCGSYLFRPVSNPVNSIFKLTNKRAFHSSPHAQIKFMFS-RSPKNGDKPIV 119

Query: 112 KIYKVSPFFIIFATASLFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFYKD 171
           KIYKVSP  I+F T SLFTFILTST                     KQFK+WQKN+FYKD
Sbjct: 120 KIYKVSPLLILFTTVSLFTFILTSTMIVIPFIFHFFFPFLIMFIFFKQFKRWQKNVFYKD 179

Query: 172 ILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETRKQF 231
           IL+SLPRTELKI VPTMRSLQ+QPM+QSWKDISSRMGIPNEFAKGLNVDLVKQ+ETRKQF
Sbjct: 180 ILNSLPRTELKITVPTMRSLQMQPMIQSWKDISSRMGIPNEFAKGLNVDLVKQDETRKQF 239

Query: 232 LSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSV 291
           LSFL+KRVLESFTKNEMG+RSYFLGDNVEKWI+ SYDLELDI++CRSELRKFQ+SIF+SV
Sbjct: 240 LSFLEKRVLESFTKNEMGIRSYFLGDNVEKWIKESYDLELDIENCRSELRKFQDSIFASV 299

Query: 292 RYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQES 351
           +YKLYLDSMK+ PL+PSK  EGK+H+ADVYVIILD+SFPEIMFNGGGYSKADFFKILQES
Sbjct: 300 QYKLYLDSMKDLPLNPSKKFEGKKHLADVYVIILDKSFPEIMFNGGGYSKADFFKILQES 359

Query: 352 ETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407
           ETANS+K HN IIA+KSVNTPLS HF+ITAKGDSGDFFSKY +S VDG HTEYTLR
Sbjct: 360 ETANSNKMHNTIIAVKSVNTPLSHHFIITAKGDSGDFFSKYHVSKVDGKHTEYTLR 415

>Smik_4.208 Chr4 complement(383879..385132) [1254 bp, 417 aa] {ON}
           YDL027C (REAL)
          Length = 417

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/417 (67%), Positives = 320/417 (76%), Gaps = 11/417 (2%)

Query: 1   MFRLPLGLTSWTRAVSNNIPCNSAGIFNRCSLRQLGTS---------YRALPKHGMEGFQ 51
           M R+PLGL S TR  +N    N+   FN    R+LG S         + ++ K+  EGFQ
Sbjct: 1   MLRIPLGLVSITRPATNTALFNNTIRFNAFLPRKLGNSPKPVSLAVIFPSISKYAREGFQ 60

Query: 52  SYKL-SLISHKYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPL 110
             ++ SL+S  Y S P + + + +S   K  SKR FHS+  AEIKF F SRS +N +KP 
Sbjct: 61  PRRIFSLMSSNYCSCPHQFLSNSMSLSSKLISKRAFHSTRHAEIKFSFFSRSHRNNNKPF 120

Query: 111 VKIYKVSPFFIIFATASLFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFYK 170
           VK+YKVSPFFI+FATAS+FTFILTST                     KQFKKWQ N FYK
Sbjct: 121 VKVYKVSPFFILFATASIFTFILTSTIIVIPFIFHFFFPLLIMLVFFKQFKKWQNNTFYK 180

Query: 171 DILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETRKQ 230
           DIL SLP+TELKI VPTMRSLQLQPM+QSW++ISSRMGIPNEFAKGLNVDL KQ+ETRKQ
Sbjct: 181 DILISLPKTELKITVPTMRSLQLQPMIQSWREISSRMGIPNEFAKGLNVDLEKQDETRKQ 240

Query: 231 FLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSS 290
           FLSFLQKRVLESFTKNEMG+RSYFLGD VEKWIE SYDLELDID+CRSELRKFQ  +FSS
Sbjct: 241 FLSFLQKRVLESFTKNEMGIRSYFLGDRVEKWIEESYDLELDIDNCRSELRKFQNFVFSS 300

Query: 291 VRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQE 350
           VRY+LYLDS+K  PL+PSK  EGK+HIADVYVIILDESFPEIMF+G GYSKADFFKIL+E
Sbjct: 301 VRYRLYLDSIKKLPLNPSKKFEGKKHIADVYVIILDESFPEIMFSGEGYSKADFFKILRE 360

Query: 351 SETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407
           SETANSSK  NMIIAIKSVN PLS HFVITA GDSG+FFSKY I+ +DG +TEYTLR
Sbjct: 361 SETANSSKMLNMIIAIKSVN-PLSSHFVITANGDSGNFFSKYHITKIDGKNTEYTLR 416

>YDL027C Chr4 complement(403695..404957) [1263 bp, 420 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; YDL027C is not
           an essential gene
          Length = 420

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/419 (68%), Positives = 326/419 (77%), Gaps = 12/419 (2%)

Query: 1   MFRLPLGLTSWTRAVSNNIPCNSAG------IFNRCSLRQL------GTSYRALPKHGME 48
           MF++P+GL S TR + N++  NS        ++    LR          +  A+PK+  E
Sbjct: 1   MFKVPVGLASRTRELMNSVTLNSLNNGKGFNMYLPGILRAFPKPVPSAITSPAIPKYRGE 60

Query: 49  GFQSYKLSLISHKYRSYPLKAVFSPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDK 108
            FQ  KLS IS  Y S   + + S  SS  +   KR FHSS RAEIKF+FSS+SPKNG+K
Sbjct: 61  SFQFRKLSCISSNYCSTTHQFLSSLKSSTSRLVGKRAFHSSRRAEIKFIFSSKSPKNGNK 120

Query: 109 PLVKIYKVSPFFIIFATASLFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIF 168
           P VK+YKVSPFFIIFATAS+FTFILTST                     KQFKKWQKNIF
Sbjct: 121 PFVKVYKVSPFFIIFATASIFTFILTSTIVVIPLIFHFFFPLLIMFFFFKQFKKWQKNIF 180

Query: 169 YKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNETR 228
           YKD+L+SLP+T+LKI +PTMRSLQLQPMVQSWK+ISSRMGIPNEFAKGLNVDLVKQ ETR
Sbjct: 181 YKDVLTSLPKTKLKITLPTMRSLQLQPMVQSWKEISSRMGIPNEFAKGLNVDLVKQEETR 240

Query: 229 KQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIF 288
           KQFLSFLQKRVLESFTKNE+G+RSYFLGD+VEKWI+ SYDLELDID+CRSELRKFQ  IF
Sbjct: 241 KQFLSFLQKRVLESFTKNELGIRSYFLGDSVEKWIKESYDLELDIDNCRSELRKFQTFIF 300

Query: 289 SSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKIL 348
           SSVRYKLYLDSMKN PL+PSK LEGK+HIADVYVIILDESFP IMFNGG YSKADFFKIL
Sbjct: 301 SSVRYKLYLDSMKNLPLNPSKKLEGKKHIADVYVIILDESFPAIMFNGGAYSKADFFKIL 360

Query: 349 QESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407
           QESET+NSSKT N IIAIKSVNT LSKHFVIT  GDSG+FFSKY IS ++  +TEYTL+
Sbjct: 361 QESETSNSSKTLNTIIAIKSVNTLLSKHFVITTNGDSGEFFSKYNISKINDKNTEYTLK 419

>ZYRO0B04862g Chr2 (391162..392388) [1227 bp, 408 aa] {ON} weakly
           similar to uniprot|Q7LHC7 Saccharomyces cerevisiae
           YDL027C Hypothetical ORF
          Length = 408

 Score =  144 bits (364), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/341 (28%), Positives = 163/341 (47%), Gaps = 54/341 (15%)

Query: 84  RTFH-SSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFFIIFATASLFT-------FILTS 135
           R FH +S R   ++ F       G++P ++++K+SP  I  A+    T       F+LT 
Sbjct: 102 RNFHFTSVRRSGRYPF-------GNRPPLRVFKISPLVIFLASIGALTVFFLILPFMLT- 153

Query: 136 TXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQP 195
                                  QF+KW+ N  +  +L+ L ++E+++   T+ ++ ++ 
Sbjct: 154 ----------FFLPLFVVGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKS 203

Query: 196 MVQSWKDISS-RMGIPNEFAKGLNVDLVKQN--------ETRKQFLSFLQKRVLESFTKN 246
           + + +    +   G+  E  KG++  + +              + LSF+Q RV+E+   +
Sbjct: 204 ISKFFDAAQNPNAGVFEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSD 263

Query: 247 EMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSMKNSPLS 306
           E G+R+YFLGD+V  WI+  YD EL    CRS +R F+  I   + Y +YL S  +    
Sbjct: 264 EQGIRTYFLGDDVSNWIKEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHP--- 320

Query: 307 PSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAI 366
                  KRH+ADV V +L     E        +  DFF  L ++     +   NM I++
Sbjct: 321 -------KRHLADVSVAVLQGHHAE-------RNNYDFF--LVQTNLIRQNAKCNMAISV 364

Query: 367 KSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407
           KS ++ L K FVI   G+SGDF++KY +      HTEYT+R
Sbjct: 365 KSTSSILPKQFVIIDGGESGDFWTKYDVHENSDGHTEYTIR 405

>TDEL0D04590 Chr4 (841954..843084) [1131 bp, 376 aa] {ON} Anc_3.164
           YDL027C
          Length = 376

 Score =  119 bits (298), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 159/352 (45%), Gaps = 58/352 (16%)

Query: 72  SPVSSIFKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSP----------FFI 121
           SP      F   R FH++     ++M     P   ++P  K+Y++SP            +
Sbjct: 64  SPYVRPLSFVGNRLFHTTTP---RYM-----PPYPNQPPFKVYRISPIVAVLTGIGFLML 115

Query: 122 IFATAS-LFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFYKDILSSLPRTE 180
           +FA    +FTF                           QF KW++ + ++DIL  L  + 
Sbjct: 116 LFAVLPFIFTFFFP---------------LIIAGICAYQFSKWKRKVLFQDILRHLKTST 160

Query: 181 LKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQ-----NETRKQFLSFL 235
           +K+   T+++L ++ + +  +       +  +  K  + DL  +     +    + L F+
Sbjct: 161 MKVNYNTVKALHVKSLDKIVRLEQQNAKVFEDLLKSFDADLRARLDKFSSAKADKLLRFI 220

Query: 236 QKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKL 295
             R+LE+   NE G+R+YFLGD+V +W+E++Y LELD    ++  +     +   + + L
Sbjct: 221 DDRLLEAIETNEQGIRNYFLGDDVGRWVEDNYQLELDTTQYKTNAQVGDGELIMLLVFPL 280

Query: 296 YLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETAN 355
           YL S  N           ++H+A+V + +L   F        G + A++ + L  S  + 
Sbjct: 281 YLKSNSNP----------RKHLANVSLALLQGLFE-------GTNGANYLEFL--SSISE 321

Query: 356 SSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407
           +     M+IA++ V    +K FVI+  G SGD++SKY        HTEYT++
Sbjct: 322 TDAECQMVIAVQPVTNFSTKLFVISTDGRSGDWYSKYDSKEDSDGHTEYTVK 373

>SAKL0C07392g Chr3 complement(682073..683158) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 361

 Score =  113 bits (282), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 133/310 (42%), Gaps = 32/310 (10%)

Query: 101 RSP-KNGDKPLVKIYKVSPFFIIFATASLFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQ 159
           R+P + G +P +  ++ SP+ + FA   L    L++                       Q
Sbjct: 77  RTPFRPGPRPTIAPFRTSPWVMFFAGVGL----LSALFVVLPLVFTLFFPLVVAGVIAYQ 132

Query: 160 FKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNV 219
           FK+W+    Y  +  SL  T+L +   ++R L    +    +   +   + +    G  +
Sbjct: 133 FKRWRSAKLYDALYRSLQTTKLDVRYRSIRGLYSTTLASILERDRAGAELFDTVVNGRKM 192

Query: 220 -DLVKQNETR---KQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDS 275
            D+      R   +Q L+FL+ RVLES   NE GVR +FLG +V+ WI + YDL+LD   
Sbjct: 193 RDMWGDENDRLRSRQLLAFLESRVLESIRNNEDGVREFFLGTDVDSWIRDGYDLQLDTRI 252

Query: 276 CRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFN 335
           C +  R     +  SV Y LYL S  N           +R +ADV ++ LDE    +   
Sbjct: 253 CGTTGRSIGGKLAMSVTYPLYLVSSTN-----------RRKLADVSIVFLDE---RLAAG 298

Query: 336 GGGYSKADFFKILQESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQIS 395
            G Y   D          A   +   M+I+I  V T + + F+I+  G SG+  S+    
Sbjct: 299 SGFYPPGDL---------AGQDERCPMVISIVPVRTLVPRQFIISTPGASGNNASRLTQR 349

Query: 396 NVDGSHTEYT 405
                H EYT
Sbjct: 350 TTRDGHREYT 359

>Kwal_33.14179 s33 complement(559209..560333) [1125 bp, 374 aa] {ON}
           YDL027C - Hypothetical ORF [contig 105] FULL
          Length = 374

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 120/265 (45%), Gaps = 48/265 (18%)

Query: 159 QFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQS---------------WKDI 203
           QFKKW+     + +   L  ++++I   T+  LQ + M +S                 D+
Sbjct: 143 QFKKWKSATLMQQLHRRLLTSKMRIDRHTILGLQAR-MFESLLGSERNSAIFFRRAMDDM 201

Query: 204 SSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWI 263
           S+R      F  G +             +SFL  R+LE+F  NE G+R YFLG +V+ W+
Sbjct: 202 SARQMDDTSFKSGAD-----------DMISFLDSRILEAFKSNEQGIRDYFLGADVKTWV 250

Query: 264 ENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVI 323
           EN Y+L LD DS R+  +  + +   ++ Y LYL S            + K+ +ADV V 
Sbjct: 251 ENGYELSLDSDSPRTIGKSIEGTFVMTITYPLYLLSSN----------QRKKLLADVTVA 300

Query: 324 ILDESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAIKSVNTPLSKHFVITAKG 383
           +L +S P          K   F ++QE+   N  K   M+I+IK      +  F++    
Sbjct: 301 VLGDSTP---------GKPSPFFLMQENFADN--KDCPMVISIKPARALNTNQFILDETD 349

Query: 384 DSGDFFSKYQISNVDGSHTEYTLRG 408
           D+G+  S+Y +      H E+  RG
Sbjct: 350 DNGNHPSRYTVKTTSDGHREFRYRG 374

>KLTH0F06512g Chr6 complement(563724..564836) [1113 bp, 370 aa] {ON}
           weakly similar to uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 370

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 92/342 (26%), Positives = 143/342 (41%), Gaps = 57/342 (16%)

Query: 83  KRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFFIIFA-----------TASLFTF 131
           KR+FH  A     F  + R P  G  P  K+Y   P   I A              +FTF
Sbjct: 63  KRSFHRDAILRSPFQ-NGRFPGEGKSPF-KLYTFPPLLGIVALIGTIALLLVVLPLVFTF 120

Query: 132 ILTSTXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFYKDILSSLPRTELKIAVPTMRSL 191
           +                          QFK+WQ       +   L  T++ I   T+  L
Sbjct: 121 LFPLIIAGIAVF---------------QFKRWQNTTLLGQLHRCLLATKMSINYKTVWGL 165

Query: 192 QLQPMVQSWKD-----ISSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVLESFTKN 246
           Q Q M +S          S  G+ +E  +   +D         + L+FL +RVLE+F  N
Sbjct: 166 QTQ-MFESLLGSDGFAAGSFRGVMDEI-RSQKIDAANSKRRADEALAFLDRRVLEAFKNN 223

Query: 247 EMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSMKNSPLS 306
           E+G+R +FLG +   W++  YDL L  D+ R   +    S+  ++ Y LYL       LS
Sbjct: 224 ELGLRDFFLGSDASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYL-------LS 276

Query: 307 PSKNLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAI 366
            S+    ++ IA V + +LD+S            +   FK ++  E A+ +K   M+I+I
Sbjct: 277 SSQE---RKLIAYVAIGVLDDSMA---------GQTGSFKFVE--ELASQNKECPMVISI 322

Query: 367 KSVNTPLSKHFVITAKGDS-GDFFSKYQISNVDGSHTEYTLR 407
           +   +  +K FV+   G++ G   S Y +   D  H E+T R
Sbjct: 323 RPARSLYAKQFVLKDYGEARGKPTSAYYVRTADDGHREFTYR 364

>NCAS0I02070 Chr9 (388867..390138) [1272 bp, 423 aa] {ON} Anc_3.164
           YDL027C
          Length = 423

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 128/267 (47%), Gaps = 48/267 (17%)

Query: 159 QFKKWQKNIFYKDILSSL---PRTELKIAVPTMRSLQLQPMVQSWKDIS----SRMGIPN 211
           QF+KW++N  YK +L+ L    +  + I   T+ SLQ + +     DIS    S+   P+
Sbjct: 186 QFRKWKQNTLYKQLLAHLKNKSKGHMSIKYSTLNSLQYKIL----NDISFMKNSQGFKPD 241

Query: 212 EFAKGLNVDLVKQNETRKQ-FLSFLQKRVLESFTKNEMGVRSYFLG-----DNVEKWIEN 265
                +N D +  N    +  L+ LQ R++E+   +E+G+R+YFLG     +NV  W+  
Sbjct: 242 ILNMKMN-DFINSNARDSEALLNLLQSRIMEAIETDELGIRTYFLGAADNINNVTHWVNE 300

Query: 266 SYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIIL 325
             D ELD  +  S+ +     +  SV Y LYL S+K SP         KR IA+V +++L
Sbjct: 301 GLDFELDTKNSISKGKLVNGEMILSVTYALYLKSLK-SP---------KRRIAEVSIVVL 350

Query: 326 DESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAIKSVNTPLSK-----HFVIT 380
           DES            K   F  +  ++ A ++K+  M+ AIK V   LS       F++ 
Sbjct: 351 DES----------VEKNHVF--ISINDLAKTNKSCPMVFAIKPVKIDLSLLLQPFQFILD 398

Query: 381 AKGDSGDFFSKYQISNVDGSHTEYTLR 407
             G SG   S Y + N    + E+ LR
Sbjct: 399 DYGRSG---SNYDVYNTKSGNREFRLR 422

>KAFR0F02210 Chr6 (431088..432161) [1074 bp, 357 aa] {ON} Anc_3.164
           YDL027C
          Length = 357

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/309 (25%), Positives = 137/309 (44%), Gaps = 50/309 (16%)

Query: 102 SPKNGDKPLVKIYKVSPFFIIFATASLFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQFK 161
           SP    +P V+IY+++   ++  +A     +L  +                      Q++
Sbjct: 92  SPFEDKEPRVRIYRITTLNLLLGSA----VVLLLSTMILPILLKLIFPMIILGIFIYQYR 147

Query: 162 KWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKDISSRMGIPNEFAKGLNVDL 221
            W++   +  I   L RT L I   T+ SLQ   + +  K    +    NE      +  
Sbjct: 148 IWKRTKLFDQIFRGLGRTNLSIKYKTLNSLQYNYVPKILKKSVPKSWYTNEDISDAEI-- 205

Query: 222 VKQNETRKQFLSFLQKRVLESFTKNEMGVRSYFL--GDNVEKWIENSYDLELDIDSCRSE 279
                     LSF++ RV+E+F KNEMG+  YFL  G N +       DL L ID   S+
Sbjct: 206 ---------LLSFIKLRVIEAFKKNEMGISDYFLRRGQNFD-------DLSLLIDKENSQ 249

Query: 280 --LRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIMFNGG 337
             +R+   +   ++R++L L           KN     ++ADV + +LD+S         
Sbjct: 250 FLIRRLAGNFIVTMRHQLLL-----------KNENVDIYLADVMISVLDDS--------- 289

Query: 338 GYSKADFFKILQESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNV 397
             S+   F  L+E   A S+K+  M+I++ S +  L + FVIT +G++G F+ K+ +S+ 
Sbjct: 290 --SQTGIFMPLKE--LAKSNKSCKMVISVVSNSDILPRQFVITDEGETGKFYGKFTVSHG 345

Query: 398 DGSHTEYTL 406
              H E+ +
Sbjct: 346 KDGHREFRI 354

>Kpol_1045.43 s1045 complement(101542..102690) [1149 bp, 382 aa]
           {ON} complement(101544..102692) [1149 nt, 383 aa]
          Length = 382

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 122/261 (46%), Gaps = 37/261 (14%)

Query: 159 QFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQ---LQPMVQS-WKDISSRMGIPNEFA 214
           QFK+W+ N         L  + L+  + TM ++    L+ M+ +  K   S  GI NE  
Sbjct: 144 QFKRWRANRMINKWFDGLKNSHLRTRMSTMYAIHTKNLEEMLHNEAKQFGSYGGIFNETL 203

Query: 215 KGLNVDL-----VKQNETRKQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYD- 268
             + ++      ++ NE+ ++  +F++ RV+E+  KNE G+R+  L  N EK ++ + D 
Sbjct: 204 NAMKMNPMYKNSIEFNESGEKLRNFIEYRVIEAIYKNEEGIRTT-LFHNYEKALDPNIDK 262

Query: 269 -LELDIDSCRSELRKFQE--SIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIIL 325
              LD ++  S  ++F++  S+ SSV Y LY + +K+ P            +  V ++ +
Sbjct: 263 PFRLDFNNVNS-FQRFEKDGSLISSVTYPLYTN-LKDKPAVV---------VGYVSIVTM 311

Query: 326 DESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDS 385
           ++    I    G   K D             SK    II+I+S +  +  +F+I   G++
Sbjct: 312 NDHPLRINLGSGDIPKVDL------------SKKLKFIISIRSPSEMIPNYFIIDTVGET 359

Query: 386 GDFFSKYQISNVDGSHTEYTL 406
           G  FS Y +      H EYTL
Sbjct: 360 GKIFSHYSVGKTTDGHNEYTL 380

>TPHA0P00670 Chr16 (137985..139127) [1143 bp, 380 aa] {ON} Anc_3.164
           YDL027C
          Length = 380

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 134/337 (39%), Gaps = 49/337 (14%)

Query: 80  FTSKRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFFIIFATASLFTFILTSTXXX 139
           FT+KR FH S     K     + P    +  V I++++P  I     + +  I       
Sbjct: 83  FTTKRHFHQS---HYKLYSMGKRPFFEGRTPVTIFRLTPMKIFLFALTFYVMIFLLVPFI 139

Query: 140 XXXXXXXXXXXXXXXXXXKQFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQS 199
                              Q++KW+ N   K  ++SL +T++     T   L+   +   
Sbjct: 140 LSILLPAAILGYAFF----QYRKWRLNCALKLWVNSLMKTQMHTKFSTFNGLRYSIINSV 195

Query: 200 WKDISSRM----GIPN-EFAKGLNVDLVKQ--NETRKQFLSFLQKRVLESFTKNEMGVRS 252
            KD  S++      PN    + +N D+ +    E   +F  F++ RVLE+F  +E GVRS
Sbjct: 196 EKDARSQVFGFTNTPNGPIFRAMN-DMTRDLSTEASDKFKKFIEARVLEAFVSDEDGVRS 254

Query: 253 YFLGDNVEKW-IENSYDLELDIDSCRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNL 311
               D+  K  I+ S  L +       E  +  E  F + R K Y+      PLS +   
Sbjct: 255 ALASDHTWKQAIKTSRPLGI-------EFGRMVERSFVA-RDKKYMTYA--FPLSINSPS 304

Query: 312 EGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAIKSVNT 371
             + H+  V ++              G++  D              KT+  +I     N+
Sbjct: 305 GSQSHLGRVSIVACHPL-------SAGFNPPD--------------KTNLKLILCIESNS 343

Query: 372 PLSKH-FVITAKGDSGDFFSKYQISNVDGSHTEYTLR 407
            LS   F+I   G +G+FFSKY +      HTEYT++
Sbjct: 344 KLSPDLFIIDTNGMTGEFFSKYDVQKFK-DHTEYTVK 379

>KLLA0C03872g Chr3 complement(353385..354515) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|Q7LHC7 Saccharomyces
           cerevisiae YDL027C Hypothetical ORF
          Length = 376

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 83/362 (22%), Positives = 147/362 (40%), Gaps = 59/362 (16%)

Query: 65  YPLKAVFSPVSSIFKFTSK----------RTFHSSARAEIKFMFSSR-----SPKNGDKP 109
           +PL A  +P  ++  +             R FHS+ R  +      R     SP N  + 
Sbjct: 49  FPLLAALNPRMNLLHYNQNILVSPVKMALRNFHSTPRNMV---LGGRDPFRKSPFNNPR- 104

Query: 110 LVKIYKVSPFFIIFATASLFTFILTSTXXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFY 169
              I+ +SPF  I +T  LF   +T                        QFK ++     
Sbjct: 105 --FIFSISPFSFILSTL-LFAGFITMIVFVLPFLLALLFPMVIFGIGWYQFKAFRTRKLM 161

Query: 170 KDILSSLPRTELKIAVPTMRSL---QLQPMVQSWKDISSRMGIPNEFAKGLNVDLVKQNE 226
           + +  +  +T++K++  T R L   Q+ P  +S+  +    G P + ++    D  +  E
Sbjct: 162 QLLDHAFNQTKMKLSSTTRRELIMKQMVPKFKSFTQLKDFSGFPFKLSQAF-TDKFQSGE 220

Query: 227 --TRKQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQ 284
                +FLSF++ R+ ESF KNE  ++S  LG +   ++    +L  +  S  S +R   
Sbjct: 221 FPNADRFLSFVKSRLDESFYKNEHNIKSIVLGSDTA-YVPGHMELVTNSYSFVSSVRN-N 278

Query: 285 ESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRH-IADVYVIILDESFPEIMFNGGGYSKAD 343
           E+I +   +   L +M +         EG R  +A VY++       E++   G Y    
Sbjct: 279 ENIQA---FSFMLLNMGS---------EGVRKPVALVYIVTKANPGDELLMFTGDY---- 322

Query: 344 FFKILQESETANSSKTHNMIIAIKSVNTPLSKHFVITAKGDSGDFFSKYQISNVDGSHTE 403
                      + SK   M+I ++++ +P SK   IT  G++G   ++Y +        E
Sbjct: 323 ----------IDDSKLSPMVIYVRAL-SPFSKCCFITDVGETGA-NAQYSVKRKKDGSKE 370

Query: 404 YT 405
           YT
Sbjct: 371 YT 372

>KNAG0K01730 Chr11 (362599..363588) [990 bp, 329 aa] {ON} Anc_3.164
           YDL027C
          Length = 329

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 81/371 (21%), Positives = 148/371 (39%), Gaps = 57/371 (15%)

Query: 26  IFNRCSLRQLGTSYRALPKHGMEGFQSYKLSLISHKYRSYPLKAVFSPVSSIFKFTSKRT 85
           I   CS   L +  R L    +E  +  ++  + H   S PL         +     +  
Sbjct: 4   ILGLCSRAGLSSRVRLL---SVEVLRKCQMRTLVHVRDSRPLSVARDTRPRLTVRWPRIL 60

Query: 86  FHSSARAEIKFMFSSRSPKNGDKPLVKI--YKVSPF-FIIFATASLFTFILTSTXXXXXX 142
           F   A   I+  F+ R          KI  Y++S    +IF+T +L  F++         
Sbjct: 61  FKGRANLTIRRNFNERGGGLPQGGGPKIRYYRISMVPLLIFSTVTLMVFVIVLPVLLKLF 120

Query: 143 XXXXXXXXXXXXXXXKQFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPMVQSWKD 202
                           QFKKWQ+N  Y  ++  LP+++L     T +S Q   + +S+  
Sbjct: 121 FPVILVAIIVY-----QFKKWQRNQLYSRLMKYLPKSDLY----TTKS-QFMSLRRSFGL 170

Query: 203 ISSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVLESFTKNEMGVRSYFLGDNVEKW 262
           +S      NE   G +V+          F +F++ R++E+  K+ M +RS  +  +   W
Sbjct: 171 LS------NEAVVGKSVE----------FTNFVKTRIMEALAKDTMKIRSTLIKPS---W 211

Query: 263 IENS-----YDLELDIDSCRSELRKFQ---ESIFSSVRYKLYLDSMKNSPLSPSKNLEGK 314
           I  +     Y L + ++  +   +  Q   +++F SV Y L+  + K    +   +L GK
Sbjct: 212 IPKNAAVEEYQLTIGLNRVKMFAKALQGQSKAVF-SVEYPLFFVT-KLEDRTKQSHLMGK 269

Query: 315 RHIADVYVIILDESFPEIMFNGG-GYSKADFFKILQESETANSSKTHNMIIAIKSVNTPL 373
             +  +Y       +  I+ N    +     FK + ++E    SK   +I  I++  T  
Sbjct: 270 VCLHFLY------DYSSILKNSAKSFDPETLFKQMNDTE----SKVQYVISVIQT-GTLS 318

Query: 374 SKHFVITAKGD 384
            K F++  + D
Sbjct: 319 PKPFILYTRHD 329

>CAGL0K01639g Chr11 complement(146143..147354) [1212 bp, 403 aa]
           {ON} weakly similar to uniprot|Q07349 Saccharomyces
           cerevisiae YDL027c
          Length = 403

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 78/379 (20%), Positives = 151/379 (39%), Gaps = 40/379 (10%)

Query: 24  AGIFNRCSLRQLGTSYRALPKHGMEGFQSYKLSLISHKYRSYPLKAVFSPVSSI------ 77
           +GI  R  LR      + LP    +  Q   L+ ++   +S P     + + +I      
Sbjct: 33  SGIATRNPLRASSLILKGLPNRNAKIVQLLSLTSVTRSTQSLPALRSSNQLLTIPPCQPR 92

Query: 78  -FKFTSKRTFHSSARAEIKFMFSSRSPKNGDKPLVKIYKVSPFFIIFATASLFTFILTST 136
                 KR F+++++  IKF+FS     N +K  +K Y +    +I +T   F  + T  
Sbjct: 93  TLNKVLKRGFYTTSKKSIKFIFSKGDKDNHNK--MKYYSIPTPVVILSTIGGFVLLFTIL 150

Query: 137 XXXXXXXXXXXXXXXXXXXXXKQFKKWQKNIFYKDILSSLPRTELKIAVPTMRSLQLQPM 196
                                 QF++W+ +  YK +   L  +++      M++ QL  M
Sbjct: 151 PFLFTFGFPFLIGMIVFF----QFRRWKTHQLYKKMAEVLQDSQI-----NMKNNQL--M 199

Query: 197 VQSWKDISSRMGIPNEFAKGLNVDLVKQNETRKQFLSFLQKRVLESFTKNEMGVRSYFLG 256
              ++ I   + +   F+      L  + ET    ++ LQ+R+ ESF  N+  + + F+ 
Sbjct: 200 SLKYRLIEQGLPMLTNFSNKTTKQLSSRGET---LINQLQQRIKESFANNDNNIANVFVP 256

Query: 257 DNVEKWIENSYDLELDIDSCRSELRKF-QESIFSSVRYKLYLDSMKNS------PLSPSK 309
               K  E  Y+L L   + +S  +K   +     +   LY+   ++       P+    
Sbjct: 257 QG-HKLSE--YELLLPHHTFKSYTKKLPHDQDIGLLSLSLYMRRRQHRNIKVAMPIPVEL 313

Query: 310 NLEGKRHIADVYVIILDESFPEIMFNGGGYSKADFFKILQESETANSSKTHNMIIAIKSV 369
           NL  K  +A+VY +   ++   ++        A     LQE +++        +I+I  +
Sbjct: 314 NLGNK--VANVYFVYKGDTARGLLNTQILLEAAKAGVDLQEIKSSTQ-----FLISIVPL 366

Query: 370 NTPLSKHFVITAKGDSGDF 388
           ++ L   ++I   G  G F
Sbjct: 367 DSWLPTQYIIADAGSLGSF 385

>SAKL0G00616g Chr7 complement(59495..60487) [993 bp, 330 aa] {ON}
           similar to uniprot|P41834 Saccharomyces cerevisiae
           YOR075W UFE1 t-SNARE that resides on the endoplasmic
           reticulum and mediates retrograde traffic from the Golgi
           complex potential Cdc28p substrate endoplasmic reticulum
           t- SNARE coprecipitates with Sec20p Tip1p. and Sec22p
          Length = 330

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%)

Query: 245 KNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFSSVRYKLYL 297
           +NE+        +N+   ++N  D+E+DI     +LRK QE    S R   YL
Sbjct: 263 QNELATHLQVQTENINTLLDNHDDIEVDIQQGNKQLRKAQERGGKSARMITYL 315

>Ecym_4041 Chr4 complement(90697..91689) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii ADR220W
          Length = 330

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 220 DLVKQNETRKQFLSFLQKRVLESFT-KNEMGVRSYFLGDNVEKWIENSYDLELDIDSCRS 278
           +L+ Q     + +  L K V+E  + +NE+         N+   ++N+ D+ELDI     
Sbjct: 237 ELLNQKSQELERVQKLSKAVMEVASLQNELSTHLQIQTQNINTLLDNNDDVELDIQQGNR 296

Query: 279 ELRKFQESIFSSVRYKLYL 297
           +LRK Q+    S +  +Y+
Sbjct: 297 QLRKAQDRGGKSAKLVIYM 315

>Suva_8.423 Chr8 (763701..764351) [651 bp, 216 aa] {ON} YOR367W
           (REAL)
          Length = 216

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 251 RSYFLGDNVEKWIENSYDLELDIDSCRSELRKFQESIFS 289
           R Y  G   +K++  SYD + D+ S   +LR+ ++S FS
Sbjct: 3   RRYCDGGRTKKYLPMSYDKKADVTSLDEDLRQLRQSKFS 41

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
           {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 35/84 (41%), Gaps = 2/84 (2%)

Query: 274 DSCRSELRKFQESIFSSVRYKLYLDSMKNSPLSPSKNLEGKRHIADVYVIILDESFPEIM 333
           DS + +L   QE  ++  R  +  D  K    SP   L       DVY II +E     M
Sbjct: 326 DSMKDKLHDLQEKNYTKDR--IARDRFKELLRSPEIRLRANSRWQDVYPIIKNEPRFLNM 383

Query: 334 FNGGGYSKADFFKILQESETANSS 357
              GG S  D F  + E ++ N S
Sbjct: 384 LGTGGSSALDLFLDVVEEKSINMS 407

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,873,872
Number of extensions: 1695125
Number of successful extensions: 5161
Number of sequences better than 10.0: 30
Number of HSP's gapped: 5288
Number of HSP's successfully gapped: 30
Length of query: 408
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 296
Effective length of database: 40,638,807
Effective search space: 12029086872
Effective search space used: 12029086872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)