Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.2233.162ON76976937210.0
Suva_4.2213.162ON76576931780.0
YDL028C (MPS1)3.162ON76476931410.0
Smik_4.2073.162ON76576931250.0
TDEL0D046003.162ON79578617040.0
ZYRO0B04906g3.162ON84782817090.0
NCAS0I020803.162ON77477716500.0
KLTH0F06468g3.162ON83782115690.0
Kwal_33.141673.162ON83883015430.0
ADR317C3.162ON81982115210.0
KAFR0F022203.162ON74777215100.0
CAGL0K01617g3.162ON77480314150.0
TPHA0M003003.162ON77479114020.0
KLLA0C03828g3.162ON79376813571e-176
Kpol_1032.103.162ON79142213211e-171
Ecym_52363.162ON86443913211e-170
SAKL0C07348g3.162ON86135712701e-162
NDAI0A066203.162ON74736612231e-157
TBLA0F008603.162ON98036112091e-152
KNAG0K017403.162ON76535711231e-142
NCAS0C035603.162ON6416459351e-115
KNAG0E008506.31ON7113182735e-24
Kwal_56.224766.31ON6973132726e-24
KLTH0C10912g6.31ON6973132691e-23
YHR102W (KIC1)5.406ON10802992693e-23
KNAG0F002901.52ON11252932666e-23
Kpol_1037.206.31ON7043052637e-23
Smik_8.1805.406ON10732992631e-22
CAGL0K05709g1.52ON11032932631e-22
NDAI0C026806.31ON7503082612e-22
Skud_8.1635.406ON10762992603e-22
KAFR0G026906.31ON7133422574e-22
KLTH0E11220g8.482ON3023182455e-22
Suva_15.2975.406ON10742992576e-22
KLLA0F24618g3.229ON5562912511e-21
KLTH0D03454g1.271ON14333362551e-21
KAFR0D049505.406ON10082962532e-21
TPHA0J004206.31ON7073122512e-21
CAGL0L12474g8.482ON3023122402e-21
YDR490C (PKH1)3.92ON7663172512e-21
Kwal_26.73551.271ON14463442532e-21
KLLA0D11990g8.482ON3043202402e-21
ZYRO0F08074g8.482ON3043162403e-21
KNAG0B043205.406ON10272982523e-21
CAGL0L11550g5.406ON10722992523e-21
Smik_13.1596.31ON7053582503e-21
TDEL0G043806.31ON7223122503e-21
NDAI0C017005.406ON10202982513e-21
ACL006W6.31ON7082982503e-21
YDR507C (GIN4)1.52ON11422952513e-21
SAKL0H11638g8.482ON3043182393e-21
Skud_13.1546.31ON7053342494e-21
Skud_4.7643.92ON7563462494e-21
NDAI0G054701.271ON15553162514e-21
YMR001C (CDC5)6.31ON7053332485e-21
Suva_13.1636.31ON7053332486e-21
TDEL0B015408.482ON3043182376e-21
NCAS0H019405.406ON10152982487e-21
Skud_16.2518.482ON3052342377e-21
Ecym_30356.31ON7402982468e-21
TBLA0B016303.177ON12952882489e-21
KLLA0F14190g1.271ON13383522471e-20
Kpol_463.81.271ON14472922471e-20
Suva_16.2868.482ON3053202351e-20
TBLA0A071501.52ON13912602471e-20
TPHA0C017808.482ON3053232351e-20
Ecym_10301.24ON4402852401e-20
NCAS0C024708.482ON3113182351e-20
Smik_4.7891.52ON11362252461e-20
NCAS0D021006.31ON7263052442e-20
KNAG0A023108.482ON3023172342e-20
KAFR0K007007.86ON13812232452e-20
TDEL0E021805.406ON9872832452e-20
NDAI0A006601.52ON10222252452e-20
TBLA0A035705.406ON9752982442e-20
YPL031C (PHO85)8.482ON3052322332e-20
Ecym_25318.482ON3013172332e-20
ZYRO0C07480g6.31ON7743132432e-20
Suva_2.6871.52ON11282252442e-20
KAFR0D041001.52ON11172252442e-20
KAFR0H015308.482ON3063182323e-20
Smik_4.7673.92ON7582992423e-20
TPHA0I009201.271ON14343242434e-20
Kpol_1031.105.406ON11272982424e-20
KLLA0C06138g6.31ON7082902414e-20
Suva_2.6663.92ON7643002414e-20
NDAI0F045201.24ON4893172384e-20
Smik_2.1463.229ON5262352385e-20
CAGL0K08514g2.479ON14892252416e-20
AFR724C1.24ON4402852356e-20
TBLA0B004906.31ON7873052397e-20
Kpol_2002.461.52ON11232252407e-20
SAKL0E01584g6.31ON6952982387e-20
KLTH0F16676g5.406ON8782982399e-20
Kwal_55.215455.406ON8653122389e-20
NCAS0B086001.52ON11172252391e-19
Skud_2.1413.229ON5262302351e-19
Kpol_1007.178.482ON3073202271e-19
ABL034W2.479ON14252082381e-19
TPHA0H016305.406ON10363272381e-19
TBLA0C029401.271ON16433552381e-19
Skud_3.1656.371ON7163142361e-19
Kwal_56.227883.229ON5153502332e-19
NDAI0A038702.496ON8952842362e-19
SAKL0D05522g1.271ON14743182372e-19
Ecym_63441.271ON13973122372e-19
SAKL0C01716g1.52ON12152252362e-19
TDEL0D039503.229ON4933552322e-19
KLTH0A06776g6.341ON15232352362e-19
Skud_4.7831.52ON11352252362e-19
ACL104C5.406ON9473052353e-19
KNAG0B017801.271ON15803162363e-19
Kpol_1023.266.31ON7393042343e-19
YBR028C (YPK3)3.229ON5252352323e-19
TBLA0I018003.229ON6292382333e-19
KLTH0C08932g3.229ON5193182313e-19
TDEL0C064901.52ON11533152353e-19
KAFR0E010403.229ON5023082313e-19
NCAS0C049403.92ON11162272343e-19
KAFR0A014201.271ON13983542344e-19
ZYRO0A06446g5.406ON9433002335e-19
TPHA0M018406.341ON16213652345e-19
TPHA0E036401.52ON11372252335e-19
CAGL0J11638g6.31ON7463272325e-19
NDAI0E021108.676ON9033162335e-19
SAKL0G01848g5.406ON8852972325e-19
TPHA0G032002.479ON15342112336e-19
YOL100W (PKH2)3.92ON10812312326e-19
Kwal_23.63256.341ON15422352336e-19
TPHA0H026307.86ON13672242328e-19
NCAS0A053706.341ON15083092319e-19
Suva_2.1573.229ON5262342289e-19
Kpol_1040.207.86ON12972242301e-18
AFR092W1.271ON14233112301e-18
Smik_3.1896.371ON7193672272e-18
NCAS0A094701.271ON15153162292e-18
SAKL0H06534g8.676ON8042902272e-18
AER264C6.341ON14833172282e-18
CAGL0I07513g3.92ON10762302282e-18
SAKL0C00946g1.24ON5642812252e-18
TBLA0B023103.92ON8192252272e-18
YCR091W (KIN82)6.371ON7203142262e-18
AFR696C1.52ON11422252272e-18
YAL017W (PSK1)7.86ON13562232273e-18
Smik_6.1254.184ON3683252203e-18
KNAG0J012903.229ON5083242243e-18
TDEL0D014001.271ON14293812273e-18
Kpol_1028.166.371ON8793142263e-18
AEL083W3.229ON5363072243e-18
Skud_3.391.52ON10173122263e-18
NDAI0K023906.371ON8863052263e-18
Skud_3.1466.341ON13342652263e-18
ZYRO0G15290g1.271ON14873182263e-18
Suva_1.507.86ON13602232264e-18
KLLA0C01650g1.52ON11122252264e-18
Smik_1.507.86ON13572232264e-18
CAGL0C03509g6.371ON8953212254e-18
Ecym_35473.229ON5373072224e-18
Kpol_1072.168.676ON7952822244e-18
ZYRO0A03894g3.229ON4523332214e-18
YNR047W (FPK1)6.371ON8933542245e-18
TBLA0H016605.406ON9963002245e-18
Smik_3.541.52ON10322252245e-18
KNAG0K006803.92ON10953472246e-18
Skud_1.447.86ON13562232246e-18
Ecym_61454.184ON3653252176e-18
Smik_10.1471.271ON14783162246e-18
NCAS0A102903.229ON5092312216e-18
TDEL0A025502.479ON13692032246e-18
CAGL0K02673g2.496ON9152382236e-18
NDAI0E031708.482ON3232382156e-18
NCAS0A057702.479ON14612702247e-18
Suva_6.1691.271ON14843162247e-18
Ecym_55055.406ON10033052237e-18
Smik_14.3776.371ON8953822237e-18
Kpol_1037.523.229ON5122172207e-18
KLLA0F11143g8.676ON8133112228e-18
Kwal_27.118038.482ON2462512091e-17
TDEL0A062208.676ON7942992211e-17
NDAI0K021002.496ON9093002221e-17
NDAI0I002506.371ON8973302221e-17
Skud_10.1191.271ON14813482221e-17
Suva_7.3254.184ON3683252151e-17
NCAS0D047106.371ON8043022211e-17
KAFR0D012207.86ON10552282211e-17
Smik_15.573.92ON10812302211e-17
KLLA0C04191g3.177ON7972872201e-17
YJL095W (BCK1)1.271ON14783162211e-17
KLLA0C12485g3.92ON9252942201e-17
CAGL0G04609g3.92ON9652922202e-17
TPHA0A041703.229ON5132082172e-17
NDAI0G042903.92ON11133152202e-17
Kwal_33.131121.24ON5052812172e-17
CAGL0L03520g1.271ON14473102212e-17
NCAS0A055706.371ON9182942202e-17
Ecym_73922.479ON14342082202e-17
ZYRO0F17402g1.52ON11892252202e-17
TDEL0C067801.24ON4682912162e-17
KNAG0D003906.341ON16562412212e-17
Skud_7.3374.184ON3683242132e-17
Kpol_431.92.479ON15522242202e-17
KLLA0E21693g5.406ON10163132202e-17
KLLA0F13552g2.479ON12673022202e-17
Ecym_35863.92ON10772262192e-17
Ecym_24996.341ON15413182202e-17
TDEL0A078606.371ON8373232192e-17
YGR040W (KSS1)4.184ON3683252132e-17
ACR142W8.676ON8373792192e-17
KLLA0F07623g7.86ON12292242192e-17
NDAI0I003406.341ON18363222202e-17
Kwal_26.78612.496ON9552842182e-17
TDEL0A075606.341ON15753552192e-17
TBLA0A016308.482ON3512542113e-17
SAKL0C08844g3.229ON5312282163e-17
ZYRO0G03366g2.479ON16162112193e-17
Smik_3.1736.341ON13403012193e-17
NCAS0A050502.496ON8932832173e-17
KAFR0A017602.496ON8853022173e-17
Kpol_1037.63.177ON9772822173e-17
Sklu_YGOB_Anc_2.4962.496ON6192982163e-17
ZYRO0B06512g3.92ON11112222183e-17
KLTH0G17512g4.184ON3653192113e-17
TPHA0M020806.371ON8893142174e-17
TBLA0I011502.479ON17452112184e-17
NCAS0F015807.86ON13822232174e-17
TBLA0I002802.496ON13162832174e-17
TBLA0F002406.371ON12483102174e-17
CAGL0B04301g3.229ON5423242145e-17
NDAI0G034508.141ON9482652165e-17
Skud_1.723.177ON9742812165e-17
AGL242C8.482ON3032392075e-17
YOL045W (PSK2)7.86ON11012242166e-17
KAFR0C009303.177ON9363352156e-17
Smik_1.793.177ON9742812156e-17
KNAG0K012403.177ON9802892156e-17
Kpol_2002.241.24ON4872822126e-17
YAR019C (CDC15)3.177ON9742812156e-17
Kwal_26.71547.86ON12132242157e-17
TPHA0H023906.371ON7302962147e-17
SAKL0C09174g3.92ON10712262158e-17
Ecym_10581.52ON11642252158e-17
Skud_14.3796.371ON8973542148e-17
Kwal_14.14164.184ON3653212088e-17
Kpol_1055.242.496ON9373022149e-17
ZYRO0D17468g6.371ON8603502131e-16
SAKL0B04488g4.184ON3683272071e-16
KLTH0F01672g1.52ON11642252141e-16
NCAS0A080805.611ON6233382121e-16
KLTH0C09548g3.92ON9932272131e-16
Suva_7.828.141ON9003592131e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.223
         (769 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...  1437   0.0  
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...  1228   0.0  
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...  1214   0.0  
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...  1208   0.0  
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   660   0.0  
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   662   0.0  
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    640   0.0  
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   608   0.0  
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   598   0.0  
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   590   0.0  
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   586   0.0  
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   549   0.0  
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   544   0.0  
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   527   e-176
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   513   e-171
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   513   e-170
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   493   e-162
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   475   e-157
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   470   e-152
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   437   e-142
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...   364   e-115
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   109   5e-24
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   109   6e-24
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   108   1e-23
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   108   3e-23
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   107   6e-23
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   105   7e-23
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   105   1e-22
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   105   1e-22
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   105   2e-22
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   104   3e-22
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   103   4e-22
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    99   5e-22
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   103   6e-22
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   101   1e-21
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   102   1e-21
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   102   2e-21
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   101   2e-21
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    97   2e-21
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   101   2e-21
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   102   2e-21
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    97   2e-21
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    97   3e-21
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   101   3e-21
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   101   3e-21
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   100   3e-21
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   100   3e-21
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   101   3e-21
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   100   3e-21
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   101   3e-21
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    97   3e-21
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   100   4e-21
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   100   4e-21
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   101   4e-21
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   100   5e-21
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   100   6e-21
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    96   6e-21
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   100   7e-21
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    96   7e-21
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    99   8e-21
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   100   9e-21
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   100   1e-20
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   100   1e-20
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    95   1e-20
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   100   1e-20
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    95   1e-20
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    97   1e-20
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    95   1e-20
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    99   1e-20
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      99   2e-20
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    95   2e-20
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    99   2e-20
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    99   2e-20
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     99   2e-20
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    99   2e-20
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    94   2e-20
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    94   2e-20
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    98   2e-20
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    99   2e-20
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    99   2e-20
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    94   3e-20
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    98   3e-20
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    98   4e-20
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    98   4e-20
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    97   4e-20
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    97   4e-20
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    96   4e-20
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    96   5e-20
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    97   6e-20
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    95   6e-20
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    97   7e-20
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    97   7e-20
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    96   7e-20
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    97   9e-20
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    96   9e-20
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    97   1e-19
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    95   1e-19
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    92   1e-19
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    96   1e-19
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    96   1e-19
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    96   1e-19
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    96   1e-19
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    94   2e-19
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     96   2e-19
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    96   2e-19
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    96   2e-19
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    96   2e-19
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    94   2e-19
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    96   2e-19
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    96   2e-19
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    95   3e-19
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    96   3e-19
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    95   3e-19
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    94   3e-19
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    94   3e-19
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    94   3e-19
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    95   3e-19
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    94   3e-19
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    95   3e-19
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    95   4e-19
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    94   5e-19
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    95   5e-19
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    94   5e-19
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    94   5e-19
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    94   5e-19
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    94   5e-19
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    94   6e-19
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    94   6e-19
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    94   6e-19
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    94   8e-19
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    94   9e-19
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    92   9e-19
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    93   1e-18
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    93   1e-18
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    92   2e-18
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    93   2e-18
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    92   2e-18
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    92   2e-18
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    92   2e-18
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    91   2e-18
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    92   2e-18
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    92   2e-18
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    92   2e-18
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    92   3e-18
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    89   3e-18
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    91   3e-18
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    92   3e-18
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    92   3e-18
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    91   3e-18
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    92   3e-18
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    92   3e-18
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    92   3e-18
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    92   3e-18
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    92   4e-18
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    92   4e-18
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    92   4e-18
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    91   4e-18
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    90   4e-18
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    91   4e-18
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    90   4e-18
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    91   5e-18
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    91   5e-18
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    91   5e-18
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    91   6e-18
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    91   6e-18
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    88   6e-18
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    91   6e-18
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    90   6e-18
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    91   6e-18
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    91   6e-18
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    87   6e-18
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    91   7e-18
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    91   7e-18
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    91   7e-18
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    91   7e-18
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    89   7e-18
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    90   8e-18
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    85   1e-17
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    90   1e-17
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    90   1e-17
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    90   1e-17
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    90   1e-17
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    87   1e-17
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    90   1e-17
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    90   1e-17
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    90   1e-17
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    89   1e-17
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    90   1e-17
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    89   1e-17
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    89   2e-17
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    88   2e-17
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    89   2e-17
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    88   2e-17
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    90   2e-17
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    89   2e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    89   2e-17
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    89   2e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    88   2e-17
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    90   2e-17
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    87   2e-17
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    89   2e-17
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    89   2e-17
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    89   2e-17
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    89   2e-17
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    89   2e-17
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    89   2e-17
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    87   2e-17
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    89   2e-17
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    89   2e-17
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      89   2e-17
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    89   2e-17
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    89   2e-17
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    86   3e-17
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    88   3e-17
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    89   3e-17
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    89   3e-17
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    88   3e-17
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    88   3e-17
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    88   3e-17
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    88   3e-17
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    89   3e-17
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    86   3e-17
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    88   4e-17
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    89   4e-17
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    88   4e-17
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    88   4e-17
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    88   4e-17
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    87   5e-17
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     88   5e-17
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    88   5e-17
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    84   5e-17
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    88   6e-17
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    87   6e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    87   6e-17
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    87   6e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    86   6e-17
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    87   6e-17
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    87   7e-17
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    87   7e-17
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    87   8e-17
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    87   8e-17
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    87   8e-17
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    85   8e-17
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    87   9e-17
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    87   1e-16
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    84   1e-16
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    87   1e-16
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    86   1e-16
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    87   1e-16
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    87   1e-16
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    87   1e-16
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    84   1e-16
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    86   1e-16
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    86   1e-16
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    87   1e-16
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    86   1e-16
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    86   1e-16
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    85   2e-16
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    86   2e-16
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    86   2e-16
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    86   2e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    86   2e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    85   2e-16
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    85   2e-16
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    86   2e-16
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    86   2e-16
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    86   2e-16
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    86   2e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    84   2e-16
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    86   2e-16
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    86   2e-16
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    86   2e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    86   3e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        85   3e-16
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    86   3e-16
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    85   3e-16
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    86   3e-16
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    85   3e-16
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    86   3e-16
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    85   3e-16
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    85   3e-16
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     83   3e-16
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    85   3e-16
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    83   3e-16
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    85   3e-16
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    85   3e-16
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    84   3e-16
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    85   3e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    85   3e-16
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    85   3e-16
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    85   4e-16
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    85   4e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    85   4e-16
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    85   4e-16
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    85   4e-16
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    85   4e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    84   4e-16
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               85   5e-16
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    84   5e-16
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    82   5e-16
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    85   5e-16
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    84   5e-16
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    84   6e-16
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    84   6e-16
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    80   6e-16
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    84   6e-16
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    84   6e-16
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    84   7e-16
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    83   7e-16
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    83   7e-16
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    82   7e-16
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    82   8e-16
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    84   8e-16
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    84   8e-16
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    84   9e-16
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    84   9e-16
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    83   9e-16
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    83   9e-16
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    84   9e-16
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    82   1e-15
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    82   1e-15
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     83   1e-15
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    84   1e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    84   1e-15
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    83   1e-15
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    83   1e-15
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    83   1e-15
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    82   1e-15
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    82   1e-15
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    83   1e-15
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    83   1e-15
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    83   1e-15
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    83   1e-15
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    82   2e-15
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               83   2e-15
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    81   2e-15
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    82   2e-15
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    83   2e-15
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    83   2e-15
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    81   2e-15
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    82   2e-15
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    83   2e-15
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    82   2e-15
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    82   2e-15
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    82   2e-15
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    82   2e-15
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    82   2e-15
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    82   3e-15
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    82   3e-15
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    82   3e-15
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    82   3e-15
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    82   3e-15
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    82   3e-15
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    81   3e-15
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    82   3e-15
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    82   3e-15
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    82   3e-15
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               81   4e-15
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    82   4e-15
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    82   4e-15
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    82   4e-15
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              82   4e-15
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    81   5e-15
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    81   5e-15
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    82   5e-15
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     81   5e-15
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    80   5e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    81   5e-15
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    80   5e-15
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    82   5e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    81   5e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    81   6e-15
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    81   6e-15
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    80   6e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    81   7e-15
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    81   7e-15
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    81   7e-15
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    81   7e-15
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    80   7e-15
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    80   7e-15
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    79   7e-15
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    80   7e-15
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    79   7e-15
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    80   7e-15
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    80   8e-15
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    79   8e-15
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    80   8e-15
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    80   8e-15
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    81   8e-15
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    80   9e-15
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    80   9e-15
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    79   9e-15
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    79   9e-15
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    80   9e-15
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    79   9e-15
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    80   9e-15
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    79   1e-14
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    80   1e-14
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    80   1e-14
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    80   1e-14
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    80   1e-14
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    80   1e-14
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    80   1e-14
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    80   1e-14
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    80   1e-14
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    79   1e-14
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    79   1e-14
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    80   1e-14
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    80   1e-14
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    79   1e-14
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    79   1e-14
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    78   1e-14
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    80   1e-14
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    79   1e-14
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    79   1e-14
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    79   1e-14
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    80   1e-14
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    80   2e-14
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    78   2e-14
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    79   2e-14
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    79   2e-14
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    78   2e-14
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    79   2e-14
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    79   2e-14
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               79   2e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    79   2e-14
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    77   2e-14
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    79   2e-14
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    79   2e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    79   2e-14
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     77   2e-14
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    78   2e-14
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    78   2e-14
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    78   2e-14
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    79   2e-14
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    79   2e-14
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    78   2e-14
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    76   2e-14
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    78   2e-14
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    79   2e-14
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    79   2e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    79   3e-14
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    79   3e-14
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    78   3e-14
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    79   3e-14
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    79   3e-14
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    78   3e-14
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    77   3e-14
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    77   3e-14
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    77   3e-14
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    79   3e-14
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    78   3e-14
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    77   3e-14
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    78   3e-14
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    77   3e-14
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    79   4e-14
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    77   4e-14
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    79   4e-14
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    77   4e-14
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    79   4e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    78   4e-14
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    78   4e-14
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    77   4e-14
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    78   4e-14
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    78   4e-14
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    78   4e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    78   4e-14
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    78   4e-14
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    78   4e-14
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    77   4e-14
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    77   5e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    78   5e-14
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    78   5e-14
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    77   5e-14
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    76   5e-14
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    78   6e-14
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    77   6e-14
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    76   6e-14
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    78   6e-14
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    76   6e-14
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    77   6e-14
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    78   7e-14
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    76   7e-14
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    77   7e-14
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    77   7e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    77   7e-14
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    78   7e-14
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    77   7e-14
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    77   8e-14
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    76   8e-14
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    77   8e-14
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    77   9e-14
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    75   9e-14
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    75   9e-14
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    76   9e-14
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    77   9e-14
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    77   9e-14
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    75   9e-14
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    77   1e-13
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    77   1e-13
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    77   1e-13
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    77   1e-13
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    77   1e-13
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    77   1e-13
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    76   1e-13
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    77   1e-13
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    75   1e-13
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              74   1e-13
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              76   1e-13
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    77   1e-13
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    77   1e-13
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    75   1e-13
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              77   1e-13
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    77   1e-13
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    77   1e-13
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    75   1e-13
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    76   1e-13
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    77   1e-13
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    76   1e-13
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    75   1e-13
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    76   1e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    77   1e-13
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              76   1e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   1e-13
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    76   2e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    75   2e-13
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    76   2e-13
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    75   2e-13
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    76   2e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    77   2e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    76   2e-13
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    75   2e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    77   2e-13
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    75   2e-13
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    75   2e-13
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    75   2e-13
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    75   2e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    76   2e-13
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    75   2e-13
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    75   2e-13
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    76   2e-13
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    75   2e-13
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    75   2e-13
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    75   2e-13
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    76   2e-13
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    75   2e-13
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    75   2e-13
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    75   2e-13
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    75   3e-13
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    76   3e-13
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     75   3e-13
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    75   3e-13
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    74   3e-13
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    75   3e-13
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    75   3e-13
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    75   3e-13
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    75   3e-13
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    74   3e-13
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    73   3e-13
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     75   3e-13
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    75   3e-13
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    75   3e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       75   3e-13
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    74   3e-13
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    75   3e-13
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    75   4e-13
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    74   4e-13
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    75   4e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   4e-13
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             75   4e-13
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    74   4e-13
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    75   4e-13
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    75   4e-13
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    75   4e-13
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    74   4e-13
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    75   4e-13
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     74   4e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   4e-13
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    75   4e-13
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    74   4e-13
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    74   4e-13
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    75   4e-13
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    75   4e-13
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    74   4e-13
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    75   5e-13
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    74   5e-13
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    75   5e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    75   5e-13
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    74   5e-13
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    74   5e-13
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    75   5e-13
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    74   5e-13
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    74   5e-13
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               74   6e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    74   6e-13
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    74   6e-13
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    75   6e-13
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    74   6e-13
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    72   6e-13
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    74   6e-13
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    74   7e-13
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    74   7e-13
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    74   7e-13
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    74   7e-13
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    74   7e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    74   7e-13
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    75   7e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    74   7e-13
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    74   7e-13
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    74   7e-13
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    74   7e-13
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    73   7e-13
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    74   8e-13
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    74   8e-13
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    73   8e-13
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    74   8e-13
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    74   8e-13
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    74   8e-13
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    74   8e-13
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    73   8e-13
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    74   8e-13
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    74   9e-13
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    72   9e-13
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    74   9e-13
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    74   9e-13
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    72   1e-12
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    74   1e-12
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    72   1e-12
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    74   1e-12
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    72   1e-12
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    73   1e-12
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               74   1e-12
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    74   1e-12
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    72   1e-12
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    72   1e-12
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    74   1e-12
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    73   1e-12
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    74   1e-12
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    73   1e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    74   1e-12
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     73   1e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    73   1e-12
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    73   1e-12
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    73   1e-12
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    72   1e-12
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    73   1e-12
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     72   1e-12
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    71   2e-12
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    73   2e-12
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    73   2e-12
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    71   2e-12
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    72   2e-12
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    73   2e-12
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    70   2e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    73   2e-12
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    72   2e-12
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    73   2e-12
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    72   2e-12
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    73   2e-12
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    70   2e-12
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    73   2e-12
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    71   2e-12
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    73   2e-12
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    71   2e-12
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    73   2e-12
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    72   2e-12
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    73   2e-12
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     72   2e-12
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    72   2e-12
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    72   2e-12
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    72   2e-12
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    73   2e-12
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    72   2e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    72   2e-12
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    72   2e-12
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    72   3e-12
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    72   3e-12
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    72   3e-12
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    72   3e-12
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    72   3e-12
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    71   3e-12
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    72   3e-12
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    72   3e-12
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    72   3e-12
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    72   3e-12
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    72   3e-12
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             72   3e-12
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    72   3e-12
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    72   3e-12
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    72   3e-12
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    72   3e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    72   3e-12
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    71   3e-12
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    72   3e-12
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    70   3e-12
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    72   3e-12
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    71   4e-12
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    72   4e-12
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    71   4e-12
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    72   4e-12
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    72   4e-12
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    72   4e-12
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    72   4e-12
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    72   4e-12
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    72   4e-12
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    72   4e-12
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    69   4e-12
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    72   4e-12
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    71   4e-12
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       72   4e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    70   4e-12
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    72   5e-12
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    71   5e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    72   5e-12
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    72   5e-12
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    71   5e-12
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    71   5e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    71   5e-12
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       70   5e-12
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    71   5e-12
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    71   5e-12
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    71   5e-12
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    71   6e-12
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    71   6e-12
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    71   6e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    71   6e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    71   6e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    71   6e-12
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    71   6e-12
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    69   7e-12
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    71   7e-12
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    70   7e-12
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    70   7e-12
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     70   7e-12
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    71   7e-12
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    71   7e-12
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    70   7e-12
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    69   7e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    71   7e-12
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    71   8e-12
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    70   8e-12
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    70   8e-12
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    70   8e-12
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    71   8e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    71   8e-12
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    69   8e-12
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    69   9e-12
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    70   9e-12
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    71   9e-12
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    70   9e-12
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    70   9e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    70   9e-12
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    70   1e-11
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    70   1e-11
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    70   1e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    70   1e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    70   1e-11
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    70   1e-11
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    68   1e-11
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    69   1e-11
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    70   1e-11
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    70   1e-11
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    70   1e-11
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    70   1e-11
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    70   1e-11
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    69   1e-11
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    70   1e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    70   1e-11
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    70   1e-11
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    68   1e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    70   1e-11
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    70   1e-11
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    70   1e-11
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    70   1e-11
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    69   1e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    70   1e-11
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    69   1e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    70   1e-11
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    70   1e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    70   1e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    70   1e-11
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              70   2e-11
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    70   2e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    70   2e-11
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    70   2e-11
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    69   2e-11
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    69   2e-11
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    69   2e-11
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    69   2e-11
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    69   2e-11
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    69   2e-11
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     69   2e-11
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    69   2e-11
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    70   2e-11
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    69   2e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    70   2e-11
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    70   2e-11
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    68   2e-11
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    69   2e-11
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    70   2e-11
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    69   2e-11
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    69   2e-11
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               69   2e-11
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    69   2e-11
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    69   2e-11
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    69   2e-11
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    69   2e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    69   2e-11
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    68   2e-11
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    66   2e-11
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    69   2e-11
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    67   2e-11
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    68   2e-11
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    69   2e-11
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    69   2e-11
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    68   2e-11
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    69   2e-11
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    69   2e-11
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    69   2e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    69   2e-11
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    69   2e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    69   3e-11
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    69   3e-11
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    69   3e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    69   3e-11
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    68   3e-11
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    69   3e-11
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    69   3e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    69   3e-11
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    69   3e-11
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    69   3e-11
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    69   3e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    69   3e-11
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    69   3e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    69   3e-11
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    69   3e-11
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    69   3e-11
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    67   3e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    69   3e-11
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    69   3e-11
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    67   4e-11
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    67   4e-11
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    69   4e-11
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    67   4e-11
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    69   4e-11
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    68   4e-11
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    68   4e-11
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    69   4e-11
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    69   4e-11
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    68   4e-11
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    69   4e-11
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    67   4e-11
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    67   4e-11
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    68   4e-11
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    69   4e-11
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    69   4e-11
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    67   4e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    69   4e-11
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    68   4e-11
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    69   4e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    68   4e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    68   5e-11
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    68   5e-11
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    68   5e-11
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    68   5e-11
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    68   5e-11
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    67   5e-11
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    68   5e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     68   5e-11
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    68   5e-11
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    69   5e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    67   5e-11
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    66   5e-11
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    68   5e-11
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    68   6e-11
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    68   6e-11
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    67   6e-11
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    67   6e-11
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    67   6e-11
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    66   6e-11
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    68   6e-11
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    68   6e-11
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    68   6e-11
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    67   6e-11
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    67   6e-11
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    67   6e-11
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    66   7e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    68   7e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    68   7e-11
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    67   7e-11
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    68   7e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    68   7e-11
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    68   7e-11
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    67   7e-11
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    67   8e-11
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    67   8e-11
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    67   8e-11
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    65   8e-11
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    67   8e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    67   8e-11
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    67   8e-11
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     66   8e-11
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    66   8e-11
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    68   8e-11
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    67   8e-11
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    68   8e-11
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    67   8e-11
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    66   9e-11
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    67   9e-11
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    67   9e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    67   9e-11
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    67   9e-11
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    67   9e-11
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    67   9e-11
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    67   9e-11
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     67   9e-11
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               66   9e-11
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    66   9e-11
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    67   9e-11
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    66   9e-11
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    67   9e-11
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    67   1e-10
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    65   1e-10
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    67   1e-10
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    66   1e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    67   1e-10
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    67   1e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    67   1e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    67   1e-10
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    67   1e-10
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    67   1e-10
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    67   1e-10
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    67   1e-10
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    66   1e-10
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    67   1e-10
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    66   1e-10
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    67   1e-10
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    67   1e-10
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    66   1e-10
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    67   1e-10
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    65   1e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    66   1e-10
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    67   1e-10
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    66   1e-10
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    66   1e-10
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    67   1e-10
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    66   1e-10
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    67   1e-10
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    67   1e-10
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    65   1e-10
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    66   1e-10
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    67   2e-10
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    66   2e-10
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    65   2e-10
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    66   2e-10
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    67   2e-10
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               67   2e-10
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    66   2e-10
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    67   2e-10
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    66   2e-10
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    66   2e-10
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    66   2e-10
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    65   2e-10
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    66   2e-10
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    65   2e-10
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    65   2e-10
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    65   2e-10
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    65   2e-10
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    66   2e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    66   2e-10
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    65   2e-10
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    65   2e-10
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    66   2e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    67   2e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    66   2e-10
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    66   2e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   2e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    66   2e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    66   2e-10
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    65   2e-10
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    66   2e-10
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    66   2e-10
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    65   2e-10
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    65   2e-10
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    66   2e-10
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    66   2e-10
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    66   2e-10
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    66   2e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    66   2e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    66   2e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    66   2e-10
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    65   3e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     66   3e-10
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    66   3e-10
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    65   3e-10
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    66   3e-10
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    65   3e-10
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    65   3e-10
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    65   3e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               65   3e-10
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    65   3e-10
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    66   3e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    66   3e-10
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    65   3e-10
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    65   3e-10
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    66   3e-10
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    65   3e-10
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    64   3e-10
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    65   4e-10
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    64   4e-10
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    64   4e-10
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    65   4e-10
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    64   4e-10
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    65   4e-10
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    65   4e-10
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    64   4e-10
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    65   4e-10
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    65   4e-10
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    65   4e-10
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    64   4e-10
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    65   4e-10
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    65   4e-10
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    65   4e-10
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    65   4e-10
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    65   4e-10
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    64   4e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    65   4e-10
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    64   5e-10
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    65   5e-10
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    64   5e-10
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    65   5e-10
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    65   5e-10
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    65   5e-10
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    65   5e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   5e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    65   5e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    65   5e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    65   5e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    64   6e-10
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    64   6e-10
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    64   6e-10
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    63   6e-10
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    65   6e-10
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    65   6e-10
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    64   7e-10
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    64   7e-10
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    64   7e-10
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    65   7e-10
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    64   7e-10
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    64   7e-10
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    64   7e-10
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    64   7e-10
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    64   8e-10
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    63   8e-10
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              65   8e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    64   8e-10
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    64   8e-10
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    64   8e-10
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    63   8e-10
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    64   8e-10
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    64   8e-10
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    64   9e-10
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    64   9e-10
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    64   9e-10
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    64   9e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    64   9e-10
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    64   9e-10
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    63   9e-10
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    62   1e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    64   1e-09
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    64   1e-09
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    64   1e-09
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    64   1e-09
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    64   1e-09
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    64   1e-09
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    64   1e-09
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    64   1e-09
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    64   1e-09
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    62   1e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    64   1e-09
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    62   1e-09
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    64   1e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    64   1e-09
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    63   1e-09
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      64   1e-09
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    64   1e-09
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    64   1e-09
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    64   1e-09
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    64   1e-09
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    64   1e-09
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    64   1e-09
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    64   1e-09
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    62   1e-09
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    64   1e-09
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    64   1e-09
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    62   1e-09
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    64   1e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    62   1e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    63   1e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    63   1e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    62   1e-09
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    63   1e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    63   2e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    64   2e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    64   2e-09
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               62   2e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    64   2e-09
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    63   2e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    63   2e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    63   2e-09
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    63   2e-09
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    62   2e-09
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              64   2e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    63   2e-09
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    63   2e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    63   2e-09
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    63   2e-09
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    63   2e-09
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    63   2e-09
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    62   2e-09
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    62   2e-09
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    62   2e-09
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    62   2e-09
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    62   2e-09
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    63   2e-09
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    63   2e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   2e-09
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    63   2e-09
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    62   2e-09
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    62   2e-09
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    63   2e-09
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    62   2e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    63   2e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    63   2e-09
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    62   2e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    62   2e-09
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    63   2e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    62   2e-09
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    63   2e-09
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    62   2e-09
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    62   2e-09
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    62   3e-09
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    62   3e-09
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    62   3e-09
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    62   3e-09
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    62   3e-09
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    62   3e-09
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    62   3e-09
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               62   3e-09
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    62   3e-09
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    62   3e-09
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    62   3e-09
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    62   3e-09
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      62   3e-09
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    62   3e-09
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    62   3e-09
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    62   3e-09
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    62   3e-09
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    62   3e-09
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    62   3e-09
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    62   4e-09
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    62   4e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    62   4e-09
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    62   4e-09
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    62   4e-09
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    62   4e-09
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    62   4e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    62   4e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   4e-09
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    62   4e-09
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    62   4e-09
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    62   4e-09
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    61   4e-09
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    62   5e-09
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    62   5e-09
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    61   5e-09
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    62   5e-09
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    62   5e-09
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    62   5e-09
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    61   5e-09
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    61   5e-09
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    60   5e-09
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    62   6e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    61   6e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    61   6e-09
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    62   6e-09
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    61   6e-09
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    62   6e-09
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    60   7e-09
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    61   7e-09
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    61   7e-09
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    62   7e-09
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    60   7e-09
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    61   7e-09
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    61   7e-09
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    61   7e-09
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    60   8e-09
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    61   8e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    61   8e-09
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    60   8e-09
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    61   8e-09
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    60   8e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    61   8e-09
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    61   8e-09
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    61   8e-09
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    61   8e-09
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    61   8e-09
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    61   8e-09
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    61   8e-09
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    61   8e-09
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    61   8e-09
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    61   9e-09
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    59   9e-09
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    60   9e-09
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    59   9e-09
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    60   9e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    60   9e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    60   9e-09
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    60   9e-09
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    60   9e-09
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    61   1e-08
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 60   1e-08
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    61   1e-08
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    60   1e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    60   1e-08
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    60   1e-08
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    60   1e-08
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    60   1e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    60   1e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    60   1e-08
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    60   1e-08
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    61   1e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    60   1e-08
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    60   1e-08
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    60   1e-08
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    60   1e-08
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    60   1e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              60   1e-08
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    60   1e-08
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    60   1e-08
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    60   1e-08
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    60   1e-08
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    60   1e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    60   2e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     60   2e-08
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    60   2e-08
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    60   2e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    60   2e-08
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    60   2e-08
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    60   2e-08
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    59   2e-08
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    60   2e-08
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    60   2e-08
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     60   2e-08
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    60   2e-08
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    60   2e-08
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    59   2e-08
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    60   2e-08
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    59   2e-08
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    60   2e-08
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    60   2e-08
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    59   2e-08
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    59   2e-08
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    59   2e-08
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    59   2e-08
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    60   2e-08
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    60   2e-08
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    59   2e-08
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    59   2e-08
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    59   2e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    59   2e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    60   2e-08
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    59   2e-08
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    60   2e-08
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    59   2e-08
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    60   2e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    60   2e-08
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    59   2e-08
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    60   3e-08
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    59   3e-08
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    59   3e-08
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    60   3e-08
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    59   3e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    59   3e-08
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    59   3e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    59   3e-08
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    59   3e-08
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    59   3e-08
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    58   3e-08
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    59   3e-08
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    58   4e-08
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    58   4e-08
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    59   4e-08
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    59   4e-08
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    57   4e-08
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    59   4e-08
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    59   4e-08
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    59   4e-08
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    59   4e-08
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    57   4e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    58   4e-08
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    57   4e-08
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    59   5e-08
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               59   5e-08
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    58   5e-08
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    58   5e-08
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    58   5e-08
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    58   5e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    58   5e-08
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    58   5e-08
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    58   5e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    58   5e-08
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    58   5e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     58   6e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    58   6e-08
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    58   6e-08
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     58   6e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    58   7e-08
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      58   7e-08
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    57   7e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    58   7e-08
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    58   7e-08
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    58   7e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    58   7e-08
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    58   7e-08
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    58   7e-08
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    57   8e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    58   8e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    58   8e-08
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    58   8e-08
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    58   8e-08
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    57   8e-08
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    54   9e-08
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    58   9e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    57   1e-07
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    57   1e-07
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    57   1e-07
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    57   1e-07
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    57   1e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    57   1e-07
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    57   1e-07
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    57   1e-07
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    57   1e-07
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    57   1e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    57   1e-07
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    57   1e-07
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    57   1e-07
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    57   1e-07
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    57   1e-07
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    57   1e-07
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    56   1e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    57   1e-07
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    57   1e-07
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    57   1e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    57   1e-07
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    57   1e-07
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    56   1e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    57   2e-07
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    57   2e-07
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    57   2e-07
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    56   2e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    57   2e-07
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     56   2e-07
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    55   2e-07
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    57   2e-07
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    56   2e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    56   2e-07
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    56   2e-07
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    56   2e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    56   2e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    57   2e-07
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    57   2e-07
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    56   2e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    57   2e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    56   2e-07
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               56   2e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    57   2e-07
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    56   2e-07
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    55   2e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    56   2e-07
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    56   2e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    56   2e-07
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    56   2e-07
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    56   2e-07
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     55   2e-07
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    56   2e-07
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    57   2e-07
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    56   2e-07
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              56   3e-07
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    56   3e-07
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    56   3e-07
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    56   3e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    55   3e-07
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    56   3e-07
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    56   3e-07
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    55   3e-07
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    56   3e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    55   3e-07
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    56   3e-07
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    56   4e-07
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     55   4e-07
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    55   4e-07
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    55   4e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    55   4e-07
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    55   4e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    55   4e-07
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    55   4e-07
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    55   4e-07
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    55   4e-07
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    55   4e-07
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    55   4e-07
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    55   4e-07
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    55   4e-07
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    55   4e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    55   4e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    55   5e-07
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    55   5e-07
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    55   5e-07
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    55   5e-07
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    55   5e-07
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    54   5e-07
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    55   5e-07
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    54   5e-07
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    54   6e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    55   6e-07
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    54   6e-07
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    54   6e-07
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    55   6e-07
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    54   7e-07
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    54   7e-07
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    55   7e-07
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    54   7e-07
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    54   7e-07
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    55   8e-07
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    54   8e-07
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    54   8e-07
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    54   9e-07
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    54   9e-07
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    54   9e-07
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    54   9e-07
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    54   9e-07
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    55   9e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    55   9e-07
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    54   1e-06
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    54   1e-06
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    54   1e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    54   1e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    54   1e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    54   1e-06
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    54   1e-06
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    54   1e-06
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    54   1e-06
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    54   1e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    54   1e-06
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    54   1e-06
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    53   1e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    54   1e-06
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    54   1e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    54   1e-06
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    53   1e-06
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    54   1e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    54   1e-06
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    54   1e-06
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    54   1e-06
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    53   1e-06
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    54   1e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    54   1e-06
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    53   1e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    53   1e-06
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    54   1e-06
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    53   1e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    54   2e-06
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    54   2e-06
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    54   2e-06
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    53   2e-06
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    54   2e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    54   2e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    54   2e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    53   2e-06
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    53   2e-06
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    53   2e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    54   2e-06
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    53   2e-06
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    53   2e-06
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    54   2e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    53   2e-06
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    53   2e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    53   2e-06
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    53   2e-06
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    54   2e-06
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              54   2e-06
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    52   2e-06
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    52   2e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    53   2e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    54   2e-06
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    53   2e-06
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    53   2e-06
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    53   2e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    53   2e-06
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    52   3e-06
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    53   3e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    53   3e-06
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    53   3e-06
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    53   3e-06
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    53   3e-06
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               52   3e-06
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    53   3e-06
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    52   3e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    53   3e-06
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    53   3e-06
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    52   3e-06
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    52   3e-06
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    52   3e-06
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    52   3e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    53   3e-06
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    52   3e-06
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               52   3e-06
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    53   3e-06
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    52   3e-06
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    52   3e-06
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    52   3e-06
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    53   3e-06
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    52   3e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    52   3e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    53   4e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    52   4e-06
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    52   4e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    52   4e-06
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    52   4e-06
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    52   4e-06
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    52   4e-06
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      52   4e-06
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    52   4e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    51   4e-06
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               52   4e-06
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    52   4e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    52   4e-06
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    51   4e-06
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    51   5e-06
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    52   5e-06
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    52   5e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    52   5e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    52   5e-06
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    51   5e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    52   5e-06
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    51   5e-06
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    52   5e-06
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    52   5e-06
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    52   5e-06
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    51   6e-06
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    52   6e-06
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    52   6e-06
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    51   6e-06
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    51   6e-06
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    51   6e-06
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    52   6e-06
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    52   6e-06
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             51   6e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    52   7e-06
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    52   7e-06
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    51   7e-06
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    51   7e-06
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    51   7e-06
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    51   7e-06
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    52   7e-06
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    51   7e-06
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    52   7e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    51   8e-06
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    51   8e-06
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    51   8e-06
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    51   8e-06
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    50   9e-06
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    50   9e-06
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    50   9e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    51   9e-06
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    50   1e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    50   1e-05
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    51   1e-05
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    51   1e-05
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    51   1e-05
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    50   1e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    51   1e-05
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    51   1e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    50   1e-05
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    51   1e-05
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    51   1e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    50   1e-05
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    51   1e-05
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    50   1e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    50   1e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    50   1e-05
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    50   1e-05
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    51   1e-05
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    50   1e-05
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    50   1e-05
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    50   1e-05
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    51   1e-05
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    51   1e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    50   1e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    50   1e-05
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    50   1e-05
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    50   2e-05
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    50   2e-05
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    50   2e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    50   2e-05
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    50   2e-05
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    49   2e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    50   2e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    50   2e-05
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     50   2e-05
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    50   2e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    50   2e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    50   2e-05
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    50   2e-05
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    50   2e-05
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    50   2e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    50   2e-05
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    49   2e-05
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    50   2e-05
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    50   2e-05
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    50   2e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    50   2e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    50   2e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    50   2e-05
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    50   2e-05
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    50   2e-05
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    50   2e-05
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    50   2e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    50   2e-05
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    50   3e-05
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    49   3e-05
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    49   3e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    50   3e-05
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    49   3e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    49   3e-05
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    49   3e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    50   3e-05
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    49   3e-05
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    49   3e-05
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    49   3e-05
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    49   4e-05
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    49   4e-05
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    49   4e-05
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    49   4e-05
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    49   4e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    49   4e-05
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    49   4e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    49   4e-05
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     49   4e-05
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    49   4e-05
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    49   4e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     49   4e-05
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    49   4e-05
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    49   4e-05
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    49   4e-05
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    49   4e-05
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    49   4e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    49   4e-05
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    49   5e-05
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    49   5e-05
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    49   5e-05
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    49   5e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    49   5e-05
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    49   5e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      49   5e-05
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    49   5e-05
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    49   5e-05
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    48   5e-05
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    49   6e-05
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    49   6e-05
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    49   6e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    49   6e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    49   6e-05
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    48   6e-05
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    49   6e-05
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    48   6e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    49   7e-05
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    48   7e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    49   7e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    48   7e-05
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    48   8e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    48   8e-05
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    48   8e-05
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    48   8e-05
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    48   8e-05
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    48   9e-05
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    48   9e-05
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    48   9e-05
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    48   9e-05
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    48   9e-05
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    48   1e-04
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    48   1e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    47   1e-04
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    47   1e-04
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    48   1e-04
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    47   1e-04
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    47   1e-04
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    47   1e-04
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    48   1e-04
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    47   1e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    47   1e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    48   1e-04
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    46   2e-04
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    47   2e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    47   2e-04
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    47   2e-04
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    47   2e-04
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    47   2e-04
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    47   2e-04
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    47   2e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    47   2e-04
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    47   2e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    47   2e-04
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    47   2e-04
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    47   2e-04
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    47   2e-04
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    47   2e-04
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    47   2e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    47   2e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    46   2e-04
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    47   2e-04
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    46   2e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    47   2e-04
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    46   2e-04
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    47   2e-04
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    47   3e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    47   3e-04
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    46   3e-04
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    46   3e-04
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    46   3e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               46   3e-04
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    46   3e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   3e-04
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    46   3e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    46   3e-04
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    46   3e-04
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    46   3e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    46   4e-04
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    46   4e-04
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    45   4e-04
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    46   4e-04
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    46   4e-04
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    46   4e-04
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    46   4e-04
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    45   5e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    45   5e-04
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    45   5e-04
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    45   5e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    45   5e-04
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    45   5e-04
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    45   5e-04
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    45   6e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    45   6e-04
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    45   6e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    45   6e-04
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    45   6e-04
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    45   6e-04
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    45   6e-04
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    45   7e-04
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    45   7e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    45   7e-04
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    45   7e-04
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    45   8e-04
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    45   8e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    45   8e-04
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    45   8e-04
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    45   8e-04
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    45   9e-04
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    44   0.001
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     44   0.001
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    44   0.001
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    44   0.001
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    44   0.001
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    44   0.001
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    44   0.001
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    44   0.001
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    44   0.001
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    44   0.001
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    44   0.001
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    44   0.002
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    44   0.002
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    44   0.002
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    44   0.002
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    44   0.002
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               44   0.002
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    44   0.002
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    44   0.002
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    44   0.002
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    44   0.002
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    43   0.002
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    44   0.002
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    44   0.002
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    43   0.002
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    43   0.002
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    43   0.002
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    43   0.003
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    43   0.003
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    43   0.003
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    43   0.003
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    43   0.003
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    42   0.003
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    43   0.003
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    42   0.004
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     42   0.004
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    42   0.005
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    42   0.005
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    42   0.005
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    42   0.005
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    42   0.005
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    42   0.006
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    42   0.006
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    42   0.006
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    42   0.006
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    42   0.007
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    42   0.007
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.007
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    42   0.007
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    42   0.007
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    42   0.007
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    42   0.008
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    42   0.008
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    42   0.008
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    41   0.008
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    42   0.008
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    42   0.008
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    42   0.008
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    42   0.008
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    42   0.009
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    41   0.010
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    41   0.010
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    41   0.010
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    41   0.010
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    40   0.014
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    41   0.016
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    40   0.016
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    41   0.016
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    41   0.017
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.017
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    40   0.018
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    40   0.018
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    40   0.020
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    40   0.021
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    40   0.022
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    40   0.022
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    40   0.023
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    40   0.023
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    40   0.024
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    40   0.024
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    40   0.024
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    40   0.025
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    40   0.025
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    40   0.026
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    40   0.029
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    40   0.029
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    40   0.031
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    40   0.032
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    39   0.036
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    39   0.037
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    39   0.038
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    39   0.041
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       39   0.041
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.042
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    39   0.042
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    39   0.043
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    39   0.045
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    39   0.047
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    39   0.047
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    39   0.047
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    39   0.048
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    39   0.049
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    39   0.049
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    39   0.049
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     39   0.049
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    39   0.054
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    39   0.059
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    39   0.059
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    39   0.059
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    39   0.061
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    39   0.061
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    39   0.063
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    39   0.067
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    38   0.072
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     39   0.073
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    38   0.083
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    38   0.087
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    38   0.088
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    38   0.089
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    38   0.089
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    38   0.092
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    38   0.094
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    38   0.096
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     38   0.100
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    38   0.10 
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    38   0.10 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    38   0.10 
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    38   0.11 
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    38   0.11 
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    37   0.11 
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    38   0.11 
Suva_3.128 Chr3 (192094..193266) [1173 bp, 390 aa] {ON} YCR091W ...    37   0.11 
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    38   0.12 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    38   0.12 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    37   0.12 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    38   0.12 
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    38   0.13 
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    38   0.13 
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    37   0.13 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.13 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    38   0.13 
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    37   0.13 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    37   0.14 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    38   0.14 
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    37   0.15 
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    37   0.15 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    37   0.15 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     37   0.15 
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    37   0.15 
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    37   0.16 
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    37   0.16 
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    37   0.16 
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    37   0.17 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    37   0.17 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    37   0.18 
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    37   0.19 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    37   0.19 
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    37   0.20 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    37   0.21 
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    37   0.21 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    37   0.21 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    37   0.23 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    37   0.26 
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    37   0.27 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    36   0.27 
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    36   0.29 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    37   0.29 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    36   0.30 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    36   0.34 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    36   0.37 
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    36   0.37 
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    36   0.39 
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    36   0.40 
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    36   0.43 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    36   0.44 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    36   0.46 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.47 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    35   0.49 
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    36   0.50 
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    36   0.51 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    35   0.60 
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    35   0.61 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    35   0.61 
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    35   0.62 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    35   0.66 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    35   0.66 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    35   0.67 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    35   0.69 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    35   0.70 
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    35   0.71 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    35   0.72 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    35   0.76 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    35   0.83 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    35   0.84 
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    35   0.84 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    35   0.85 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   0.86 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    35   0.87 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   0.90 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    35   0.93 
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    35   0.96 
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    35   1.0  
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    34   1.2  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    34   1.2  
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    35   1.2  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    34   1.2  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    34   1.3  
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    34   1.4  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    34   1.5  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    34   1.5  
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    34   1.5  
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    34   1.6  
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    34   1.6  
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    34   1.7  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    34   1.8  
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    34   1.8  
ZYRO0E02376g Chr5 complement(181177..182817) [1641 bp, 546 aa] {...    34   1.9  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    34   2.0  
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    33   2.7  
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    33   2.7  
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    33   3.3  
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    33   3.4  
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    33   3.7  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    32   4.8  
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    32   5.1  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    32   5.6  
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    32   5.9  
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    32   6.1  
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    32   6.5  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    32   7.2  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    32   8.4  
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    31   8.8  

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score = 1437 bits (3721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/769 (91%), Positives = 702/769 (91%)

Query: 1   MSTNSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDK 60
           MSTNSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDK
Sbjct: 1   MSTNSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDK 60

Query: 61  IANPVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIE 120
           IANPVFEEMN           MGNL            LFGRYLRNSHQTSMTTMNTSDIE
Sbjct: 61  IANPVFEEMNRSSSRSHPPSSMGNLTSGHTSTSSQSTLFGRYLRNSHQTSMTTMNTSDIE 120

Query: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180
           MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD
Sbjct: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180

Query: 181 DDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLS 240
           DDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLS
Sbjct: 181 DDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLS 240

Query: 241 TSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDASITFNS 300
           TSDLPIISQIYFDRQREENKQAALRKH                        KDASITFNS
Sbjct: 241 TSDLPIISQIYFDRQREENKQAALRKHSSRELLSRNRSSSTSLSSGNSLANKDASITFNS 300

Query: 301 SSQPRRKVXXXXXXXXXXVEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDPDCEKRE 360
           SSQPRRKV          VEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDPDCEKRE
Sbjct: 301 SSQPRRKVSTGSFSSKSSVEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDPDCEKRE 360

Query: 361 VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV 420
           VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV
Sbjct: 361 VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV 420

Query: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF 480
           EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF
Sbjct: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF 480

Query: 481 DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL 540
           DDSSIDGFKGEI          RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL
Sbjct: 481 DDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL 540

Query: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 600
           DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY
Sbjct: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 600

Query: 601 RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 660
           RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG
Sbjct: 601 RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 660

Query: 661 SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720
           SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF
Sbjct: 661 SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720

Query: 721 LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI
Sbjct: 721 LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score = 1228 bits (3178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/769 (78%), Positives = 655/769 (85%), Gaps = 4/769 (0%)

Query: 1   MSTNSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDK 60
           MSTNSFHDYMDSKS+MN RQ SDDEEFTTPPKLSNFGSALLSHTEK S S+ LS NKNDK
Sbjct: 1   MSTNSFHDYMDSKSRMNARQFSDDEEFTTPPKLSNFGSALLSHTEKTSVSQELS-NKNDK 59

Query: 61  IANPVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIE 120
           IANPVFEE N           MGNL            LFGRYL+N+HQTSMTTMNT+DIE
Sbjct: 60  IANPVFEETNRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLKNNHQTSMTTMNTNDIE 119

Query: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180
           ++VGNSLDKSFE+I++LRQNMKEDITSKY ERRSKRFLISNRTTKLGPAKRA+TL +VFD
Sbjct: 120 INVGNSLDKSFEKIRSLRQNMKEDITSKYTERRSKRFLISNRTTKLGPAKRASTLTNVFD 179

Query: 181 DDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLS 240
           DDV +SSNQLIS  RETTESPL D  +  F+ T KK+  YESI+F DLNPIQYIKKHNL 
Sbjct: 180 DDVPNSSNQLISNLRETTESPLDDPSETEFKET-KKNSDYESINFGDLNPIQYIKKHNLP 238

Query: 241 TSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDASITFNS 300
           TSDLP+ISQIYFD+QREEN+QAALRKH                        KD SIT NS
Sbjct: 239 TSDLPMISQIYFDKQREENRQAALRKHSSRELLSKNRSSSTPLSNSYSLVNKDHSITSNS 298

Query: 301 SSQPRRKVXXXXXXXXXXVEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDPDCEKRE 360
           +SQPRRK+          +EIRK  KEN++  N ++   P++KIY+E SRNKD D EKRE
Sbjct: 299 NSQPRRKISTGSSSSKSSIEIRKVLKENIDTDNYSNLKSPINKIYRESSRNKDSDSEKRE 358

Query: 361 VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV 420
            LRNISIN +HAD+ LQQ+NKRLKRSLDDAII++NE  N+KNQ+VFYHRPAPKPPVTKKV
Sbjct: 359 ALRNISINTSHADSGLQQDNKRLKRSLDDAIIHDNE--NMKNQDVFYHRPAPKPPVTKKV 416

Query: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF 480
           EIVEP ++A+ S++RN+ITVNDSQYEKIELLGRGGSSRVYKVKG+GNKVYALKRVSFDAF
Sbjct: 417 EIVEPIKSASLSNSRNIITVNDSQYEKIELLGRGGSSRVYKVKGAGNKVYALKRVSFDAF 476

Query: 481 DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL 540
           DDSS+DGFKGEI          RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR NMSL
Sbjct: 477 DDSSVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMSL 536

Query: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 600
           DFNF+RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY
Sbjct: 537 DFNFIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 596

Query: 601 RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 660
           RETQIGTPNYMAPEALVAMNYTQ N+NR +GNKWKVGRPSDMWSCGCIVYQMIYGKPPYG
Sbjct: 597 RETQIGTPNYMAPEALVAMNYTQTNENRQEGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 656

Query: 661 SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720
           SFQGQNRLLAIMNPDVKIPFP+HTSN+E+IPKSAIELMKACLYRNPDKRWTVDKVL+STF
Sbjct: 657 SFQGQNRLLAIMNPDVKIPFPDHTSNNERIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716

Query: 721 LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           LQPFMIS SIMEDLIRNAVRYGSEKPQISHD+LNDVVETVLRKFADYKI
Sbjct: 717 LQPFMISGSIMEDLIRNAVRYGSEKPQISHDDLNDVVETVLRKFADYKI 765

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score = 1214 bits (3141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/769 (78%), Positives = 650/769 (84%), Gaps = 5/769 (0%)

Query: 1   MSTNSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDK 60
           MSTNSFHDY+D KS+ NTRQ SDDEEFTTPPKLSNFGSALLSHTEK S SE LS++ NDK
Sbjct: 1   MSTNSFHDYVDLKSRTNTRQFSDDEEFTTPPKLSNFGSALLSHTEKTSASEILSSHNNDK 60

Query: 61  IANPVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIE 120
           IAN + EEM+           MGNL            LFGRYLRN+HQTSMTTMNTSDIE
Sbjct: 61  IANRL-EEMDRSSSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTSDIE 119

Query: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180
           ++VGNSLDKSFERI+NLRQNMKEDIT+KYAERRSKRFLISNRTTKLGPAKRA TL ++FD
Sbjct: 120 INVGNSLDKSFERIRNLRQNMKEDITAKYAERRSKRFLISNRTTKLGPAKRAMTLTNIFD 179

Query: 181 DDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLS 240
           +DV +S NQ I+ +RET E PL DS+Q  F+ T K++  Y+SIDF DLNPIQYIKKHNL 
Sbjct: 180 EDVPNSPNQPIN-ARETVELPLEDSHQTNFKET-KRNTDYDSIDFGDLNPIQYIKKHNLP 237

Query: 241 TSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDASITFNS 300
           TSDLP+ISQIYFD+QREEN+QAALRKH                        KD SIT N+
Sbjct: 238 TSDLPLISQIYFDKQREENRQAALRKHSSRELLYKSRSSSSSLSSNNLLANKDNSITSNN 297

Query: 301 SSQPRRKVXXXXXXXXXXVEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDPDCEKRE 360
            SQPRRKV          +EIR+  KEN++ SN ++ N P+HKIYK ISRNKD D EKRE
Sbjct: 298 GSQPRRKVSTGSSSSKSSIEIRRALKENIDTSNNSNFNSPIHKIYKGISRNKDSDSEKRE 357

Query: 361 VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV 420
           VLRNISINANHADN+LQQENKRLKRSLDDAI NEN  +N KN EVFYHRPAPKPPVTKKV
Sbjct: 358 VLRNISINANHADNLLQQENKRLKRSLDDAITNEN--INSKNLEVFYHRPAPKPPVTKKV 415

Query: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF 480
           EIVEPA++A+ S+NRN+ITVNDSQYEKIELLGRGGSSRVYKVKGSGN+VYALKRVSFDAF
Sbjct: 416 EIVEPAKSASLSNNRNIITVNDSQYEKIELLGRGGSSRVYKVKGSGNRVYALKRVSFDAF 475

Query: 481 DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL 540
           DDSSIDGFKGEI          RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR  M L
Sbjct: 476 DDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSGMPL 535

Query: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 600
           DFNFVRFY KEML CIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY
Sbjct: 536 DFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 595

Query: 601 RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 660
           RETQIGTPNYMAPEALVAMNYTQN++N+H+GNKWKVGRPSDMWSCGCI+YQMIYGKPPYG
Sbjct: 596 RETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 655

Query: 661 SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720
           SFQGQNRLLAIMNPDVKIPFPEHTSN+EKIPKSAIELMKACLYRNPDKRWTVDKVL+STF
Sbjct: 656 SFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 715

Query: 721 LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           LQPFMIS SIMEDLIRNAVRYGSEKP IS D+LNDVV+TVLRKFADYKI
Sbjct: 716 LQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFADYKI 764

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score = 1208 bits (3125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/769 (77%), Positives = 650/769 (84%), Gaps = 4/769 (0%)

Query: 1   MSTNSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDK 60
           MSTNSFHDYMD  S+ N RQ SDDEEFTTPPKLSNFGSALLSH+EK S  E LS++K +K
Sbjct: 1   MSTNSFHDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNK 60

Query: 61  IANPVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIE 120
           + N V EEM+           MGNL            LFGRYLRN+HQTSMTTMNT+DIE
Sbjct: 61  MTNHVLEEMDRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTNDIE 120

Query: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180
           ++VGNSLDKSFERI+NLRQNMKED+TSKYAERRSKRFLISNRTTKLGPAKRATTL +VFD
Sbjct: 121 INVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD 180

Query: 181 DDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLS 240
           ++V +SSN  I+  RET E+ L DS ++GFR + KK+M YESI+F DLNPIQYIKKHNL 
Sbjct: 181 EEVPNSSNLPIN-PRETIETLLEDSNKSGFRES-KKNMDYESIEFGDLNPIQYIKKHNLP 238

Query: 241 TSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDASITFNS 300
           TSDLP+ISQIYFD+QREEN+QAALRKH                        KD SITF +
Sbjct: 239 TSDLPLISQIYFDKQREENRQAALRKHSSRELLYKNRSSSTSLSSNNLLPSKDNSITFIN 298

Query: 301 SSQPRRKVXXXXXXXXXXVEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDPDCEKRE 360
           SS PRRK+          +EIR+  KEN++ SN +S N P+H I+KEISRNKD D EKR 
Sbjct: 299 SSLPRRKISTGSSSSKSSIEIRRALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRG 358

Query: 361 VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV 420
           VLRNISINANHADNILQQ+NKRLKRSLDD I NENE  N K QEVFYHRPAPKPPVTKKV
Sbjct: 359 VLRNISINANHADNILQQDNKRLKRSLDDVITNENE--NKKIQEVFYHRPAPKPPVTKKV 416

Query: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF 480
           EIVEPA++A+SS+NR+MITVNDSQYEKIELLGRGGSSRVYKVKGSGNK+YALKRVSFDAF
Sbjct: 417 EIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRVSFDAF 476

Query: 481 DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL 540
           DDSS+DGFKGEI          RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR NM L
Sbjct: 477 DDSSVDGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPL 536

Query: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 600
           DFNFVRFY KEML CIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY
Sbjct: 537 DFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 596

Query: 601 RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 660
           RETQIGTPNYMAPEALVAMNYTQ++DN+H+GNKWKVGRPSDMWSCGCI+YQMIYGKPPYG
Sbjct: 597 RETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 656

Query: 661 SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720
           SFQGQNRLLAIMNPDVKIPFPE+TSN+EKIPKSAIELMKACLYRNPDKRWTVDKVL+STF
Sbjct: 657 SFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716

Query: 721 LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           LQPFMIS SIMEDLI+NAVRYGSEKPQISHD+LNDVVETVLRKF+DYKI
Sbjct: 717 LQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/786 (45%), Positives = 494/786 (62%), Gaps = 53/786 (6%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANPVFEEMNXXXXXXXXXXX 81
           SDDE+ T PPKLS+FG ALL   E  + S      + +   N    E+            
Sbjct: 25  SDDEKITGPPKLSDFGVALLMEKENMAPS---MVRRGEPSPNSFKRELKTRFGPTNTDYF 81

Query: 82  MGN---------LXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDKSFE 132
            G+                      +F +  R + Q SMTTM+T+ I++   + L+ SF 
Sbjct: 82  SGSNNQTSFSQTYVSANSGEPSQSTIFAQS-RFNQQPSMTTMDTNGIKIPASD-LETSFG 139

Query: 133 RIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFDDDVADSSNQLIS 192
           RIK+++QNM+E++T+++A+RRS+RFL   R   LGPAKRA++       D++D S   + 
Sbjct: 140 RIKSMQQNMREELTTRHAQRRSRRFLHGTRIGVLGPAKRASSTNGA---DMSDLSIGNVQ 196

Query: 193 ISRETTESPLADSYQAGF----------RGTRKKD-MKYESIDFEDLNPIQYIKKHNLST 241
           + ++T  +PL +  +             + TR +D + Y+SIDF D+NP+QY+K HNLS+
Sbjct: 197 MVQQTDNTPLEEHREVQSPAEIKPDLTKKETRTRDVLDYKSIDFGDMNPVQYLKLHNLSS 256

Query: 242 SDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXX--XKDASITFN 299
           S+LP +S++YF+RQREE  Q AL+K                           +++S+   
Sbjct: 257 SELPKLSKVYFERQREEIHQMALQKSISSREALTNKVQRSFSSISSSGNSIRRESSMPL- 315

Query: 300 SSSQPRRKVXXXXXXXXXXVEIRKTF-------KEN--VNASNINSPNGPVH--KIYKEI 348
               PRRK+             + +F       K+N  ++   + S     H   + K+ 
Sbjct: 316 ---YPRRKLSDTSVSSAAKTSFQSSFSSPLAYPKKNFLIDQPVVTSKPAADHGKNLTKQY 372

Query: 349 SRNKDPDCE----KREVLRNISINANHADNILQQENKRLKRSLDDAIINENE-DVNVKNQ 403
           ++ +    E    KRE L NI IN N  +++  Q+ KR K       ++E+       N+
Sbjct: 373 AQREQYTLESSFKKREALANIDINRNSQESL--QQPKRFKPIRTQEQLSESHLPEPYVNK 430

Query: 404 EVFYHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVK 463
           E + +R  PKP  TK+VEI+EP + +   S +N++ VND +YEK+ELLGRGGSS+VYKV+
Sbjct: 431 EEYLNREPPKPRATKRVEILEP-KPSQGQSRKNVVKVNDVEYEKVELLGRGGSSKVYKVR 489

Query: 464 GSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMEC 523
              N VYALKRV FD FDDSS+ GFKGEI          RV+QL+D+EM  G+LYLIMEC
Sbjct: 490 DRSNNVYALKRVVFDEFDDSSVSGFKGEIELLKKLENQNRVVQLVDHEMEHGVLYLIMEC 549

Query: 524 GDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKI 583
           GDHDLS+ILN R  M LD  FVR++A+EML+C+KVVHD+GIVHSDLKPANFV VKGILKI
Sbjct: 550 GDHDLSRILNHRAGMPLDMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGILKI 609

Query: 584 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMW 643
           IDFGIANAVP+HTVNIYRE QIGTPNYMAPEALVAMNYTQ+++     N+WKVG+PSD+W
Sbjct: 610 IDFGIANAVPDHTVNIYRENQIGTPNYMAPEALVAMNYTQDDEKYQQQNRWKVGKPSDIW 669

Query: 644 SCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLY 703
           SCGCI+YQMIYG+PPYG FQGQNRLLAIMNPDVKI F + TS DE IP+SA++ MKACL 
Sbjct: 670 SCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSALDTMKACLT 729

Query: 704 RNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRK 763
           RNPDKR TVD+VL S FL+P M++   + DLI+NAVRYG+++ ++S + + ++ + VL +
Sbjct: 730 RNPDKRLTVDEVLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLSR 789

Query: 764 FADYKI 769
            +D+++
Sbjct: 790 LSDFRL 795

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/828 (45%), Positives = 496/828 (59%), Gaps = 106/828 (12%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHTEKASTSE-------ALSTNKNDKIAN-PVFEEMNXXX 73
           SDDE+ + PPKLSNFGSALLS  EK + +E          + K   + N P +  +N   
Sbjct: 46  SDDEKISIPPKLSNFGSALLSEKEKENINENDLFEMLPKDSVKPSSLNNEPYYNSVNHTP 105

Query: 74  XXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDKSFER 133
                    G+             LF +Y R+  Q SMTTMN++D++   GN  + SF++
Sbjct: 106 GNTYASIHSGD--------PSQSTLFAQY-RSHQQPSMTTMNSTDVQDKDGNDFENSFQK 156

Query: 134 IKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTL-KSVFDDDVADSS----- 187
           IK+++Q+M+E++TS++AERRS+RFL S+R   LGPAKRA+ +     D   + ++     
Sbjct: 157 IKSMQQSMREELTSRHAERRSRRFLNSSRKEFLGPAKRASAIFPEALDRRFSGTTNSNGT 216

Query: 188 -------NQLISISRE-TTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNL 239
                  + L+ ++RE + E  L+ S Q               +D  DLNP+QY+KKH+L
Sbjct: 217 NDNNNSTDGLLQLNREESPEEKLSLSSQ---------------VDLGDLNPVQYLKKHDL 261

Query: 240 STSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDASITFN 299
            TS+LP IS++YF++Q+    + A  K                         ++ S++  
Sbjct: 262 PTSELPRISRLYFEKQKPRKMELARLKQEILRESRTSSSGNNGSGVQHIPIRRENSLS-- 319

Query: 300 SSSQPRRKVXXXXXXXXXXVEIRKTFKENVNAS-NINSPNGPV-HKIYKEISRNKDP--D 355
           +++QPRRK+                   +V++  NI S    + H  Y     +      
Sbjct: 320 AATQPRRKLSDTSSRNIFQRGFSSPVARSVDSQRNILSDKSSLKHNEYDSYPHSNTLLYS 379

Query: 356 CEKREVLRNISINANHADNILQQENKRLKRSLDDAIINENEDV----------------- 398
             KRE L NI +N N+ D I + E KR K   +    N N D                  
Sbjct: 380 HRKREALANIDVNRNNNDQIYEPELKRYKYFDEHHNNNRNNDYEPESKRYDLFEDHRNGN 439

Query: 399 --------------------------NVKNQEVFYHRPAPKPPVTKKVEIVEPARTATS- 431
                                     +V  +  F+HR APKPPV KKVEIVEP +   S 
Sbjct: 440 NNKDEKPISLERLPSEAPPVAIPIHPSVIQENEFHHREAPKPPVVKKVEIVEPEKRTDSK 499

Query: 432 --SSN------RNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAFDDS 483
             SSN      RN  TVND +YEKIELLGRGGSS+VYKVK + NK+YALKRV FD FDDS
Sbjct: 500 GKSSNGEALTRRNATTVNDVEYEKIELLGRGGSSKVYKVKDNNNKLYALKRVVFDEFDDS 559

Query: 484 SIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFN 543
           S++GFKGEI          RV++L DYEM  G+LYLIMECGDHDLSQILNQR  M LD  
Sbjct: 560 SVNGFKGEIELLNKLKDKTRVVKLFDYEMEHGVLYLIMECGDHDLSQILNQRAGMPLDIE 619

Query: 544 FVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRET 603
           FVR++A+EML+C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVP+HTVNIYRET
Sbjct: 620 FVRYHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRET 679

Query: 604 QIGTPNYMAPEALVAMNYTQNNDN--RHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGS 661
           QIGTPNYMAPEALVAMNYT  ND       N+WKVG+PSD+WSCGCI+YQMIYG+PPYG 
Sbjct: 680 QIGTPNYMAPEALVAMNYTGQNDGDKYKQQNRWKVGKPSDVWSCGCIIYQMIYGRPPYGG 739

Query: 662 FQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           FQGQNRLLAIMNP+VKI F E T+NDE +P+S ++ MKACL RNPDKR TVD+VL+S FL
Sbjct: 740 FQGQNRLLAIMNPEVKIIFSEKTANDEAVPRSILDTMKACLLRNPDKRLTVDEVLDSPFL 799

Query: 722 QPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           +P M++   + DLI+NAVRYG+++ ++S + + ++ + VL K AD ++
Sbjct: 800 KPVMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLGKLADIRL 847

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/777 (46%), Positives = 480/777 (61%), Gaps = 61/777 (7%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANPVFEEMNXXXXXXXXXXX 81
           SDDE+ + PP LSNF SA LS  +K +TS       N      VF   N           
Sbjct: 30  SDDEKVSGPPVLSNFASAFLSEGDK-NTSNIREEETN------VFNNSNMKLSQTPNNSI 82

Query: 82  MGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDK-------SFERI 134
             N             LF   + N  Q+S+TTMN+++   ++ +  +K       + ++I
Sbjct: 83  EPN---QADDLSLHSTLFANTVGN-RQSSLTTMNSTN-NFALNHDTNKEHTVFEDNLQKI 137

Query: 135 KNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATT------LKSVFDDDVADSSN 188
           K+L+Q MKE++TS+Y ERR+KRFL S R   LGPAKRA+T       +  + ++   S+N
Sbjct: 138 KSLQQTMKEELTSRYIERRNKRFLTSRRNN-LGPAKRASTSAISASTEDRYQENDKHSNN 196

Query: 189 QLISISRETT---------ESPLADSYQA-----GFRGTRKKDMKYESIDFEDLNPIQYI 234
           +  S   ++           SPL    +A     G     K+ + Y SI+F +L P +Y+
Sbjct: 197 EKYSTQDDSNILAKQVGRLSSPLNRQNRAFQSSNGDDTNMKEPVDYSSIEFGELTPFEYL 256

Query: 235 KKHNLSTSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDA 294
           KKH+L TS+LP IS+IYF++Q+ EN+Q  LRK                            
Sbjct: 257 KKHDLPTSELPYISRIYFEKQKLENRQTVLRKRRFSSKESLSLGTTSSLAPYSNSKNNTT 316

Query: 295 SITFNSSSQPRRKVXXXXXXXXXXVEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDP 354
           +      S PRRK+             ++  K N+N S   S   P     + I R  + 
Sbjct: 317 NQVSRDLSLPRRKISDTSSKIS-----KQILKSNINLSESGSHGFPPD--LQSIQRQHE- 368

Query: 355 DCEKREVLRNISINANHADNILQQENKRLKRS--LDDAIINENEDVNVKNQEVFYHRPAP 412
             EK      I +N N   N+  +   +L+ +    D+ +N  +D + K   V Y + AP
Sbjct: 369 SAEKLSRAPLIDLNVN---NVSPKRMDKLRETHKFSDSRLNV-QDFSKKTDVVVYEKQAP 424

Query: 413 KPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYAL 472
           +    KKVEIVEP R+ +  + RN ITVND++YEKIELLGRGGSSRVYKVK S NKV+AL
Sbjct: 425 R----KKVEIVEPKRSHSKLAKRNTITVNDTEYEKIELLGRGGSSRVYKVKNSQNKVFAL 480

Query: 473 KRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQIL 532
           KRVSFD FDDSS+DGFKGEI          RV++L DY+M  G+L+LIMECGDHDLSQIL
Sbjct: 481 KRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQIL 540

Query: 533 NQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 592
           +QR +M LD +FVR++A+E+++CIK+VHDAGIVHSDLKPANFV VKGILKIIDFGIANA+
Sbjct: 541 SQRSDMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAI 600

Query: 593 PEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQM 652
           P+HTVNIYRE QIGTPNYMAPEALVAMNYT  ND    GNKWKVG+PSD+WSCGCI+YQM
Sbjct: 601 PDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDG---GNKWKVGKPSDIWSCGCIIYQM 657

Query: 653 IYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTV 712
           IYG+PPY  FQGQNRLLAIMNPDVK+ F E T+N+E IP+S I+LMK CL R+P+KRW+V
Sbjct: 658 IYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRWSV 717

Query: 713 DKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           D+VL S F  P +++   ++DLI+NAVRYG ++ ++S++ + ++   VL +  D+K+
Sbjct: 718 DQVLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDVLGRLTDFKM 774

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/821 (43%), Positives = 484/821 (58%), Gaps = 84/821 (10%)

Query: 18  TRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANP------------- 64
            R  SDDE    PPKLSNFGSALLS  E     E    ++N  ++N              
Sbjct: 32  ARDDSDDENMLGPPKLSNFGSALLSDKENV---EPYPYSRNQSVSNAKRYSQPPRAAARP 88

Query: 65  -VFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNT---SDIE 120
             F  +             G              +F     N  Q SMTT N    S+  
Sbjct: 89  ETFGAVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHN--QQSMTTFNPETPSEQG 146

Query: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180
                 L+KS  R+K+++Q ++++++ + ++RR++RF +S+R   LGPAKRA++     +
Sbjct: 147 KPEDMYLEKSRSRVKSMQQTLRDELSLRSSKRRNRRF-VSSRFNLLGPAKRASSNTGTPN 205

Query: 181 -DDVADSSN---QLISISRETTESPLADS------YQAGFRGTRKKD---------MKYE 221
             ++AD SN   Q  + S  ++    A        Y++    + +KD         + Y+
Sbjct: 206 HSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTSINYD 265

Query: 222 SIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXX 281
           +I+F DLNP QY+KKHN+ T++LP IS++YF+RQ+ EN++ ALRK+              
Sbjct: 266 NIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSA 325

Query: 282 XXXXXXXXXXKDASITFNS--SSQPRRKVXXXXX-----XXXXXVEIRKTFKENVNASNI 334
                      D      S    QPRRK+               V   K  K    + + 
Sbjct: 326 SLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDSKAWSSPVSSSKGLK-TAPSRDG 384

Query: 335 NSPNGPVHKIYKEISR-NKDP--DCEKREVLRNISINANHADNILQQENKRLKRSLDD-- 389
            SP     ++Y+ I R  +D      +RE L NI+IN+N+     Q +NKR K S ++  
Sbjct: 385 TSPRA--SEMYENIERPERDTFGSIRRREALSNININSNYH----QLQNKRTKYSTENLE 438

Query: 390 ---AIINENEDVNVKNQEV----FYHRPAPKPPVTKKVEIVEPART---------ATSSS 433
               I     + +V+ +      F HR  P  P  K VEIVEP +T         ATS  
Sbjct: 439 EARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGD 498

Query: 434 NRN----MITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKVYALKRVSFDAFDDSSIDGF 488
           + N     I VN ++YEK+ELLGRGGSS+VYKVK  + NKVYALKRVSFD FDDSSI+GF
Sbjct: 499 SYNRRKPTIYVNGTEYEKLELLGRGGSSKVYKVKNVANNKVYALKRVSFDEFDDSSIEGF 558

Query: 489 KGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFY 548
           KGEI          RV++L+D+EM  G+LY +MECGDHDLS  L  R  M LD  FVRF+
Sbjct: 559 KGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFH 618

Query: 549 AKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTP 608
           ++EML+C+KVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVNIYRETQIGTP
Sbjct: 619 SQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTP 678

Query: 609 NYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL 668
           NYMAPEALVAMNYTQ      + N+WKVG+PSD+WSCGCI+YQMIYG+PPYG FQGQNRL
Sbjct: 679 NYMAPEALVAMNYTQGQPA--EQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRL 736

Query: 669 LAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE 728
           LAIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRW+VD+VLN  F++P  ++ 
Sbjct: 737 LAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTH 796

Query: 729 SIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
             + DLI+N+V+YG+ + +IS++ + ++ E V  + AD+++
Sbjct: 797 FFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/830 (42%), Positives = 476/830 (57%), Gaps = 102/830 (12%)

Query: 18  TRQLSDDEEFTTPPKLSNFGSALLS-------------------------HTEKASTSEA 52
            R  SDDE    PP LSNFGSALLS                         H++  S +E 
Sbjct: 33  ARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLPSRTET 92

Query: 53  LSTNKNDKIANPVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMT 112
           L+ ++    AN                   G              LF  +  N  Q SMT
Sbjct: 93  LAMSREFSTAN-------------TNSSYTGPHSTIHSVDHSDSTLFATFKDN--QQSMT 137

Query: 113 TMNTSDIEMSVG---NSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPA 169
           T N  D     G    SL++S  +IK+L+Q +++D++S+ ++RR++RF  S+R + LGPA
Sbjct: 138 TFNPDDQLHQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRF-ASSRLSLLGPA 196

Query: 170 KRATTLKS-------VFDDDVADSSNQLISISRETTESPLAD------------SYQAGF 210
           KRA++          + + +++     + + S  T  + L +            + Q+  
Sbjct: 197 KRASSTSGTPNRSELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSH 256

Query: 211 RGTRKKDMKYESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKHXXX 270
                  + YE ++F DLNP QY+KK+NL T++LP IS+IYF+RQ+ +N++AALRK    
Sbjct: 257 SPFISSTINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRK-SIA 315

Query: 271 XXXXXXXXXXXXXXXXXXXXXKDASITFNSS--SQPRRKVXXXXXXXXXXVEIRKTFKEN 328
                                 DA    NS+   QPRRK+                F   
Sbjct: 316 SKDAIQNRIATTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDPKA-WSSPFSGI 374

Query: 329 VNASNINSPNGPVHKIYKEISRNKDPD------CEKREVLRNISINANHADNILQQENKR 382
            N +  ++     ++  ++ S  + PD        +RE L NI+IN+  A    Q ++K+
Sbjct: 375 NNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSA---AQPQHKK 431

Query: 383 LKRS---------LDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPARTATS-- 431
            K S         L    +     ++ K +  F HR  P  P  K VEIVEP RT  S  
Sbjct: 432 PKYSDYNPQEFGRLPRPSLENRSPISNKEEPQFKHRSPPLIP-GKHVEIVEPIRTKESIP 490

Query: 432 -----------SSNRNMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVSFDA 479
                         R ++ VN ++YEK+ELLGRGG+S+VYKVK  + NKVYALKRVSFD 
Sbjct: 491 LKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSKVYKVKNANNNKVYALKRVSFDE 550

Query: 480 FDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMS 539
           FDDSSIDGFKGEI          RV++L+D+EM  G+LY++MECGDHDLSQ L  R  M 
Sbjct: 551 FDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMP 610

Query: 540 LDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNI 599
           LD  FVR++A+EML+C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVPEHTVNI
Sbjct: 611 LDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNI 670

Query: 600 YRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY 659
           YRETQIGTPNYMAPEALVAMNYT N     + ++WKVG+PSD+WSCGCI+YQMIYG+PPY
Sbjct: 671 YRETQIGTPNYMAPEALVAMNYTHNQAP--EQSRWKVGKPSDIWSCGCIIYQMIYGRPPY 728

Query: 660 GSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNST 719
           G FQGQNRLLAIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRWTV++V N +
Sbjct: 729 GGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGS 788

Query: 720 FLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           F++P  ++   + DLI N+VRYG+ + +IS   + ++ E V  +  ++++
Sbjct: 789 FVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEFRL 838

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/821 (41%), Positives = 467/821 (56%), Gaps = 112/821 (13%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANPVFEEMNXXXXXXXXXXX 81
           SDD+    PPKLSNFGSALL+  E  + +    +  + +  N                  
Sbjct: 38  SDDDHPLGPPKLSNFGSALLTDKENETPTYLRRSGTSLQGGN---------ATATSGHTK 88

Query: 82  MGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDKSFERIKNLRQNM 141
                           LF     + HQ SMTT+   D E +       S  R + ++Q+M
Sbjct: 89  PSTFTGTMNTEDSHSTLFSSM--SKHQPSMTTV---DAERTAPGDDGLSSHRYQVIQQSM 143

Query: 142 KEDITSKYAERRSKRFLISNRTTKLGPAKRATTL------KSVFDDDVADSSNQL----- 190
           K++I S+   RRS+RF I++R   LGPAKR +T        ++  D+  D S+Q      
Sbjct: 144 KDEILSRQGTRRSRRF-ITSRLATLGPAKRNSTTTNFEFSSNISHDEPRDVSHQEGNVST 202

Query: 191 -------------ISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKH 237
                         ++  +T E    D  ++     +     Y +I F DLNP QY+KKH
Sbjct: 203 SSNSNSGVLNNNGYNVFLDTEERARHDDKESHSAARQSGLSDYGNISFGDLNPYQYLKKH 262

Query: 238 NLSTSDLPIISQIYFDRQREENKQAALRKHX------XXXXXXXXXXXXXXXXXXXXXXX 291
           NL TS+LP IS+IYF+ Q+ EN++AA+RK+                              
Sbjct: 263 NLPTSELPNISRIYFEMQKRENRRAAVRKNVLNGSGGQVAQLPTNNSAIASTAVALKEAN 322

Query: 292 KDASITFNSSS---------------QPRRKVXXXXXXXXXXVEIRKTFKENVNASNINS 336
             ASI+  S+                QPRRK               K     ++A   N 
Sbjct: 323 GIASISSGSNKLTPPQAANSMIKRDRQPRRK-----HSDASVSSFSKLLSSPISAGAPNY 377

Query: 337 PNGPVHKIYKEISRNKDP-----DCEKREVLRNISINANHADNILQQENKRLKRSLDDAI 391
            +   H   ++ S   +P     + +KRE L ++ +NAN   +I+ ++ K          
Sbjct: 378 ADSQKHTPVQKNSTPYEPLLINQNTKKREALNSLDVNANRHPSIITKKQK---------- 427

Query: 392 INENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPAR------------TATSSSN----- 434
           ++E  D         Y + AP     KKVEIVEP R            +A   +N     
Sbjct: 428 VDELHD---------YLKKAPAAASVKKVEIVEPVRDPVITTIPLKPPSAEVPANVHQLP 478

Query: 435 ---RNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAFDDSSIDGFKGE 491
              R +ITVN S+YEK+ELLGRGGSS+VYKV+ S N++YALKRVSFD FDD+S DGFKGE
Sbjct: 479 QRKRQVITVNGSEYEKVELLGRGGSSKVYKVRNSSNRIYALKRVSFDEFDDASADGFKGE 538

Query: 492 IXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKE 551
           I          RV++L+D+EM  G+LY++MECGDHDLSQ+L QR +M LD  FVR++A+E
Sbjct: 539 IELLKKLENQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRSSMPLDIEFVRYHAQE 598

Query: 552 MLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 611
           ML+C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYM
Sbjct: 599 MLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYM 658

Query: 612 APEALVAMNYTQNND---NRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL 668
           APEALVAMNYTQ++D        N+WKVG+PSD+WSCGCI+YQMIYGKPPYGSFQGQNRL
Sbjct: 659 APEALVAMNYTQDSDQIQQEMHHNRWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRL 718

Query: 669 LAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE 728
           LAIMNP+VKI +PE T   + +P++A++ +KACL RNP++RWTVD++L   F++P  ++ 
Sbjct: 719 LAIMNPEVKIVYPEKTPTGDFVPRTALDTIKACLERNPERRWTVDELLRGPFIKPITVTH 778

Query: 729 SIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
             + DLI+NAV+YGS++  +S + + ++ + V  + +D+++
Sbjct: 779 FFIRDLIKNAVKYGSDQRYVSKEKVENLADDVWHRLSDFRL 819

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/772 (44%), Positives = 466/772 (60%), Gaps = 81/772 (10%)

Query: 25  EEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANPVFEEMNXXXXXXXXXXXMGN 84
           E    PPKLSNFGSALL+  + + T+    T       N V   ++           +  
Sbjct: 30  ENIIGPPKLSNFGSALLTENDNSGTTSRFHTQFRSLNGNSVHSPISLSRNNSYGSYGIA- 88

Query: 85  LXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDKSFE----RIKNLRQN 140
                        +F   + N+   SMTT+     + +V N+++  +E    +I  ++Q+
Sbjct: 89  ------EQSPQTSIFATTI-NNRPISMTTIQNGSADSNVTNNVNDKYESSYNKINKIQQS 141

Query: 141 MKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFDDDVADSSNQLISISRETTES 200
           +K+++TS++   R KRFL +NR  KLGPAKRA+T++   D  +  ++N   + S +    
Sbjct: 142 IKDELTSRHTG-RIKRFLNTNRMNKLGPAKRASTME--VDIPLPANTNDSYNSSSDVF-- 196

Query: 201 PLADSYQAGFRGTRKKDMK---YESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQRE 257
               S QA       K+++   Y +I+F DLNP Q+++K+NL T++LP IS+IYF+RQ+E
Sbjct: 197 ----SGQAIEEANDIKEVQNYDYSNINFGDLNPFQFLRKYNLPTTELPNISKIYFERQKE 252

Query: 258 ENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDASITFNSSSQPRRKVXXXXXXXXX 317
           EN+ + L+KH                        KD SI+ N +S+ +  +         
Sbjct: 253 ENRLSILKKH----------TNNNTGAKTNGNDIKDFSISKNLTSEDKTDLKNTVNTGLV 302

Query: 318 XVEIRKTFKENVNASNINSPNGPVHKIYKE-----------ISRNKD---PDCEKREVLR 363
               R      +++   NS   P  K   E           ++ N D   P+ ++RE L 
Sbjct: 303 S---RTLLNSTLSSRKTNSSLSPKSKDNNEFNSLDVEEPKHLTSNNDEIRPN-KRREPLV 358

Query: 364 NISINANHAD----NILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKK 419
           ++S N    +       ++  KR      D IINE E+V    Q+V        P   K+
Sbjct: 359 DLSTNRKEPELKRFKTFEENKKR------DEIINEKENV---VQDV--------PKSMKR 401

Query: 420 VEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDA 479
           VEI+EP     S   RN+I VN+++YEKIELLGRGGSS+VYKVKG  NKV+ALKRV FD 
Sbjct: 402 VEIMEP---KMSHRQRNVINVNETEYEKIELLGRGGSSKVYKVKGPSNKVFALKRVVFDE 458

Query: 480 FDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMS 539
           FDDSSI+GFKGEI          RV++L DYEM  GLLYLIMECGD DLSQILNQ+ N++
Sbjct: 459 FDDSSINGFKGEIKLLNKLRNENRVVKLFDYEMNQGLLYLIMECGDVDLSQILNQKINLN 518

Query: 540 LDFN--FVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTV 597
           L F+  F+R+Y +EM++C+KVVHD GIVHSDLKPANFVLVKG+LKIIDFGIA+AVP+HTV
Sbjct: 519 LPFDIEFIRYYTREMIKCVKVVHDNGIVHSDLKPANFVLVKGVLKIIDFGIADAVPDHTV 578

Query: 598 NIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKP 657
           NIYRETQ GTPNYMAPE L+AMNYT N        KWKVG+PSD+WSCGCI+YQMIYGK 
Sbjct: 579 NIYRETQTGTPNYMAPETLIAMNYTNNGAKDL---KWKVGKPSDVWSCGCIIYQMIYGKA 635

Query: 658 PYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLN 717
           PY  FQGQ+R+ AIMN DVKI +PE T+ +E IPK+ +ELMK CL R+P KRWTVD +L+
Sbjct: 636 PYAGFQGQHRIFAIMNSDVKIVYPEKTNEEELIPKTMVELMKNCLRRDPGKRWTVDDILS 695

Query: 718 STFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           STFL P + S+S + DLI+NA+ +GS++  +S D +ND+   VL +  ++K+
Sbjct: 696 STFLNPIVTSQSFIRDLIKNAITFGSQQKIVSEDKINDLTNDVLTRLQEFKM 747

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/803 (39%), Positives = 457/803 (56%), Gaps = 69/803 (8%)

Query: 4   NSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIAN 63
           N +H   D   ++++ Q SDD E   PPKLSNFGS L+S        E ++ N++DK   
Sbjct: 3   NPYHSESDQIWRISS-QDSDDGEIGNPPKLSNFGSELIS-----DAIENINPNRSDK--K 54

Query: 64  PVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLF-----GRYLRNSHQTSMTTMNTSD 118
            + EE               N              F           S  ++  +  T D
Sbjct: 55  LISEETRIHESHSQQLNTDINQSTRVTHSASSPLYFEDTSPSTMFVQSQASAQPSATTYD 114

Query: 119 IEMSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFL-ISNRTTKLGPAKRATTLKS 177
           I     +   KSF ++K+ +  +K+++T++Y+ERR++RFL  +NRTTKLGPA R  T  +
Sbjct: 115 ISSQDYSDSSKSFIKLKSKQDTLKQELTTRYSERRTRRFLHATNRTTKLGPALRNLTSPA 174

Query: 178 VFDDDVADSSNQL-----ISISRETTESPL------ADSYQAGFRGTRKKDM-------- 218
           +  +D     N++     ++ S +T  + +       D Y +G      KD         
Sbjct: 175 LAINDNNSIDNKMNETSKVNSSFDTNNAYVDFHQTKQDIYTSGEEHNNTKDNGKIGATQQ 234

Query: 219 -KYESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXX 277
             Y  I+  + NPIQY+K HNL TS+L  IS+ YF+ +++E  +    K+          
Sbjct: 235 NDYSDINIHECNPIQYMKMHNLPTSELSKISKAYFE-KQKEENRKKALKNVNMKQSLNYD 293

Query: 278 XXXXXXXXXXXXXXKDASIT-------FNSSSQPRRKVXXXXXXXXXXVEIRKTFKENVN 330
                         K+ ++        FN                     +   F E+ N
Sbjct: 294 LKHYSNSFPSIESGKENNLIHNTEIEDFNGRGHSTNNHSSSYLSNSHSHPVSTQFVESAN 353

Query: 331 ASNINSPNGPVHKIYKEISRNKDPDCEKREVLRNISINANHADNILQQENKR--LKRSLD 388
              +  P      + K +S        +RE L+NI +N+N  D  +  + ++  LK S  
Sbjct: 354 IE-LEKPT-----LKKSLSNADSYRHTQREALQNIDVNSNVRDGAIDYKRQKIALKDSEF 407

Query: 389 DAIINENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKI 448
           D I+++ +   +K                 +VEIVEP  +    S +N+++VN ++YE++
Sbjct: 408 DGILDKKKYRGIK-----------------RVEIVEPPTSTRPPSRKNVVSVNGTEYERV 450

Query: 449 ELLGRGGSSRVYKVKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLL 508
           ELLGRGGSS VYKV+G  N+VYALK+VSFD FD+SS++GFKGEI          RV+QL 
Sbjct: 451 ELLGRGGSSNVYKVRGLKNRVYALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLY 510

Query: 509 DYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSD 568
           D+EMG G+LYL+MECGD+DLSQ+L+QR N   D  F+R++A+EM+ C+KVVHDAGIVHSD
Sbjct: 511 DFEMGSGVLYLLMECGDYDLSQVLHQRANQPFDMEFIRYHAREMVTCVKVVHDAGIVHSD 570

Query: 569 LKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNR 628
           LKPANFV VKGILKIIDFGIANAVP+HTVNIYR+ QIGTPNYMAPEALVA NYT +ND +
Sbjct: 571 LKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGK 630

Query: 629 HD--GNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSN 686
           +D   NKWK+G+P+D+WSCGCI+YQMIYGKPPY  +QGQ RLL+IM+P+VKI + E   +
Sbjct: 631 YDQKTNKWKIGKPADIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPD 690

Query: 687 DEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKP 746
              IP  A+ELM+ CL RNP++RW+  ++L+S FL P M+S+  +++LI  AV YG+ + 
Sbjct: 691 KTVIPSLALELMQYCLMRNPEERWSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREG 750

Query: 747 QISHDNLNDVVETVLRKFADYKI 769
            +S   L  + ++VL + AD+++
Sbjct: 751 DVSPSRLEALTDSVLARLADFRM 773

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/791 (40%), Positives = 458/791 (57%), Gaps = 91/791 (11%)

Query: 24  DEEFTTPPKLSNFGSALLSHTEK-------ASTSEALSTN--------KNDKIANPVFEE 68
           DE+ T  PKLSNFGSAL+S   +        ++S ++S+N        KN++I   +   
Sbjct: 30  DEKLTVLPKLSNFGSALISEKNENITRNSLTNSSISMSSNYNQINTLTKNNEIGT-INSN 88

Query: 69  MNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYL-RNSHQTSMTTMNTSDIEMSVGNSL 127
            N           + NL              GR + R     S+     ++++ ++  S 
Sbjct: 89  FNNGQIASPKFKGIKNLIDQEMTVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPS- 147

Query: 128 DKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFDDD----- 182
                       +M E    +Y E   K F   N      P K  TT  S+  ++     
Sbjct: 148 ------------HMTEVNYDQYQENDHKTFESMNDMENDIP-KYKTTTDSILSNNKSTDN 194

Query: 183 ---------VADSSNQLISISRETTESPLADSYQAGFRGTRKKD--MKYESIDFEDLNPI 231
                    V   S+   S    +T +P  DS       T   +  + Y  I+  DLNP 
Sbjct: 195 LAGKNSKNHVTTPSSSFGSTLYSSTTNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPF 254

Query: 232 QYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXX 291
           Q +KK+NL +++L  IS++YF++Q+EEN++  ++K                         
Sbjct: 255 QVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTSISSNSVSSKISRQS 314

Query: 292 KDASITFNSSSQPRRKVXXXXXXXXXXVEIRKTFKENVNASNINSPNGPV-HKIYKEISR 350
                +F++++  R                    K++ NA  +N+ +     K+ K ++ 
Sbjct: 315 -----SFHTTTNNRHSSMVS--------------KQDTNAILMNTTSTRSDEKVMKPLNE 355

Query: 351 NKDPDCEKREVLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRP 410
             +PD   R+VL +I IN N   N +++     KR ++     E   +++          
Sbjct: 356 -YEPD---RKVLASIDINKNINVNAIEK-----KRPVEHQYSYEKSKIHISESRESQSST 406

Query: 411 APKP----------PVTKKVEIVEPARTATS-SSNRNMITVNDSQYEKIELLGRGGSSRV 459
             KP           + KKVEIVEP  + T+  S++++++VND +YE+IELLGRGGSS+V
Sbjct: 407 VEKPHTFQDNKEGQKIVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKV 466

Query: 460 YKVKGSGN-KVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLY 518
           YKVK + N +VYALKRV FD FDD+S+D FKGEI          RV++L+ Y+M +G+LY
Sbjct: 467 YKVKNTNNNRVYALKRVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLY 526

Query: 519 LIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK 578
           L+MECGDHDLSQILNQR NM LD +F+R+Y++EML+C+KVVHDAGIVHSDLKPANFVLVK
Sbjct: 527 LVMECGDHDLSQILNQRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVK 586

Query: 579 GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGR 638
           GILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVA+N   N + +   N+W+VG+
Sbjct: 587 GILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVEKK---NRWRVGK 643

Query: 639 PSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELM 698
           PSD+WSCGCI+YQM YG+PPYG+FQ QNRLLAIMNP+VKI F E TS +E++PKSA++ M
Sbjct: 644 PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTM 703

Query: 699 KACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVE 758
           KACL R+P+KRWT D++L+++FL P +++  I+ DLIRNAV YGS++ Q+S D + ++ +
Sbjct: 704 KACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELAD 763

Query: 759 TVLRKFADYKI 769
            VL + AD+++
Sbjct: 764 DVLNRLADFRL 774

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score =  527 bits (1357), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 313/768 (40%), Positives = 436/768 (56%), Gaps = 158/768 (20%)

Query: 108 QTSMTTMNT-----SDIEMSVGNSLDK-----------------SFERIKNLRQNMKEDI 145
           Q SMTTMNT     +DI  S  N  +K                 + ++ K L+Q+MKE++
Sbjct: 78  QPSMTTMNTVVKEDNDISNSNSNHDNKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEEL 137

Query: 146 ---TSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFDDDVADSS------------NQL 190
              T+K + +R++RF I++R + LGPAKR   L + F+ D    S            N  
Sbjct: 138 YNSTTKSSNKRNRRF-ITSRLSSLGPAKR--NLSTSFNVDSPSESRVDNSQINSSIINDT 194

Query: 191 ISISRETTE-SPLADSYQAGFR--------------------------GTRKKDMKYESI 223
            +IS++  E S  ++S   G+R                             + ++ YE+I
Sbjct: 195 SNISQQDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKDPSANLQPNINYENI 254

Query: 224 DFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXX 283
           DF DLNP QY+KK+NL + +LP IS++YF+RQ+EEN++  LRK                 
Sbjct: 255 DFGDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLALKREFTQYRR 314

Query: 284 XXXXXXXXKDASITFNSSSQPRRKVXXXXXXXXXXVEIRKTFKENVNASNINSP-NGPVH 342
                           ++ QPRRK                      + +++  P + P+ 
Sbjct: 315 TQ--------------TARQPRRK-----------------HNFGTDKTSLQDPLSSPLQ 343

Query: 343 K---IYKEISRNKDPDCEKREVLRNISINANHADNILQQENKRLKRSLDDAIINENEDVN 399
           K   +++E+ R       KRE L+ + +N   +     QE KR K         EN+ V 
Sbjct: 344 KNQLVFQEVDREL---ANKREALKPLDVNNPSS----SQEAKRPKY--------ENDHVP 388

Query: 400 VKNQEVFY-HRPAPKPPVTK---KVEIVEPARTATS-----------SSNRN-------- 436
              +  F+ HR AP P  +K   KVEIVEP ++              SS  N        
Sbjct: 389 EDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNY 448

Query: 437 ---------------MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAFD 481
                           ITVN + YEK+ELLG+GGS +VYKVK S +KVYALKRVSFD FD
Sbjct: 449 NGSFDTKKRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKSSDHKVYALKRVSFDEFD 508

Query: 482 DSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLD 541
           +SSIDGFKGEI          RV++L+DY MG G+L+L+MECG+HDLSQ+L QR  +  D
Sbjct: 509 ESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFD 568

Query: 542 FNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYR 601
             FVR++ +EM++C+KVVHDA IVHSDLKPANFV VKG+LKIIDFGIANAVP+HTVNIYR
Sbjct: 569 TEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYR 628

Query: 602 ETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGS 661
           + QIGTPNYMAPE LVAMN+T+N+  +    KWKVG+PSD+WSCGCI+YQM+YGKPPYG+
Sbjct: 629 DNQIGTPNYMAPETLVAMNFTRNDGEQ---AKWKVGKPSDVWSCGCILYQMVYGKPPYGT 685

Query: 662 FQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           FQG NRL AIMNPDVKIP+PE  S    IP++ I+ +++CL RNP  R T+D++L+   +
Sbjct: 686 FQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALI 745

Query: 722 QPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
            P  +++  + DLI+NAV YG ++  ++++ + ++ E V  K A++K+
Sbjct: 746 NPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  513 bits (1321), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 318/422 (75%), Gaps = 13/422 (3%)

Query: 357 EKREVLRNISINANHADNILQ-QENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPP 415
           +KRE L +I++N NH  +  +  +NKR K S    I +E E V  +N  +   +      
Sbjct: 374 KKREALSSINVNTNHNHSYQELGDNKRNKISTK-GIESEIEHVAARNSMLEQQKVEQLNS 432

Query: 416 VT------KKVEIVEP-ARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKG-SGN 467
                   KKVEI+EP + +A   +++++++VN  +YEKIELLGRGGSS+VYKVK    N
Sbjct: 433 ANIHKHGKKKVEIIEPKSASANRIASKSVVSVNGVEYEKIELLGRGGSSKVYKVKNVHNN 492

Query: 468 KVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHD 527
           K++ALKRV FD FD+SSID FKGEI          RV+ L+ ++M  G+L LIMECGDHD
Sbjct: 493 KIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMECGDHD 552

Query: 528 LSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFG 587
           LSQILNQR NM LD  F+RF+A+EML+C+KVVHDAGIVHSDLKPANFV VKGILKIIDFG
Sbjct: 553 LSQILNQRMNMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFG 612

Query: 588 IANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGC 647
           IANAVP+HTVNIYRETQIGTPNYMAPEALVAMN  Q++D +   NKWKVG+PSD+WSCGC
Sbjct: 613 IANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSDQQ---NKWKVGKPSDIWSCGC 669

Query: 648 IVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPD 707
           I+YQM YG+PPYGSFQGQNRLLAIMNP+VKI F E TSN+E+IP+SA+E MKACL RNPD
Sbjct: 670 ILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRNPD 729

Query: 708 KRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADY 767
           KRW VD+VL  +F  P M++  I+ DLI+NAV YG+++  ++ + + ++ + VL + AD+
Sbjct: 730 KRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELADDVLNRLADF 789

Query: 768 KI 769
           ++
Sbjct: 790 RL 791

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 131/271 (48%), Gaps = 45/271 (16%)

Query: 17  NTRQLSDDEEFTTPPKLSNFGSALLSH-----TEKASTSEALSTNKNDKIANPVFEEMNX 71
           N +  SDDE+ T  PKLSNFGSALL+      T+   T+  L+ N +  +A   +     
Sbjct: 41  NIQDDSDDEQITGFPKLSNFGSALLTSEKENITKNKLTNTNLTLNDDKSLAYDNY----- 95

Query: 72  XXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDKSF 131
                      GN+                    S   +    N S   +S GNS   +F
Sbjct: 96  --SSTLSINRAGNVNTTSSM--------------SKANNNYEYNNSSENISTGNS---TF 136

Query: 132 ERIKNLRQNMKEDITSKYAERR-SKRFLISNRTTKLGPAKRAT---------TLKSVFDD 181
           +R K L +++K+++ +K  ERR ++RF    +   LGPA R           +     ++
Sbjct: 137 QRFKGLHESIKDELNTKNLERRKTRRFFNRTKMGVLGPAMRTNLENEKLGKNSKHETIEE 196

Query: 182 DV--ADSSNQLISISRETTESPLA---DSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKK 236
            +   D    LIS S     S      D++Q+    T +  + Y+ IDF +LNP+QYIKK
Sbjct: 197 KINKYDQPAHLISSSSTVASSSYTSYHDTHQS-INQTSQTTINYDLIDFGELNPVQYIKK 255

Query: 237 HNLSTSDLPIISQIYFDRQREENKQAALRKH 267
           +NL T++LP IS++YF+RQR E+++ AL+KH
Sbjct: 256 NNLPTTELPTISKLYFERQRAESRKIALKKH 286

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score =  513 bits (1321), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 236/439 (53%), Positives = 315/439 (71%), Gaps = 41/439 (9%)

Query: 353 DPDCEKREVLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYH-RPA 411
           +P+ +KRE L  + +N+ +   I+ +++K                    +++ FYH R A
Sbjct: 445 NPNTKKREALNKLDVNSTNQQAIVHKKHK-------------------SDEQNFYHIRKA 485

Query: 412 PKPPVTKKVEIVEPARTA------------------TSSSNRNMITVNDSQYEKIELLGR 453
           P PP  KKVEI+EP +                    T    R +I VN S+YEK+ELLGR
Sbjct: 486 PNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGR 545

Query: 454 GGSSRVYKVKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMG 513
           GGSS+VYKV+ S NK+YALKRVSFD FDD+SIDGFKGEI          RV++L+D+EM 
Sbjct: 546 GGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMN 605

Query: 514 DGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPAN 573
            G+LY++MECGDHDLSQ+L QR NM  D  FVR++A+EML+C++VVHD GIVHSDLKPAN
Sbjct: 606 HGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPAN 665

Query: 574 FVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQN---NDNRHD 630
           FV VKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYT +    +    
Sbjct: 666 FVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQ 725

Query: 631 GNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKI 690
            N+WKVG+PSD+WSCGCI+YQMIYG+PPYG FQGQNRLLAIMNP+VKI +PE T++ + +
Sbjct: 726 QNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLV 785

Query: 691 PKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISH 750
           P++A++ +KACL RNP++RWTVD +L   F++P  ++   + DLI+NAV+YGS++  +S 
Sbjct: 786 PRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSK 845

Query: 751 DNLNDVVETVLRKFADYKI 769
           + + D+ + V  + +D+++
Sbjct: 846 EKVEDLADDVWNRLSDFRL 864

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 138/271 (50%), Gaps = 41/271 (15%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANPVFEEMNXXXXXXXXXXX 81
           SDDE   +PPKLSNFGSAL +  E  + +      K+  +A P     N           
Sbjct: 39  SDDENPLSPPKLSNFGSALFTDKENETPT---YLRKSGVVAQPA-PYPNINMNANKPPTL 94

Query: 82  MGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSDIEMSVGNSLDKSFERIKNLRQNM 141
            G L            LF    +  HQ SMTT+N    + + G     S+ R + ++Q+M
Sbjct: 95  TGTLHMDDGSHST---LFTSVSK--HQPSMTTVNQE--QRTPGEEGLGSY-RFQMIQQSM 146

Query: 142 KEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD-------DDVADSS------- 187
           K++++S+   RRS+RF I++R + LGPAKR TTL +  D       +D  D S       
Sbjct: 147 KDELSSRQIMRRSRRF-ITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGNIS 205

Query: 188 -----------NQLISISRETTESPLADSYQA-GFRGTRKKDMKYESIDFEDLNPIQYIK 235
                      NQ  ++  +T  +   DS +  G +     D  Y++I F DLNP QY+K
Sbjct: 206 SSSNNHSGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSID--YDNISFGDLNPYQYLK 263

Query: 236 KHNLSTSDLPIISQIYFDRQREENKQAALRK 266
           KHNL TS+LP IS+IYF+ Q++EN++AA+RK
Sbjct: 264 KHNLPTSELPNISRIYFEIQKKENRRAAVRK 294

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  493 bits (1270), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 219/357 (61%), Positives = 282/357 (78%), Gaps = 4/357 (1%)

Query: 413 KPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYAL 472
           KPP T  ++   PA   + +  +  I VN ++YEK+ELLGRGGSS+VYKV+   NKVYAL
Sbjct: 509 KPPATGSLK--PPASLDSHARRKPTIQVNGTEYEKMELLGRGGSSKVYKVRTPNNKVYAL 566

Query: 473 KRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQIL 532
           KRV+FD FD+SS+DGFKGEI          RV++L+DYEM  G+L+++MECGDHDLS IL
Sbjct: 567 KRVAFDEFDESSVDGFKGEIELLKKLENQPRVVRLVDYEMAHGVLFVVMECGDHDLSSIL 626

Query: 533 NQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 592
             R ++ LD  FVR++A+EML+C+KVVHDA IVHSDLKPANFV VKGILKIIDFGIANAV
Sbjct: 627 AHRASLPLDIEFVRYHAQEMLRCVKVVHDADIVHSDLKPANFVFVKGILKIIDFGIANAV 686

Query: 593 PEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQM 652
           P+HTVNIYRETQIGTPNYMAPEALVAMNY Q     H  N+WKVG+PSD+WSCGCI+YQM
Sbjct: 687 PDHTVNIYRETQIGTPNYMAPEALVAMNYAQGQP--HQQNRWKVGKPSDIWSCGCILYQM 744

Query: 653 IYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTV 712
           IYG+PPYG FQGQNRLLAIMNP+VKI +PE T + + +P++A++ MKACL RNPDKR TV
Sbjct: 745 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTPSGDVVPRTALDTMKACLERNPDKRCTV 804

Query: 713 DKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           D+VLN  F++P  ++   + DLI+NAV+YGSE+ ++S + + ++ + V  + A++++
Sbjct: 805 DEVLNGAFIRPVSVTHFFVRDLIKNAVKYGSEQREVSSEKVEELADDVWNRLAEFRL 861

 Score =  125 bits (314), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 99/304 (32%), Positives = 151/304 (49%), Gaps = 55/304 (18%)

Query: 7   HDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALL----SHTEKAS--TSEALSTNKNDK 60
           H +  S  +++ +  SDDE    PPKLSNFGSALL    +HT   +    +A + +    
Sbjct: 21  HLFQRSSQRVSLKDDSDDEHPIGPPKLSNFGSALLFDKENHTPTGTGLQRDAAAADLRKS 80

Query: 61  IANPVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGR---------------YLRN 105
           +A   F++++             NL             FG                +  +
Sbjct: 81  VA---FQDISTGCQRPSQVPLSRNLSLNSMSNTNNT--FGASYPSYNSEDPSQSTLFTTS 135

Query: 106 SHQTSMTTMNTSDIEMSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTK 165
            HQ SMTT++     +    S ++S  R++ L+ ++KE+++S++A+RR++RF +S+R   
Sbjct: 136 RHQPSMTTVHPEPHGLDSSKS-EQSSHRLRALQHSLKEELSSRHAKRRNRRF-VSSRLGL 193

Query: 166 LGPAKRATTLKSVFDDDVADSSNQLISISRETTESPLADSYQAGFRG------------- 212
           LGPAKRA++   +      DS N   SIS++        S  +GF G             
Sbjct: 194 LGPAKRASSTAGLA---YTDSGNDDASISQQEANVS-GSSSTSGFVGNNEGYNVFLESHT 249

Query: 213 --------TRKKD--MKYESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQA 262
                   T  KD  + Y  +DF DLNP QY+KKHNL TS+LP IS+IYF+RQ+EEN++ 
Sbjct: 250 GAGERQHHTSSKDTGVDYRDVDFGDLNPYQYLKKHNLPTSELPNISKIYFERQKEENRRT 309

Query: 263 ALRK 266
           ALRK
Sbjct: 310 ALRK 313

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  475 bits (1223), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/366 (59%), Positives = 281/366 (76%), Gaps = 7/366 (1%)

Query: 407 YHRPAPKPPVTKKVEIVEPARTATS--SSNRNMITVNDSQYEKIELLGRGGSSRVYKVKG 464
           Y R +PK    KKVEI+EP   A    +  +  ITVN   YEKIELLGRGGSS+VYKVK 
Sbjct: 386 YKRLSPK----KKVEIIEPFIYAQKKKTGKKLSITVNGIDYEKIELLGRGGSSKVYKVKN 441

Query: 465 SGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECG 524
             NK++ALKRVSFD FDDSSI GFKGEI          RV++L DY+M  G+LYLIMECG
Sbjct: 442 DQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQMSSGVLYLIMECG 501

Query: 525 DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKII 584
           D+DLSQ+LNQR    LD +F+R++ +E+L+C+K VHDAGIVHSDLKPANFV +KG+LK+I
Sbjct: 502 DNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVHDAGIVHSDLKPANFVFIKGLLKLI 561

Query: 585 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT-QNNDNRHDGNKWKVGRPSDMW 643
           DFGIAN +P+HTVN+YRE+QIGTPNYMAPE L+A N++ + +D   + +KWKVG+PSD+W
Sbjct: 562 DFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQSDLNKEMSKWKVGKPSDVW 621

Query: 644 SCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLY 703
           SCGCI+YQMIYG+PPY  FQGQNRLLAIMNP+VK+ F E T+ DEKIP S I+LMKACL 
Sbjct: 622 SCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTAKDEKIPTSLIDLMKACLL 681

Query: 704 RNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRK 763
           R+P KRW++DK+L S F  P +++   ++DLI+NAV+YG+++  ++   + ++   VL +
Sbjct: 682 RDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTDAKIEELSNDVLER 741

Query: 764 FADYKI 769
             D+K+
Sbjct: 742 LNDFKM 747

 Score =  112 bits (280), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 88/259 (33%), Positives = 129/259 (49%), Gaps = 19/259 (7%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDKIANPVFEEMNXXXXXXXXXXX 81
           SDDE  + PPKLS F SAL S  + +S     S N N     P+ +              
Sbjct: 26  SDDEPLSDPPKLSTFASALFS-VKDSSNQLDFSENYNSTTNGPINKYAGLKNVSANESHN 84

Query: 82  MGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTS----DIEMSVGNS-----LDKSFE 132
           + N             +F  +     Q S+TT N +    D    +  S     ++ + +
Sbjct: 85  ITNNATQFDDHSSISTIFA-HTNLPRQPSITTTNNNVPGDDDNARLAESYNELEMESNLQ 143

Query: 133 RIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFDDDVADS-SNQLI 191
           RIK L+Q+MKE++TS+Y ERR++RFL S R T+LGPAKRA++  +V + D+  S  N   
Sbjct: 144 RIKVLQQSMKEELTSRYVERRNRRFLTS-RLTRLGPAKRASS--AVSEKDILRSIDNNTQ 200

Query: 192 SISRETTESPLADSYQAGF----RGTRKKDMKYESIDFEDLNPIQYIKKHNLSTSDLPII 247
            +  E    PL+   Q           + ++ Y SIDF  L P +Y+KK  L TS+LP I
Sbjct: 201 HLLPEYHTPPLSVLDQKEISTVPESAARGNIDYSSIDFGRLKPFEYLKKKKLPTSELPSI 260

Query: 248 SQIYFDRQREENKQAALRK 266
           S+ YF +Q+EE+ Q  L+K
Sbjct: 261 SKAYFQKQKEESLQNTLKK 279

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  470 bits (1209), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/361 (60%), Positives = 280/361 (77%), Gaps = 4/361 (1%)

Query: 409 RPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNK 468
           +P P+  V KKVEI+EP      +  + +I VN+ +YEK+ LLGRGGSS+VYKVKG  N 
Sbjct: 620 QPQPQQ-VRKKVEIIEP-EAKIHNYQKPIIIVNNIEYEKVALLGRGGSSKVYKVKGPKNS 677

Query: 469 VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDL 528
            YALKRV FD FDDSSI+GFKGEI          RV++L DY+M +G L+LIMECGD DL
Sbjct: 678 YYALKRVLFDEFDDSSIEGFKGEIELLKKLEHEERVVRLFDYKMENGTLHLIMECGDLDL 737

Query: 529 SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGI 588
           S+IL+QR    LD  F+R+Y++EML+C++VVH+  IVHSDLKPANFVLV  +LKIIDFGI
Sbjct: 738 SRILHQRSKQPLDLEFIRYYSREMLKCVQVVHNNDIVHSDLKPANFVLVGSVLKIIDFGI 797

Query: 589 ANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQN-NDNRHDG-NKWKVGRPSDMWSCG 646
           ANAVP+HTVNIYRE QIGTPNYMAPEALV+MN T N N+N     N+WKVG+PSD+WSCG
Sbjct: 798 ANAVPDHTVNIYRECQIGTPNYMAPEALVSMNLTSNENENAQKPVNRWKVGKPSDVWSCG 857

Query: 647 CIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNP 706
           CI+YQM YGKPPYG +QGQNRLLAIMNP+V+I +PE T N+E IP+SAI+ MKACLYR+P
Sbjct: 858 CILYQMFYGKPPYGHYQGQNRLLAIMNPEVEIKYPEFTPNNEPIPRSAIDTMKACLYRDP 917

Query: 707 DKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFAD 766
            KR+T++++LN+ F  P M++   ++DLI+N+VRYG ++  IS++ L  + + VL +  +
Sbjct: 918 SKRFTIEELLNNPFFSPIMVTPFFLQDLIKNSVRYGIDRKNISNEELEKMSDDVLNRLRE 977

Query: 767 Y 767
           +
Sbjct: 978 F 978

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 36/47 (76%)

Query: 220 YESIDFEDLNPIQYIKKHNLSTSDLPIISQIYFDRQREENKQAALRK 266
           Y SI+F  LNP+QY +KH+L  S+LP +++ Y  +QREEN++A L++
Sbjct: 320 YSSIEFNGLNPMQYWRKHDLPPSELPKLNKAYLQKQREENRKAVLKQ 366

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 79/179 (44%), Gaps = 23/179 (12%)

Query: 5   SFHDYMDSKSKMNTRQLSDDEEFTT--PPKLSNFGSALLSHTE----KASTSEALSTNKN 58
           S H+YMD          SDDE+     PPKLSNFGSALLS+ E    K    + + +  +
Sbjct: 24  SSHNYMDD---------SDDEDNIERGPPKLSNFGSALLSNQEEQNNKQHQQDVMESKDS 74

Query: 59  DKIANPVFEEMNXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNSHQTSMTTMNTSD 118
            +I     ++ N              L                 +R     S+TT+ + +
Sbjct: 75  LQIKT---DKHNIWRNNTNINNTSNTLFGHTDEHSQTSTSTMTSVRMHDHQSVTTLYSDN 131

Query: 119 IEMSVGNSL--DKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTL 175
               + N+L  D +    ++L+Q  +E++ S+   +R++R L + +   LGPA R ++L
Sbjct: 132 NGKDLNNTLVKDSNKSTFRSLKQLSREELPSR---QRNRRLLQNLKAGNLGPASRTSSL 187

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  437 bits (1123), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 263/357 (73%), Gaps = 8/357 (2%)

Query: 413 KPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYAL 472
           KP + K+VEI EP  +  ++S    I +N+ +YEKIELLG GGSS+VYKV+ S  KV+AL
Sbjct: 417 KPAIIKRVEIQEPKPSKKNTS----IVINNEEYEKIELLGSGGSSKVYKVRDSSKKVFAL 472

Query: 473 KRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQIL 532
           KRV+ D F++SS++ FKGEI          RV+QL +Y +   +LYLIMECGD+DLS +L
Sbjct: 473 KRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSVLYLIMECGDYDLSVML 532

Query: 533 NQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 592
            +R N  LD  FVR+YA+E+  C+KVVHD GIVHSDLKPANF+ VKG LKIIDFGIANAV
Sbjct: 533 RERLNKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIFVKGTLKIIDFGIANAV 592

Query: 593 PEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQM 652
           PEHTVNIYRETQIGTPNYMAPEALVAMNYT    N    ++WKVG+PSD+WS GCI+YQM
Sbjct: 593 PEHTVNIYRETQIGTPNYMAPEALVAMNYTNGESNV---SRWKVGKPSDVWSLGCIIYQM 649

Query: 653 IYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTV 712
           +YGKPPY SFQG +R+ AI+ P VKI +P        +P S IEL+K CL R+P+KR  V
Sbjct: 650 VYGKPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELIKVCLNRDPNKRVDV 708

Query: 713 DKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769
           D +LNSTFL P ++SE+ + DL++NAV YG ++  +S   ++ +   V+ K ++Y+I
Sbjct: 709 DGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALANDVIEKLSEYRI 765

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 129/274 (47%), Gaps = 56/274 (20%)

Query: 30  PPKLSNFGSALLSHTEKASTSEALSTNKNDKIANP--VFEEMNXXXXXXXXXXXMGNLXX 87
           PPKLS+FGS LL+  E A+ S   +  +   +A+   V + ++            G    
Sbjct: 48  PPKLSDFGSNLLN--ESANHSGTFTKFRGLGMAHSPRVTQRIDGPGGNNIVSHRNG---- 101

Query: 88  XXXXXXXXXXLFGRYLRN-SHQTSMTTMN------TSDIEMSVGNSLDKSFER------- 133
                     +FG  + N +  +SMTT+N      +S I     + L+++ ER       
Sbjct: 102 ---SSPSSSSIFGSTVYNPARPSSMTTVNNLKHEDSSRISTVKNDVLNRTLERRRLSRTA 158

Query: 134 --------------------IKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRAT 173
                               I+ ++Q ++++ TSK  ERR+KRFL   R  +LGPAKR +
Sbjct: 159 SSLSNPPTVNSIDLKDHEVNIEKIKQTIRDETTSKLLERRAKRFLNLERRNRLGPAKRTS 218

Query: 174 TLKSVFDDDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQY 233
              S+   ++ D     + I R+       +  Q     T + D  Y +I F DLNP QY
Sbjct: 219 MTSSLITSEMDD-----LLIQRDAK----GEVEQQDREMTPQVD--YSNIVFGDLNPFQY 267

Query: 234 IKKHNLSTSDLPIISQIYFDRQREENKQAALRKH 267
           + K+N+   +LP IS++Y ++++EEN++ ALRKH
Sbjct: 268 VNKYNIPMEELPQISKVYIEKRKEENRRVALRKH 301

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score =  364 bits (935), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 218/645 (33%), Positives = 346/645 (53%), Gaps = 72/645 (11%)

Query: 131 FERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTL--KSVFDDDVADSSN 188
           +  I  +++ MK+ IT K  ++R  R+   +++  LGPA+R+T    K+     ++D  N
Sbjct: 55  YNDIMEMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLEN 114

Query: 189 QLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLSTSDLPIIS 248
               I+    ES L +  + G + T          +  +LNP QY+KK+NL T +L  ++
Sbjct: 115 ----INEPKRESILGE--ETGLKET----------ELGELNPFQYLKKNNLPTKELSRLT 158

Query: 249 QIYFDRQREENKQAALRKHXXXXXXXXXXXXXXXXXXXXXXXXKDASITFNSSSQPRRKV 308
           ++Y +R+ +E +    +                           DA    +SS Q  ++ 
Sbjct: 159 KLYCNRKLDETRSKKTQ-------------------------AIDAHEMNSSSDQLEKRQ 193

Query: 309 XXXXXXXXXXVEIRKTFKENV-----NASNINSPNGPVHKIYKEISRNKD---PDCEKRE 360
                      +  +    NV       ++    +G +H+ Y    RN+      C++  
Sbjct: 194 RKVTTTTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSVRNEQKALSQCQQE- 252

Query: 361 VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV 420
                   AN    ++ +  K +   +D  I + N  +  K  +      AP P      
Sbjct: 253 -----MPTANEQAKLISK--KLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQSV--- 302

Query: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF 480
               P++    S   + IT  D +   +ELLG+GGSS+VYKV+    K YALK++  +  
Sbjct: 303 ----PSQANLMSKQWSRIT--DEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL 356

Query: 481 DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL 540
           D++     + EI          RV++L++Y++ D ++ ++MECG+ DLS +L++R N   
Sbjct: 357 DENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPF 416

Query: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 600
           D NFVR  +KEM++CIK VHD+ IVHSDLKPANF+ VKG LK+IDFGIAN + ++T+N+Y
Sbjct: 417 DINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVY 476

Query: 601 RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 660
           R TQ+GTPNYMAPE L++ NY+ NN+N      WK+G+PSD+WS GCI+YQM YG PPY 
Sbjct: 477 RNTQMGTPNYMAPETLISQNYSNNNNN----LLWKIGKPSDIWSYGCILYQMTYGHPPYS 532

Query: 661 SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720
           SF G +RLLAIMNP+++I +P  +   +K+P+S + L+K CL R+P  R T D++ + +F
Sbjct: 533 SFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592

Query: 721 LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFA 765
             P +IS+  +E LI NA+ YG E   I+ D +  +   V+ K +
Sbjct: 593 FNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLS 637

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  109 bits (273), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 149/318 (46%), Gaps = 31/318 (9%)

Query: 408 HRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGN 467
           H    +PPV KK E +    +A   +  ++I      Y +   LG GG +R +++K    
Sbjct: 58  HLQDQQPPVKKKKEKL----SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDESG 113

Query: 468 KVYALKRVS-FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGD 525
           K++A K V+      + +      EI           V+Q +D    D  +Y+++E C +
Sbjct: 114 KIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHF-NVVQFIDCFEDDTNVYILLEICPN 172

Query: 526 HDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKII 584
             L ++L +R  ++     VR++  ++   IK +H   ++H DLK  N    K   LKI 
Sbjct: 173 GSLMELLKKRRTVTEPE--VRYFMTQICGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIG 230

Query: 585 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
           DFG+A  +       Y  T  GTPNY+APE L+          +H G+ ++V    D+WS
Sbjct: 231 DFGLAAVLANDRERKY--TVCGTPNYIAPEVLMG---------KHSGHSYEV----DIWS 275

Query: 645 CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
            G ++Y ++ GKPP+ S         I N D   P  ++ SN+ K       L+   L  
Sbjct: 276 IGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFPKDKYISNEAKT------LIHDILST 329

Query: 705 NPDKRWTVDKVLNSTFLQ 722
           +P +R +++++++  + +
Sbjct: 330 DPLERPSIEEIIDYVWFR 347

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  109 bits (272), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 151/313 (48%), Gaps = 36/313 (11%)

Query: 428 TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSID 486
           +A   +  ++I      Y +   LG GG +R +++K  G K++A K V+      + +  
Sbjct: 62  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVAKISIKSEKTRK 121

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
               EI           ++Q +D    D  +Y+++E C +  L  +L +R  ++     V
Sbjct: 122 KLLSEIQIHKSMRHTN-IVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE--V 178

Query: 546 RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 604
           RF+  +++  +K +H   ++H DLK  N    K   LK+ DFG+A  +       Y  T 
Sbjct: 179 RFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKY--TV 236

Query: 605 IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            GTPNY+APE L           +H G+ ++V    D+WSCG ++Y ++ GKPP+     
Sbjct: 237 CGTPNYIAPEVLTG---------KHTGHSYEV----DIWSCGVMIYALLIGKPPF----- 278

Query: 665 QNRLLAIMNPDVK---IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF- 720
           Q + + I+   +K     FP+    D+ I   A+ L+K  L  +P +R ++D++++  + 
Sbjct: 279 QAKEVNIIYERIKCGDFVFPK----DKFISPEALVLIKDILSIDPLERPSLDEIIDYVWF 334

Query: 721 --LQPFMISESIM 731
             L P  I  S++
Sbjct: 335 RGLFPSRIDASVL 347

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 150/313 (47%), Gaps = 36/313 (11%)

Query: 428 TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSID 486
           +A   +  ++I      Y +   LG GG +R +++K    K++A K V+      + +  
Sbjct: 62  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRK 121

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
               EI           ++Q +D    D  +Y+++E C +  L  +L +R  ++     V
Sbjct: 122 KLLSEIQIHKSMRHFN-IVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE--V 178

Query: 546 RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 604
           RF+  +++  +K +H   ++H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 179 RFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKY--TV 236

Query: 605 IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            GTPNY+APE L           +H G+ ++V    D+WSCG ++Y ++ GKPP+     
Sbjct: 237 CGTPNYIAPEVLTG---------KHTGHSYEV----DIWSCGVMIYALLIGKPPF----- 278

Query: 665 QNRLLAIMNPDVKIP---FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           Q + + I+   +K     FP     D+ I + A+ L++  L  +P +R ++D++++  + 
Sbjct: 279 QAKEVNIIYERIKCGDYVFPR----DKCISQEALTLIRDILSIDPLERPSLDEIIDYVWF 334

Query: 722 Q---PFMISESIM 731
           +   P  I  S++
Sbjct: 335 RGIFPPRIDASVL 347

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 142/299 (47%), Gaps = 34/299 (11%)

Query: 443 SQYEKIELLGRGGSSRVYK---VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           S +++ E++GRG    VYK   VK    +VYA+K ++ D+ D   ++  + EI       
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKTG--RVYAIKVLNLDS-DSDEVEDVQREIQFLASLK 77

Query: 500 XXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
               + +     + D  L++IME C    L  +L       +D  ++    +E+L  +K 
Sbjct: 78  QISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKC 134

Query: 559 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 617
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 618 AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVK 677
              Y             KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLII--KSK 236

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE-SIMEDLI 735
            P  E    D     S  E +  CL  +P +R + D +L S F++    +  SI+++LI
Sbjct: 237 PPRLE----DRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELI 291

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/293 (29%), Positives = 136/293 (46%), Gaps = 42/293 (14%)

Query: 449 ELLGRGGSSRVYKV--KGSGNKVYALKRVSFDAFDDSSID-------------GFKGEIX 493
           E LG G + +V     K +GN+  A+K +S   F DS++              G + EI 
Sbjct: 22  ETLGLGSTGKVQLAYNKTTGNQA-AIKVISKTIFQDSNVTSMVDNTTPDALPYGIEREIV 80

Query: 494 XXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEM 552
                     V++L D    +  LY+++E  +  +L  +L +RG +  +   +RF+ +++
Sbjct: 81  IMKLLNHAN-VLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQI 137

Query: 553 LQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 611
           +  I   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET  G+P+Y 
Sbjct: 138 IIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL---LETSCGSPHYA 194

Query: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
           APE +  + Y               G  SD+WSCG I+Y ++ G+ P+    G  R L +
Sbjct: 195 APEIVSGIPYH--------------GFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240

Query: 672 MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                +   PE    D++I K A  L+   L  NP +R T   +L    LQ +
Sbjct: 241 KVQAGQFEMPE----DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  105 bits (263), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 143/305 (46%), Gaps = 30/305 (9%)

Query: 436 NMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXX 494
           ++I      Y +   LG GG +R +++K    K++A K V+      + +      EI  
Sbjct: 73  SLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKSEKTRKKLLSEI-Q 131

Query: 495 XXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                    V+Q +D    D  +Y+++E C +  L  +L +R  ++     VRF+  ++ 
Sbjct: 132 IHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEP--EVRFFTTQIC 189

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 612
             IK +H   ++H DLK  N    +   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 190 GAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIA 247

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ S         I 
Sbjct: 248 PEVLMG---------KHSGHSYEV----DIWSIGVMLYALLIGKPPFQSKDVNTIYERIK 294

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ---PFMISES 729
             D   P  +H SN+ K+      L++  L  +P +R ++ ++++  + +   P  I  +
Sbjct: 295 CCDFSFPKEKHISNEAKV------LIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIEST 348

Query: 730 IMEDL 734
           +M ++
Sbjct: 349 VMTEV 353

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 34/299 (11%)

Query: 443 SQYEKIELLGRGGSSRVYK---VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           S +++ E++GRG    VYK   VK    +VYA+K ++ D+ D   ++  + EI       
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKT--RRVYAIKVLNLDS-DSDEVEDVQREIQFLASLK 77

Query: 500 XXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
               + +     + D  L++IME C    L  +L       +D  ++    +E+L  +K 
Sbjct: 78  QISNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKC 134

Query: 559 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 617
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 618 AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVK 677
              Y             KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLII--KSK 236

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE-SIMEDLI 735
            P  E  S       S  E +  CL  +P +R + D +L S F++    +  SI+++L+
Sbjct: 237 PPRLEGRSYS----PSLKEFIALCLDEDPKERLSADDLLRSKFIKAHRATPTSILKELV 291

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 138/293 (47%), Gaps = 43/293 (14%)

Query: 449 ELLGRGGSSRVYKVKGSGNK----VYALKRVSFDAFDDSSIDG---------FKGEIXXX 495
           E LG G + +V        K    V  + +  F+A ++S  +G          + EI   
Sbjct: 24  ETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIM 83

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQ 554
                   V++L D    +  LYL++E  +  +L  +L +RG +  +   VR + ++++ 
Sbjct: 84  KLLNHPN-VLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP-ENEAVRAF-RQIII 140

Query: 555 CIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAP 613
            I   H  G+VH DLKP N +L   + +KI DFG+A    E  +    ET  G+P+Y AP
Sbjct: 141 GISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKL---LETSCGSPHYAAP 197

Query: 614 EALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAI 671
           E +  + Y               G  SD+WSCG I++ ++ G+ P+    G  +N LL +
Sbjct: 198 EIISGLPYE--------------GFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 243

Query: 672 MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
              + ++P      +D++I K A +L+   L  +P KR T+ ++L    LQ +
Sbjct: 244 QKGEFEMP------DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/308 (26%), Positives = 146/308 (47%), Gaps = 36/308 (11%)

Query: 436 NMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXX 494
           ++I      Y +   LG GG +R +++K    K++A K V+      + +      EI  
Sbjct: 86  SLIKTRGRDYRREHFLGEGGFARCFQIKDESGKIFAAKTVAKISIKSEKTKRKLLSEI-Q 144

Query: 495 XXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                    ++Q +D    D  +Y+++E C +  L  +L +R   SL    VRF+  ++ 
Sbjct: 145 IHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQIC 202

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 612
             IK +H   I+H DLK  N    K   LK+ DFG+A  +       Y  T  GTPNY+A
Sbjct: 203 GAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKY--TVCGTPNYIA 260

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+     Q + + ++
Sbjct: 261 PEVLMG---------KHSGHSFEV----DIWSIGVMIYALLVGKPPF-----QAKDVNVI 302

Query: 673 NPDVKI---PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ---PFMI 726
              +K+    +P+    D+ + K A  L+   L  NP +R T+  +++  + +   P  I
Sbjct: 303 YERIKLCKYGYPK----DKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVWFRGVFPARI 358

Query: 727 SESIMEDL 734
           S  +M+ +
Sbjct: 359 SPDVMDTV 366

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 34/299 (11%)

Query: 443 SQYEKIELLGRGGSSRVYK---VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           S +++ E++GRG    VYK   VK    +VYA+K ++ D+ D   ++  + EI       
Sbjct: 21  SLFKRTEVVGRGKFGVVYKGYNVKT--RRVYAIKVLNLDS-DSDEVEDVQREIQFLASLK 77

Query: 500 XXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
               + +     + D  L+++ME C    L  +L       +D  ++    +E+L  +K 
Sbjct: 78  QMPNITRYYGSYLKDTSLWILMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKC 134

Query: 559 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 617
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGSVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 618 AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVK 677
              Y             KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLII--KSK 236

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE-SIMEDLI 735
            P  E  S       S  E +  CL  +P +R + D +L S F++    +  SI+++LI
Sbjct: 237 PPRLEGRSYSS----SLKEFIALCLDEDPKERLSADDLLRSKFIKTHRATPTSILKELI 291

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  103 bits (257), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 92/342 (26%), Positives = 159/342 (46%), Gaps = 34/342 (9%)

Query: 399 NVKNQEVFYHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSR 458
           N  N+   YH    +PP  KK E +    ++   +  ++I      Y +   LG GG +R
Sbjct: 53  NSNNKRTDYHHRHDQPPQKKKKEKL----SSLCKTPPSLIKTRGRDYHRGHFLGEGGFAR 108

Query: 459 VYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLL 517
            ++++    K++A K V+      + +      EI           ++Q +D    D  +
Sbjct: 109 CFQIRDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHV-NIVQFIDCFEDDTNV 167

Query: 518 YLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPAN-FV 575
           Y+++E C +  L  +L +R   SL    VRF+  ++   IK +H   ++H DLK  N F 
Sbjct: 168 YILLEICPNGSLMDLLKKRK--SLTEPEVRFFTTQICGAIKYMHSRKVIHRDLKLGNIFF 225

Query: 576 LVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWK 635
             K  LKI DFG+A  +       Y  T  GTPNY+APE L+          +H G+ ++
Sbjct: 226 DRKYNLKIGDFGLAATLANDRERKY--TVCGTPNYIAPEVLMG---------KHSGHSYE 274

Query: 636 VGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAI 695
           V    D+WS G ++Y +I G+PP+ S         I   D   P  +  S++ KI     
Sbjct: 275 V----DIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFPKDKLISSEAKI----- 325

Query: 696 ELMKACLYRNPDKRWTVDKVLNSTFLQ---PFMISESIMEDL 734
            L++  L  +P +R +V+++++  + +   P    ES+M ++
Sbjct: 326 -LIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKESVMVEV 366

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score = 99.0 bits (245), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 146/318 (45%), Gaps = 54/318 (16%)

Query: 441 NDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           + SQ++++E LG G  + VYK       +Y ALK V  D+ + +     + EI       
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGIYVALKEVKLDSEEGTPSTAVR-EISLMKELK 61

Query: 500 XXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNMSLDF--NFVRFYAKEMLQC 555
               +++L D    +  L L+ E  D+DL + ++ R  GN    F  + V+++  ++LQ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQG 120

Query: 556 IKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 612
           +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 VAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           P+ L+       +               D+WSCGCI+ +MI G+P +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGRPLFPGTNDEEQLKLIF 222

Query: 673 N----------PDVK-IP-----FPEHTSND----------EKIPKSAIELMKACLYRNP 706
                      P V  +P      P+H   D          EK+  + I+L+   L  NP
Sbjct: 223 ETMGTPTERTWPGVSTLPKYNPRLPQHLPKDLGALLQSQTREKMELTLIDLLYGLLQLNP 282

Query: 707 DKRWTVDKVLNSTFLQPF 724
           D+R +  + LN  +   +
Sbjct: 283 DRRLSAKQALNHPWFAEY 300

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 34/299 (11%)

Query: 443 SQYEKIELLGRGGSSRVYK---VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           S +++ E++GRG    VYK   VK    +V+A+K ++ D+ D   ++  + EI       
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKT--RRVFAIKVLNLDS-DSDEVEDVQREIQFLASLK 77

Query: 500 XXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
               + +     + D  L++IME C    L  +L       +D  ++    +E+L  +K 
Sbjct: 78  QIHNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMREVLVALKC 134

Query: 559 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 617
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 618 AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVK 677
              Y             KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCEVEALRAMQLII--KSK 236

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE-SIMEDLI 735
            P  E  S       S  E +  CL  +P +R + D +L S F++    +  SI+++LI
Sbjct: 237 PPRLEGRSYS----PSLKEFIALCLDEDPKERLSADDLLKSKFIKNHKTTPTSILKELI 291

>KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]
           {ON} similar to uniprot|P38070 Saccharomyces cerevisiae
           YBR028C Hypothetical ORF
          Length = 556

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 129/291 (44%), Gaps = 47/291 (16%)

Query: 448 IELLGRGGSSRVYKVKGS-GNKVYA---LKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           I  LG G   +V  VK S  +K+YA   LK+      +DS        +          R
Sbjct: 173 IRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIERTFAER 232

Query: 504 VI--QL-------LDYEMGDGL-LYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEM 552
            I  QL       L Y   D   LYL+++     +L   L ++G  +LD   V FYA E+
Sbjct: 233 TILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQG--TLDEGTVAFYAAEL 290

Query: 553 LQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN-------AVPEHTVNIYR-ET 603
              +K +H  GIV+ DLKP N +L  +G L + DFG++        A PE   N+ +  +
Sbjct: 291 SCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVNQLYS 350

Query: 604 QIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQ 663
            IGTP Y APE L    YTQN                D +S GC+VY M+ GKPP+    
Sbjct: 351 IIGTPEYCAPEILAGEPYTQN---------------CDWYSLGCLVYDMLIGKPPFTGVN 395

Query: 664 GQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDK 714
            +  L  I         P + S+  K      + + A L ++P KRW VDK
Sbjct: 396 HKIILNKIKQEKTGARIPSYLSDGFK------DYLGALLRKDPTKRWDVDK 440

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 89/336 (26%), Positives = 153/336 (45%), Gaps = 38/336 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRV 475
            T+ VE+ +    A + S  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1118 TRVVEVTDKKTVAINKSKNSNGEYKEFAWIKGEIIGKGSFGSVYLGLNVTTGEMMAVKQV 1177

Query: 476  ------SFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                  S D    S ++  K E+           ++Q L +E  + +  L +E      +
Sbjct: 1178 EVPRYGSQDETTLSVLEALKSEVSTLKDLDHVN-IVQYLGFENKNHVYSLFLEYVAGGSV 1236

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFG 587
              ++   G    D + +RF A ++L+ +  +H  GI+H D+K  N +L V GI KI DFG
Sbjct: 1237 GSLIRLFGR--FDEDLIRFLAVQVLRGLAYLHSKGILHRDMKADNLLLDVDGICKISDFG 1294

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+    + + NIY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1295 IS----KKSNNIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1336

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M  GK P+ +F+    +  I       P PE T   + +   A   + AC   
Sbjct: 1337 LGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDT--QKLLSAEAKSFLDACFEI 1394

Query: 705  NPDKRWTVDKVLNSTFL---QPFMISESIMEDLIRN 737
            +P+KR T D +L+  F      F+  E+ +   IR+
Sbjct: 1395 DPEKRPTADDLLSHPFCGVRSRFVFQETSLARFIRS 1430

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 137/296 (46%), Gaps = 30/296 (10%)

Query: 444 QYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           ++ +  ++GRG    VYK      K VYA+K ++ D+ D+  ++  + EI          
Sbjct: 34  KFRRTNVIGRGKFGVVYKGYHLNTKHVYAIKVLNLDS-DEDEVEDVQKEIQFLASLKQLP 92

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            + +     + +  L++IME CG   L  +L       +D  ++    +E+L  +K +H 
Sbjct: 93  NITRYYGSYLKNTSLWIIMEYCGGGSLRSLLRPG---KIDEKYIGVIMREILIALKYIHK 149

Query: 562 AGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
             ++H D+K AN ++   G +K+ DFG+A  +  +     R+T  GTP +MAPE ++   
Sbjct: 150 DNVIHRDIKAANVLINNDGSIKLCDFGVAAQL--NQTKSRRQTMAGTPYWMAPEVIMEGV 207

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
           Y                  +D+WS G   Y++  G PPY   +    +  I     K P 
Sbjct: 208 YYDTK--------------ADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAK--SKPPR 251

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFM-ISESIMEDLI 735
            E  +    I     E +  CL  +P +R T D++L + F++ +  +  SI+++LI
Sbjct: 252 LEGRNYSALIK----EFIATCLDEDPSERPTADELLKTAFIKTYKPLPTSILKELI 303

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 143/312 (45%), Gaps = 28/312 (8%)

Query: 436 NMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXX 494
           ++I      Y +   LG GG +R ++      K++A K V+      + +      EI  
Sbjct: 74  SLIKTRGRDYHRGHFLGEGGFARCFQFNDDSGKIFAAKTVAKLSIKSEKTRRKLLSEIQI 133

Query: 495 XXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                    ++Q +D    D  +Y+++E C +  L  +L +R   SL    VRF+  ++ 
Sbjct: 134 HKSMKNV-NIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRK--SLTEPEVRFFTTQIC 190

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 612
             IK +H   ++H DLK  N    K   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 191 GAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIA 248

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ S         I 
Sbjct: 249 PEVLMG---------KHTGHSYEV----DIWSIGVMLYALLIGKPPFQSKDVNTIYERIK 295

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIME 732
             D   P  ++ S + KI      L++  L  +P +R +VD++++  + +  +    I  
Sbjct: 296 CCDFTFPKDKYISPEAKI------LIQDLLSLDPLERPSVDEIIDYVWFRG-LFPPQIES 348

Query: 733 DLIRNAVRYGSE 744
           D++ N   Y ++
Sbjct: 349 DVMTNIPNYDNQ 360

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/312 (27%), Positives = 145/312 (46%), Gaps = 56/312 (17%)

Query: 440 VNDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXX 498
           ++ SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI      
Sbjct: 1   MSSSQFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 59

Query: 499 XXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNM--SLDFNFVRFYAKEMLQ 554
                +++L D    +  L L+ E  D+DL + ++ R  GN    L+ N V+++  ++L+
Sbjct: 60  KHD-NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLE 118

Query: 555 CIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 611
            +   H+  I+H DLKP N ++ K G LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 119 GLAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 174

Query: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
           AP+ L+       +               D+WSCGCI+ +MI GKP +     + +L  I
Sbjct: 175 APDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNDEEQLKLI 220

Query: 672 MN----------PDVKIPFPEHTSN-DEKIPK----------------SAIELMKACLYR 704
            +          P V    P++  N  +++PK                + I+L+   L  
Sbjct: 221 FDKMGTPNETTWPGVT-SLPKYNPNFQQRLPKDLKAELQPYVKEPLDDNVIDLLHGLLQL 279

Query: 705 NPDKRWTVDKVL 716
           NPD R +  + L
Sbjct: 280 NPDMRLSAKQAL 291

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 144/317 (45%), Gaps = 43/317 (13%)

Query: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGG-SSRVYKVKGSGNKVYALKRVSFDA 479
           ++V+PA   T    ++++ +    ++  E LG G  SS V        K YA+K +S + 
Sbjct: 104 DVVDPA---TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEY 160

Query: 480 F-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGN 537
                 +     E            + +L      +  LY ++E   H D   ++ + G 
Sbjct: 161 LIRQKKVKYVTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYG- 219

Query: 538 MSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT 596
            SL+    R+YA +++  +  +H+ GI+H D+KP N +L K + +K+ DFG A  +PE  
Sbjct: 220 -SLNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEP 278

Query: 597 VN---------IYRETQ--IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSC 645
            N         +Y +++  +GT  Y++PE L        NDN  D          D+W+ 
Sbjct: 279 SNTADGKPYFDLYAKSKSFVGTAEYVSPELL--------NDNYTDSR-------CDIWAF 323

Query: 646 GCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRN 705
           GCI+YQM+ GKPP   F+  N  L      +KI +    +     P+   +L+K  L R+
Sbjct: 324 GCILYQMLAGKPP---FKAANEYLTFQKV-MKIQY----AFTAGFPQIVKDLVKKLLVRD 375

Query: 706 PDKRWTVDKVLNSTFLQ 722
           P+ R T+ ++    F  
Sbjct: 376 PNDRLTIKQIKAHLFFH 392

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 156/344 (45%), Gaps = 38/344 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRV 475
            T+ VE+ +    A + S  +     +  + K E++G+G    V+  +  +  ++ A+K+V
Sbjct: 1118 TRVVEVTDKKMVAINKSKNSNGEYKEFAWIKGEMIGKGSFGSVFLGLNVTTGEMIAVKQV 1177

Query: 476  ------SFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                  S D    S ++  + E+           ++Q L +E  + +  L +E      +
Sbjct: 1178 EVPRYGSQDETTLSVLEALRSEVATLKDLDHTN-IVQYLGFENKNYVYSLFLEYVAGGSV 1236

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFG 587
              ++   G    D N +RF A ++L+ +  +H   I+H D+K  N +L V GI KI DFG
Sbjct: 1237 GSLIRLYGK--FDENLIRFLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFG 1294

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+    + + NIY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1295 IS----KKSNNIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1336

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M  GK P+ + +    +  I       P PE T   + I     E + AC   
Sbjct: 1337 LGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDT--QKIISAEGKEFLDACFEI 1394

Query: 705  NPDKRWTVDKVLNSTFL---QPFMISESIMEDLIRNAVRYGSEK 745
            NP+KR T D++L+  F    + F+  E+ +   IR+  +  S K
Sbjct: 1395 NPEKRPTADELLSHPFCIVDKEFVFKETSLAKFIRSNDKGNSSK 1438

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 148/320 (46%), Gaps = 56/320 (17%)

Query: 440 VNDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXX 498
           V  SQ++++E +G G  + VYK       VY ALK V  D+ + +     + EI      
Sbjct: 2   VAPSQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 60

Query: 499 XXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GN--MSLDFNFVRFYAKEMLQ 554
                +++L D    +  L L+ E  D+DL + ++ R  GN    L+ + V+++  ++LQ
Sbjct: 61  KHD-NIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQ 119

Query: 555 CIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 611
            +   H+  I+H DLKP N ++  +G LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 120 GVAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 175

Query: 612 APEALV-AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLA 670
           AP+ L+ + NY  +                D+WSCGCI+ +MI GKP +     + +L  
Sbjct: 176 APDVLMGSRNYCTS---------------IDIWSCGCILAEMIMGKPLFPGSNDEEQLKL 220

Query: 671 I---MNPDVKIPFPEHT-----------------------SNDEKIPKSAIELMKACLYR 704
           I   M   V+  +P+ T                       + +E +  + ++L+   L  
Sbjct: 221 IFDTMGTPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQL 280

Query: 705 NPDKRWTVDKVLNSTFLQPF 724
           NPD R +    LN  +   +
Sbjct: 281 NPDARLSAKDALNHPWFAEY 300

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 142/316 (44%), Gaps = 54/316 (17%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI         
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHD 63

Query: 502 XRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GN--MSLDFNFVRFYAKEMLQCIK 557
             V++L D    +  L L+ E  D+DL + ++ R  GN    L+ N V+++  ++++   
Sbjct: 64  -NVVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELNLVKYFQWQLMEGAA 122

Query: 558 VVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 614
             H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 615 ALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMN- 673
            L+       +               DMWSCGCI+ +M+ GKP +     + +L  I + 
Sbjct: 179 VLMGSRTYSTS--------------IDMWSCGCILAEMVTGKPLFPGTNDEEQLKLIFDI 224

Query: 674 ---------------PDVKIPFPEHTSND----------EKIPKSAIELMKACLYRNPDK 708
                          P   + FP+    D          E +  + I+L+   L  NPD 
Sbjct: 225 MGTPNESTWPGVSSLPKFNLNFPQKLPRDLRSILQVCSKEPLDDNLIDLLHGLLQLNPDM 284

Query: 709 RWTVDKVLNSTFLQPF 724
           R +  + L+  +   +
Sbjct: 285 RLSAKQALHHPWFAEY 300

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 142/298 (47%), Gaps = 30/298 (10%)

Query: 442 DSQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXX 500
           ++ + + E++G+G    VYK      K VYA+K ++ D+ D+  ++  + EI        
Sbjct: 38  NAAFRRTEVIGKGKFGVVYKGYNLRTKHVYAIKVLNLDS-DEDEVEDVQREIQFLASLKQ 96

Query: 501 XXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
              V +     + +  L++IME C    L  +L       +D  ++    +E+L  +K +
Sbjct: 97  LPNVTRYYGSYLKNTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKFI 153

Query: 560 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
           H   I+H D+K AN ++  +G +K+ DFG+A  + + T  + R+T  GTP +MAPE ++ 
Sbjct: 154 HKDNIIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRT--LRRQTMAGTPYWMAPEVIME 211

Query: 619 MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
             Y             KV    D+WS G   Y++  G PPY   +    +  I     K 
Sbjct: 212 GVYYDT----------KV----DIWSLGITAYEISTGNPPYCDVEALRAMQLIT--KSKP 255

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESI-MEDLI 735
           P  E  +    I     E +  CL  +P++R + D++L S F++    + +I +++LI
Sbjct: 256 PRLEGRNYTPLIK----EFIALCLDEDPNERLSADELLKSKFIKAHKTTPTIVLKELI 309

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 145/299 (48%), Gaps = 34/299 (11%)

Query: 443 SQYEKIELLGRGGSSRVYK---VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           S +++ E++GRG    VYK   VK    +VYA+K ++ D+ +D  ++  + EI       
Sbjct: 14  STFKRTEVIGRGKFGIVYKGYHVKT--KQVYAIKVLNLDSSEDE-VEDVQREIQFLASLK 70

Query: 500 XXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
               + +     +    L++IME C    L  +L       +D  ++    +E+L  +KV
Sbjct: 71  QIPNITRYYGSYLRGTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKV 127

Query: 559 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 617
           +H   ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++
Sbjct: 128 IHKDNVIHRDIKAANVLITNEGQVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIM 185

Query: 618 AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVK 677
              Y             KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 186 EGVYYDT----------KV----DIWSLGITAYEIATGNPPYCDVEALRAMQLII--KSK 229

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMIS-ESIMEDLI 735
            P  E  +   ++     E +  CL  +P +R + +++L + F++    +  +I+++LI
Sbjct: 230 PPRLEERNYTPQLK----EFIALCLDEDPQERLSAEELLKTKFIKTHKATPTTILKELI 284

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 90/358 (25%), Positives = 163/358 (45%), Gaps = 36/358 (10%)

Query: 407 YHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSG 466
           +H+PA K    KK E +    +A   +  ++I      Y +   LG GG +R +++K   
Sbjct: 52  HHQPAQK----KKREKL----SALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDS 103

Query: 467 NKVYALKRVSFDAF-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CG 524
             ++A K V+  +   + +      EI           ++Q +D    D  +Y+++E C 
Sbjct: 104 GDIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMAHPN-IVQFIDCFEDDSNVYILLEICP 162

Query: 525 DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKI 583
           +  L ++L +R  +S     VRF+  ++   IK +H   ++H DLK  N        LKI
Sbjct: 163 NGSLMELLKRRKVLSEPE--VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKI 220

Query: 584 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMW 643
            DFG+A  +   +   Y  T  GTPNY+APE L+          +H G+ ++V    D+W
Sbjct: 221 GDFGLAAVLANESERKY--TICGTPNYIAPEVLMG---------KHSGHSFEV----DIW 265

Query: 644 SCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLY 703
           S G ++Y ++ GKPP+ +         I   D   P  +  S++ KI      L++  L 
Sbjct: 266 SLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPKDKPISDEGKI------LIRDILS 319

Query: 704 RNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVL 761
            +P +R ++ ++++  + +      SI   ++     +G+   + S  N  D +E  L
Sbjct: 320 LDPIERPSLTEIMDYVWFRG-TFPPSIPSTVMSEVPNFGNIPEEQSLVNFKDCMEKSL 376

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 147/312 (47%), Gaps = 31/312 (9%)

Query: 428 TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSID 486
           +A   +  ++I      Y +   LG GG +R +++K    K++A K V+      + +  
Sbjct: 84  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKTEKTRK 143

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
               EI           ++Q +D    +  +Y+++E C +  L ++L +R  ++     V
Sbjct: 144 KLLSEI-QIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEP--EV 200

Query: 546 RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 604
           RF+  ++   IK +H   ++H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 201 RFFTTQICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKY--TV 258

Query: 605 IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            GTPNY+APE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ +   
Sbjct: 259 CGTPNYIAPEVLMG---------KHSGHSYEV----DIWSIGVMIYALLIGKPPFQAKDV 305

Query: 665 QNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ-- 722
                 I   D   P  ++ S++ +I      L++  L  +P +R ++ +VL+  + +  
Sbjct: 306 NTIYERIKCCDFVFPKEKYISSEARI------LVQDLLSLDPLERPSIMEVLDYVWFRGI 359

Query: 723 --PFMISESIME 732
             P++ S+ + E
Sbjct: 360 FPPYIQSDVMTE 371

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 141/298 (47%), Gaps = 30/298 (10%)

Query: 442 DSQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXX 500
           +S + + E++GRG    VYK      K +YA+K ++ D+ D+  ++  + EI        
Sbjct: 39  NSVFRRTEVIGRGKFGIVYKGYHVKTKQIYAIKVLNLDS-DEDEVEDVQREIQFLASLKQ 97

Query: 501 XXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
              + +     + D  L++IME C    L  +L       +D  ++    +E+L  +K +
Sbjct: 98  LPNITRYYGSYLKDTSLWIIMEYCAGGSLRTLLRPG---KIDEKYIGVITREILIALKYI 154

Query: 560 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
           H   I+H D+K AN ++  +G +K+ DFG+A  + + T    R+T  GTP +MAPE ++ 
Sbjct: 155 HKDNIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKR--RQTMAGTPYWMAPEVIME 212

Query: 619 MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
             Y             KV    D+WS G   Y++  G PPY   +    +  I     K 
Sbjct: 213 GVYYDT----------KV----DIWSLGITTYEIATGNPPYCEIEALRAMQLIT--KSKP 256

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE-SIMEDLI 735
           P  E   N   + K   E +  CL  +P +R + + +L + F++   ++  SI+++LI
Sbjct: 257 PRLEG-RNYSPLLK---EFVALCLDEDPKERMSAEDLLKTKFIKAHKLTPVSILKELI 310

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 135/298 (45%), Gaps = 27/298 (9%)

Query: 428 TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSID 486
           +A   +  ++I      Y +   LG GG +R +++K    KV+A K V+      + +  
Sbjct: 56  SALCKTPPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKVFAAKTVAKISIKSEKTRK 115

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
               EI           ++Q  D    D  +Y+++E C +  L  +L QR  ++     V
Sbjct: 116 KLLSEIQIHKSMKHP-NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE--V 172

Query: 546 RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 604
           RF+  +++  IK +H   I+H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 173 RFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TI 230

Query: 605 IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            GTPNY+APE L           +H G+ ++V    D+WS G ++Y ++ GKPP+ + + 
Sbjct: 231 CGTPNYIAPEVLTG---------KHTGHSFEV----DIWSIGVMIYALLIGKPPFQAKEV 277

Query: 665 QNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                 I   D   P       D+ I   A  L+K  L  +P +R ++ +++   + +
Sbjct: 278 NTIYERIKVCDFSFP------KDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFR 329

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 138/295 (46%), Gaps = 44/295 (14%)

Query: 449 ELLGRGGSSRVYKVK-GSGNKVYALKRVSFDAFDDSSIDG--FKGEIXXXXXXXXXXR-- 503
           E LG G + +V   + GS  +  A+K +S   F+  ++ G    G            R  
Sbjct: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82

Query: 504 ----------VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEM 552
                     V++L D    +  LYL++E  +  +L  +L +RG +  +   +RF+ +++
Sbjct: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-EHEAIRFF-RQI 140

Query: 553 LQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 611
           +  +   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET  G+P+Y 
Sbjct: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSCGSPHYA 197

Query: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR--LL 669
           APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G  R  LL
Sbjct: 198 APEIVSGIPYQ--------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLL 243

Query: 670 AIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
            +   + ++P      +D++I + A +L++  L  +P++R     +L    LQ +
Sbjct: 244 KVQKGEFEMP------SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 83/318 (26%), Positives = 142/318 (44%), Gaps = 54/318 (16%)

Query: 441 NDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           + SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI       
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 500 XXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GN--MSLDFNFVRFYAKEMLQC 555
               +++L D    +  L L+ E  D+DL + ++ R  GN    L    V+++  ++LQ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRAVGNTPQGLALPLVKYFEWQLLQG 120

Query: 556 IKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 612
           +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 VAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           P+ L+       +               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILVEMITGKPLFPGTSDEEQLKLIF 222

Query: 673 --------------------NPDVKIPFPE------HTSNDEKIPKSAIELMKACLYRNP 706
                               NP+  I  P+       +   E +  + ++L+   L  NP
Sbjct: 223 ETMGTPTERTWPGISSLPKYNPNFPIHLPKDLRAFLQSQTRESLDNNVVDLLHGLLQLNP 282

Query: 707 DKRWTVDKVLNSTFLQPF 724
           + R +  + LN  +   +
Sbjct: 283 EMRLSAKQALNHPWFAEY 300

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 157/334 (47%), Gaps = 38/334 (11%)

Query: 407 YHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSG 466
           +H+PA K    KK E +    +A   +  ++I      Y +   LG GG +R +++K   
Sbjct: 52  HHQPAQK----KKREKL----SALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDS 103

Query: 467 NKVYALKRVSFDAF-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CG 524
            +++A K V+  +   + +      EI           ++Q +D    D  +Y+++E C 
Sbjct: 104 GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPN-IVQFIDCFEDDSNVYILLEICP 162

Query: 525 DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKI 583
           +  L ++L +R  ++     VRF+  ++   IK +H   ++H DLK  N        LKI
Sbjct: 163 NGSLMELLKRRKVLTEPE--VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKI 220

Query: 584 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMW 643
            DFG+A  +   +   Y  T  GTPNY+APE L+          +H G+ ++V    D+W
Sbjct: 221 GDFGLAAVLANESERKY--TICGTPNYIAPEVLMG---------KHSGHSFEV----DIW 265

Query: 644 SCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLY 703
           S G ++Y ++ GKPP+ +         I   D   P  +  S++ KI      L++  L 
Sbjct: 266 SLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPKDKPISDEGKI------LIRDILS 319

Query: 704 RNPDKRWTVDKVLNSTFLQ---PFMISESIMEDL 734
            +P +R ++ ++++  + +   P  I  ++M ++
Sbjct: 320 LDPIERPSLTEIMDYVWFRGTFPPSIPATVMSEV 353

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 151/346 (43%), Gaps = 61/346 (17%)

Query: 422 IVEPARTATSSSNRNMITVNDSQYEKIELLGRGG-SSRVYKVKGSGNKVYALKRVSFDAF 480
           +V+PA   T    ++++ +    ++  E LG G  SS V        K YA+K +S +  
Sbjct: 105 VVDPA---TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYL 161

Query: 481 -DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNM 538
                +     E            +I+L      +  LY ++E   H D   ++ + G  
Sbjct: 162 IRQKKVKYVTVEKLALQKLNGTKGIIRLFFTFQDEASLYFLLEYASHGDFLGLIKKYG-- 219

Query: 539 SLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTV 597
           SL+    R+YA +++  +  +H  GI+H D+KP N +L K + +K+ DFG A  +PE   
Sbjct: 220 SLNEKCARYYASQIIDAVDSLHAIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPS 279

Query: 598 N---------IYRETQ--IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCG 646
           N         +Y  ++  +GT  Y++PE L        ND+  D          D+W+ G
Sbjct: 280 NNADGKPCFDLYARSKSFVGTAEYVSPELL--------NDSYTDSR-------CDIWAFG 324

Query: 647 CIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNP 706
           CI+YQM+ GKPP   F+  N  L      +KI +    +     P  A +L+K  L R P
Sbjct: 325 CILYQMVAGKPP---FKAANEYLTFQKV-MKIQY----AFTAGFPLIAKDLVKKLLVREP 376

Query: 707 DKRWTVDKVLNSTF------------------LQPFMISESIMEDL 734
           + R TV+++    F                  +QP+ +S   M+ L
Sbjct: 377 NDRLTVEQIKAHVFFHGVHFEDGSVWDDDAPEIQPYKVSAEAMKPL 422

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 141/316 (44%), Gaps = 35/316 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ E    + + S  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1226 TRMVEVTEKQMVSINKSKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQV 1285

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +        S++D  K E+           ++Q L +E  D +  L +E      +
Sbjct: 1286 EVPKYSSQDEAIMSTVDAIKSEVSTLKDLDHL-NIVQYLGFENKDNIYSLFLEYVAGGSV 1344

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D   +R    ++L+ +  +H  GI+H D+K  N +L + G+ KI DFG
Sbjct: 1345 GSLIRIYGR--FDEPLIRHLNIQVLRGLAYLHARGILHRDMKADNLLLDQDGVCKISDFG 1402

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1403 IS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1444

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GCIV +M  GK P+ +F+    +  I       P PE T     I     E + AC   
Sbjct: 1445 LGCIVLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPEDTL--PLISAEGREFLDACFEI 1502

Query: 705  NPDKRWTVDKVLNSTF 720
            +PDKR T D++L  TF
Sbjct: 1503 DPDKRPTADELLYHTF 1518

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  100 bits (248), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 156/333 (46%), Gaps = 38/333 (11%)

Query: 407 YHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSG 466
           +H+PA K    KK E +    +A   +  ++I      Y +   LG GG +R +++K   
Sbjct: 52  HHQPAQK----KKREKL----SALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDS 103

Query: 467 NKVYALKRVSFDAF-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CG 524
            +++A K V+  +   + +      EI           ++Q +D    D  +Y+++E C 
Sbjct: 104 GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPN-IVQFIDCFEDDSNVYILLEICP 162

Query: 525 DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKI 583
           +  L ++L +R  ++     VRF+  ++   IK +H   ++H DLK  N        LKI
Sbjct: 163 NGSLMELLKRRKVLTEPE--VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKI 220

Query: 584 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMW 643
            DFG+A  +   +   Y  T  GTPNY+APE L+          +H G+ ++V    D+W
Sbjct: 221 GDFGLAAVLANESERKY--TICGTPNYIAPEVLMG---------KHSGHSFEV----DIW 265

Query: 644 SCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLY 703
           S G ++Y ++ GKPP+ +         I   D   P  +  S++ KI      L++  L 
Sbjct: 266 SLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKI------LIRDILS 319

Query: 704 RNPDKRWTVDKVLNSTFLQ---PFMISESIMED 733
            +P +R ++ ++++  + +   P  I  ++M +
Sbjct: 320 LDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSE 352

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 156/333 (46%), Gaps = 38/333 (11%)

Query: 407 YHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSG 466
           +H+PA K    KK E +    +A   +  ++I      Y +   LG GG +R +++K   
Sbjct: 52  HHQPAQK----KKREKL----SALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDS 103

Query: 467 NKVYALKRVSFDAF-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CG 524
            +++A K V+  +   + +      EI           ++Q +D    D  +Y+++E C 
Sbjct: 104 GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMAHPN-IVQFVDCFEDDSNVYILLEICP 162

Query: 525 DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKI 583
           +  L ++L +R  ++     VRF+  ++   IK +H   ++H DLK  N        LKI
Sbjct: 163 NGSLMELLKRRKVLTEPE--VRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKI 220

Query: 584 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMW 643
            DFG+A  +   +   Y  T  GTPNY+APE L+          +H G+ ++V    D+W
Sbjct: 221 GDFGLAAVLANESERKY--TICGTPNYIAPEVLMG---------KHSGHSFEV----DIW 265

Query: 644 SCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLY 703
           S G ++Y ++ GKPP+ +         I   D   P  +  S++ KI      L++  L 
Sbjct: 266 SLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPKDKPISDEGKI------LIRDILS 319

Query: 704 RNPDKRWTVDKVLNSTFLQ---PFMISESIMED 733
            +P +R ++ ++++  + +   P  I  ++M +
Sbjct: 320 LDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSE 352

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 95.9 bits (237), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 143/318 (44%), Gaps = 58/318 (18%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI         
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 502 XRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GN--MSLDFNFVRFYAKEMLQCIK 557
             +++L D    +  L L+ E  D+DL + ++ R  GN    L+ + V+++  ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELSLVKYFHWQLLEGVS 122

Query: 558 VVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 614
             H++ I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 615 ALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM-- 672
            L+       +               DMWSCGCI+ +MI GKP +     + +L  I   
Sbjct: 179 VLMGSRTYSTS--------------IDMWSCGCILAEMITGKPLFPGTNDEEQLKLIFEI 224

Query: 673 ------------------NP--------DVKIPFPEHTSNDEKIPKSAIELMKACLYRNP 706
                             NP        D++     HT   E +  + I L+   L  NP
Sbjct: 225 MGTPNESTWSGVSSLPKYNPNFSQKLPRDLRTILQPHTK--EPLDDNLINLLHGLLQLNP 282

Query: 707 DKRWTVDKVLNSTFLQPF 724
           D R +  + L+  +   +
Sbjct: 283 DMRLSAKQALHHPWFAEY 300

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 141/298 (47%), Gaps = 30/298 (10%)

Query: 442 DSQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXX 500
           +S + + E++GRG    VYK      K +YA+K ++ D+ D+  ++  + E+        
Sbjct: 34  NSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDS-DEDEVEDVQREVQFLSSLKQ 92

Query: 501 XXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
              + +     + D  L++IME C    L  +L       +D  ++    +E+L  +K +
Sbjct: 93  IPNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKYI 149

Query: 560 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
           H   ++H D+K AN ++  +G +K+ DFG+A  + + T  + R+T  GTP +MAPE ++ 
Sbjct: 150 HKDNVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQST--LRRQTMAGTPYWMAPEVIME 207

Query: 619 MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
             Y             KV    D+WS G   Y++  G PPY   +    +  I     K 
Sbjct: 208 GVYYDT----------KV----DIWSLGITAYEIATGNPPYCEVEALRAMQLIT--KSKP 251

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE-SIMEDLI 735
           P  E  S    +     E +  CL  +P +R + +++  + F++   ++  SI+++LI
Sbjct: 252 PRLESRSYTPLLK----EFIALCLDEDPKERLSAEELSKTKFIKAHKLTPVSILKELI 305

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 95.9 bits (237), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 118/234 (50%), Gaps = 31/234 (13%)

Query: 441 NDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           + SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI       
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 500 XXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNM--SLDFNFVRFYAKEMLQC 555
               +++L D    +  L L+ E  D+DL + ++ R  GN    L+ N V+++  ++LQ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQG 120

Query: 556 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 612
           +   H++ I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHESKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQN 666
           P+ L+       +               D+WSCGCI+ +MI GKP    F G N
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKP---LFPGTN 213

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 99.4 bits (246), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 135/298 (45%), Gaps = 27/298 (9%)

Query: 428 TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSID 486
           +A   +  ++I      Y +   LG GG +R +++K    K++A K V+      + +  
Sbjct: 56  SALCKTPPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKIFAAKTVAKISIKSEKTRK 115

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
               EI           ++Q  D    D  +Y+++E C +  L  +L QR  ++     V
Sbjct: 116 KLLSEIQIHKSMRHP-NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE--V 172

Query: 546 RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 604
           RF+  +++  IK +H   I+H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 173 RFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TI 230

Query: 605 IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            GTPNY+APE L           +H G+ ++V    D+WS G ++Y ++ GKPP+ + + 
Sbjct: 231 CGTPNYIAPEVLTG---------KHTGHSFEV----DVWSIGVMIYALLIGKPPFQAKEV 277

Query: 665 QNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                 I   D   P       D+ I   A  L+K  L  +P +R ++ +++   + +
Sbjct: 278 NTIYERIKVCDFNFP------RDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVWFR 329

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 84/288 (29%), Positives = 138/288 (47%), Gaps = 35/288 (12%)

Query: 440 VNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXX 498
           V  +QY  I ++G+G    VYK V    N+V A+K+V++D  +D  ++    EI      
Sbjct: 74  VTKAQYGLINVIGKGSFGVVYKAVNRQTNQVIAIKQVNYD--NDEELNDIMSEINLLKNL 131

Query: 499 XXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQ-RGNMSLDFNFVRFYAKEMLQCI 556
                +++   +      LY+++E C    L  +++  +G    D    + Y  + L  +
Sbjct: 132 NHK-HIVKYHGFMQKSDTLYILLEYCAHGSLKNLISSSKGIPEKD---AQQYIIQTLYGL 187

Query: 557 KVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEA 615
             +H  G++H D+K AN +L K   +K+ DFG++  V   T+ +   T  G+ N+MAPE 
Sbjct: 188 VYLHAQGVIHRDIKAANILLDKDNTVKLADFGVSTRVGNATMAM---TLAGSLNWMAPEI 244

Query: 616 LVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPD 675
           L              GNK      SD+WS G  V ++I G PP+ +    N   AI N D
Sbjct: 245 L--------------GNK-GASTLSDIWSLGATVVELITGNPPFHNLVDINIYYAIEN-D 288

Query: 676 VKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQP 723
             IP PE   ++     +AI+ +  C  +N  +R T  ++LN  +LQP
Sbjct: 289 NYIP-PEGAFSE-----TAIDFLNLCFKKNMYRRPTAQQLLNHKWLQP 330

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 159/352 (45%), Gaps = 38/352 (10%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRV 475
            TK VEI +    + + S  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1010 TKVVEITDKRTISINKSRNSRGEYKEFAWIKGEIIGKGSFGAVYLALNVTTGEMLAVKQV 1069

Query: 476  S---FDAFDDSSI---DGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
            +   F + D+S+I   +  K E+           ++Q L +E  +G+  L +E      +
Sbjct: 1070 TVPEFSSQDESAISMVEALKSEVSTLKDLNHV-NIVQYLGFEEKNGIYSLFLEYVAGGSV 1128

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D   +R   K++L+ +  +H  GI+H D+K  N +L   G+ KI DFG
Sbjct: 1129 GSLIRMYGR--FDDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDGVCKISDFG 1186

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + NIY  + +   GT  +MAPE +         D  H G   KV    D+WS
Sbjct: 1187 IS----RKSNNIYSNSDMTMRGTVFWMAPEMV---------DTAH-GYSAKV----DIWS 1228

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M  GK P+ +F+    +  I       P P+ T   + +  +    +  C   
Sbjct: 1229 LGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPIPDDT--KDLVSPAGQSFLDQCFEI 1286

Query: 705  NPDKRWTVDKVLNSTFLQ---PFMISESIMEDLIRNAVRYGSEKPQISHDNL 753
            +P+ R T D ++   F +    F   ++ +   I++  +  S + +IS   L
Sbjct: 1287 DPEMRPTADSLVGHPFCKTSSSFDFPKTKLAQFIKSNDKLNSSRLRISSQEL 1338

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 136/292 (46%), Gaps = 35/292 (11%)

Query: 441  NDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRVSFDAFD------DSSIDGFKGEIX 493
            N+  + K E++G+G    V+  +  +  ++ A+K+V    +        +++D  + E+ 
Sbjct: 1136 NEFAWMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVS 1195

Query: 494  XXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEM 552
                      ++Q L +E  +G+  L +E      +  ++   G    D   +R    ++
Sbjct: 1196 TLKDLDHL-NIVQYLGFEAKNGIYSLFLEYVAGGSVGSLIRMYGR--FDDILIRHLTIQV 1252

Query: 553  LQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTP 608
            LQ +  +H  GI+H D+K  N +L + G+ KI DFGI+      + +IY  +++   GT 
Sbjct: 1253 LQGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSNDIYSNSEMTMKGTV 1308

Query: 609  NYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL 668
             +MAPE +          +   G   KV    D+WS GCIV +M  GK P+ +F+    +
Sbjct: 1309 FWMAPEMV----------DTKQGYSAKV----DIWSLGCIVLEMFAGKRPWSNFEVVAAM 1354

Query: 669  LAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720
              I       P PE T     I ++A E +  C   +P+KR T DK+L+  F
Sbjct: 1355 FKIGQAKSAPPIPEDTL--PLISENAKEFLDCCFEIDPEKRPTADKLLSHPF 1404

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 144/320 (45%), Gaps = 58/320 (18%)

Query: 441 NDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           + SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI       
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 500 XXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNM--SLDFNFVRFYAKEMLQC 555
               +++L D    +  L L+ E  D+DL + ++ R  GN    L+ N V+++  ++LQ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQG 120

Query: 556 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 612
           +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           P+ L+       +               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNDEEQLKLIF 222

Query: 673 --------------------NPDVKIPFPE--------HTSNDEKIPKSAIELMKACLYR 704
                               NP+V+   P         HT   E +  + ++ +   L  
Sbjct: 223 DIMGTPSESLWPAVTKLPKYNPNVQHRTPRDLRQVLQPHTK--EPLDGNLMDFLHGLLQL 280

Query: 705 NPDKRWTVDKVLNSTFLQPF 724
           NPD R +  + L+  +   +
Sbjct: 281 NPDMRLSAKQALHHPWFAEY 300

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/260 (30%), Positives = 129/260 (49%), Gaps = 34/260 (13%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    D  LY+++E  +  +L  +L +RG +  +   +RF+ ++++  I   H  
Sbjct: 93  VLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGISYCHAL 150

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A      T +   ET  G+P+Y APE +  + Y
Sbjct: 151 GIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIISGLPY 207

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  +D+WSCG I++ ++ G+ P+    G  +N LL + +   ++P
Sbjct: 208 H--------------GLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF-MISESIMEDLIRNA 738
                 NDE I + A +L+   L  +P KR    ++L    +Q +  I +S     IRN 
Sbjct: 254 -----GNDE-ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDS---KTIRNL 304

Query: 739 VRYGSEKPQISHDNLNDVVE 758
            R  +    +S DN  DV E
Sbjct: 305 PREDTYLNPLSDDN-GDVCE 323

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 149/323 (46%), Gaps = 58/323 (17%)

Query: 438 ITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXX 496
           ++ + SQ++++E LG G  + VYK       ++ ALK V  D+ + +     + EI    
Sbjct: 1   MSSSSSQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSEEGTPSTAIR-EISLMK 59

Query: 497 XXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNMS--LDFNFVRFYAKEM 552
                  +++L D    +  L L+ E  D DL   ++ R  GN +  L+ + V+++  ++
Sbjct: 60  ELKHE-NIVRLYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQL 118

Query: 553 LQCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPN 609
            + +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    T++ T  
Sbjct: 119 FEGVTFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----TEVVTLW 174

Query: 610 YMAPEALV-AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL 668
           Y AP+ L+ + +Y+ +                DMWSCGCI+ +MI GKP +     + +L
Sbjct: 175 YRAPDVLMGSRSYSTS---------------IDMWSCGCILAEMITGKPLFPGTNDEEQL 219

Query: 669 LAIMN----PDVKIPFPEHTS-----------------------NDEKIPKSAIELMKAC 701
             I +    PD ++ +P  TS                         E +    I+L+   
Sbjct: 220 KLIFDIMGTPDEQL-WPAVTSLPKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVTGL 278

Query: 702 LYRNPDKRWTVDKVLNSTFLQPF 724
           L  NPD R T  + L+  +   +
Sbjct: 279 LQLNPDARLTAKQALHHPWFGEY 301

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 133/285 (46%), Gaps = 34/285 (11%)

Query: 444 QYEKIELLGRGGSSRVYKVKG-SGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           QYE ++ +GRG    VYK +  + N++ A+K V+ +  D+  ID    EI          
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEP-IDLLAQEIFFLSEL---- 73

Query: 503 RVIQLLDYE---MGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
           R   + +Y+   + D  ++++ME CG    +++L       L  +   F   E+L  +  
Sbjct: 74  RSPYITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLDY 133

Query: 559 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 617
           +H    +H D+K AN +L   G +K+ DFG++    +  V   R+T +GTP +MAPE + 
Sbjct: 134 LHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG---QMMVTRKRDTFVGTPFWMAPEVI- 189

Query: 618 AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVK 677
                       D NK      +D+WS G  V +++ G PP   +     L+A       
Sbjct: 190 ------------DRNKKGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMA------- 230

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
           IP  +    D++    A + +  CL ++P +R T  ++L   F++
Sbjct: 231 IPKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLKHRFVK 275

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 144/318 (45%), Gaps = 54/318 (16%)

Query: 441 NDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           + SQ++++E LG G  + VYK        Y ALK V  D+ + +     + EI       
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 500 XXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GN--MSLDFNFVRFYAKEMLQC 555
               +++L D    +  L L+ E  D+DL + ++ R  GN    L+ N V+++  ++L+ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEG 120

Query: 556 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 612
           +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           P+ L+       +               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGSNDEEQLKLIF 222

Query: 673 N----------PDVK-IP-----FPEHTSND----------EKIPKSAIELMKACLYRNP 706
                      P V  +P     FP+    D          E +  + I+L+   L  NP
Sbjct: 223 ETMGTPTEATWPGVSALPKYNPNFPQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNP 282

Query: 707 DKRWTVDKVLNSTFLQPF 724
           D R +  + L+  +   +
Sbjct: 283 DMRLSAKQALHHPWFAEY 300

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 114/225 (50%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LYL++E  +  +L  +L +RG +  +   +RF+ ++++  +   H  
Sbjct: 93  VLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGVSYCHAL 150

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A    E  +    ET  G+P+Y APE +  + Y
Sbjct: 151 GIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSCGSPHYAAPEIVSGIPY 207

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR--LLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  R  LL +   + ++P
Sbjct: 208 Q--------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELP 253

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +D++I + A +L+   L  +P++R     +L    LQ +
Sbjct: 254 ------SDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKY 292

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 142/305 (46%), Gaps = 34/305 (11%)

Query: 436 NMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXX 495
           ++I      Y +   LG GG +R +++K    K++A K V+  +                
Sbjct: 83  SLIKTRGRDYRRGHFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQI 142

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQ 554
                   ++  +D    D  +Y+++E C +  L  ++ +R  ++     VRF+  ++  
Sbjct: 143 HKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEP--EVRFFTTQICG 200

Query: 555 CIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAP 613
            +K +H   ++H DLK  N    K   LK+ DFG+A  +  +    Y  T  GTPNY+AP
Sbjct: 201 AVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKY--TVCGTPNYIAP 258

Query: 614 EALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMN 673
           E L+          +H G+ ++V    D+WS G ++Y ++ GKPP+     Q + + ++ 
Sbjct: 259 EVLMG---------KHAGHSFEV----DIWSIGVMIYALLVGKPPF-----QAKDVNVIY 300

Query: 674 PDVKI---PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ---PFMIS 727
             +K     +P+    D+ +   A  L+   L  +P +R ++ ++++  + +   P  I+
Sbjct: 301 DRIKACQYGYPK----DKYVSSEAKTLIADILCVDPVERPSIREIIDDVWFRGIFPPKIT 356

Query: 728 ESIME 732
           E +ME
Sbjct: 357 EDVME 361

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 147/317 (46%), Gaps = 56/317 (17%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI         
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHD 63

Query: 502 XRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNM--SLDFNFVRFYAKEMLQCIK 557
             +++L D    +  L L+ E  D+DL + ++ R  GN    L+ + V+++  ++L+ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRIVGNTPRGLELHLVKYFQWQLLEGLA 122

Query: 558 VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 614
             H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 615 ALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMN- 673
            L+       +               D+WSCGCI+ +MI GKP +     + +L  I + 
Sbjct: 179 VLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFLGSNDEEQLKLIFDT 224

Query: 674 ---------PDVKIPFPEHTSN-DEKIPK----------------SAIELMKACLYRNPD 707
                    P V    P++ +N  +++PK                + I+L+   L  NPD
Sbjct: 225 MGTPNEATWPGVT-SLPKYNANFQQRLPKDLKMILQPYCESPLDDTVIDLLHGLLQLNPD 283

Query: 708 KRWTVDKVLNSTFLQPF 724
            R +  + L+  +   +
Sbjct: 284 MRLSAKQALHHPWFAEY 300

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 114/223 (51%), Gaps = 37/223 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            +++LLD+   D   Y+      E G  DL  ++    NM+ +F  ++   K+++  +K +
Sbjct: 1189 ILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFTSNMT-EFE-IKLLFKQVVSGVKHL 1246

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  KG +KIIDFG A  V     +++    +GT +Y APE L  
Sbjct: 1247 HDQGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVKSGPFDVF----VGTIDYAAPEVL-- 1300

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        GN ++ G+P D+W+ G ++Y +++ + P+ +         I+  D+K 
Sbjct: 1301 -----------GGNPYE-GKPQDIWALGILLYTIVFKENPFYNID------EILEGDLKF 1342

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
              PE+ S D       IEL+K  L RN  KR T+D + N  +L
Sbjct: 1343 NDPENISQD------CIELIKLILNRNVFKRPTIDDIYNDKWL 1379

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 130/283 (45%), Gaps = 29/283 (10%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           S +++ E++GRG    VYK   S  K V+A+K ++ D+ D+  ++  + E+         
Sbjct: 24  SIFKRTEIIGRGKFGVVYKGYHSRTKQVFAIKVLNLDS-DEDEVEDVQREVQFLASMKQV 82

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             + Q     + D  L++I+E C    L  +L       +D  ++    +E+L  +K +H
Sbjct: 83  PNITQYYGSYLKDTTLWIIIEYCAGGSLRTLLRPG---KIDEKYIGVIMRELLIALKFIH 139

Query: 561 DAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
              ++H DLK AN ++   G +K+ DFG+A  +  +  N  R T  GTP +MAPE ++  
Sbjct: 140 RDNVIHRDLKAANVLITNDGQVKLCDFGVAAQL--NQSNSRRHTMAGTPYWMAPEVIMEG 197

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
            Y             KV    D+WS G   Y+   G PPY   +    +  I     K P
Sbjct: 198 VYYDT----------KV----DIWSLGITTYEAATGNPPYCEVEALRAMQLITK--SKPP 241

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
             E  S    +     E +  CL  +P +R + +++L + F++
Sbjct: 242 RLEGRSYSPLL----KEFIALCLDEDPKERLSAEELLKTKFIK 280

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 115/225 (51%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V+ L D    +  LY+I+E  +  +L  +L +RG +  +   +RF+ ++++  I   H  
Sbjct: 92  VLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP-EKEAIRFF-RQIIIGISYCHAL 149

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L   + +KI DFG+A      T +   ET  G+P+Y APE +  + Y
Sbjct: 150 GIVHRDLKPENLLLDHKLNIKIADFGMAAL---ETKDKMLETSCGSPHYAAPEIVSGVPY 206

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  +N LL + + + ++P
Sbjct: 207 H--------------GFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEYEMP 252

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +D++I K A +L+   L  +P++R     +L    LQ +
Sbjct: 253 ------DDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKY 291

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 141/298 (47%), Gaps = 35/298 (11%)

Query: 445 YEKIELLGRGGSSRVYK---VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           + + E++GRG    VYK   +K  G  VYA+K +S ++  D   D  + EI         
Sbjct: 42  FRRTEIIGRGKFGVVYKGYHMKTKG--VYAIKVLSLESDLDEVAD-IQREIQFLVSLKQV 98

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             + +     + D  L++IME C    +  +L       +D  ++    +E+L  +  +H
Sbjct: 99  PNITRYYASYLKDTSLWIIMEYCAGGSVRTLLRPG---KIDEKYIAVIMRELLVALHYIH 155

Query: 561 DAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
              ++H D+K AN ++  +G +K+ DFG+A  + ++T  + R+T  GTP +MAPE ++  
Sbjct: 156 KDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNT--MRRQTMAGTPYWMAPEVIM-- 211

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
                     +G  +     +D+WS G   Y++  G PP+   +    +  I       P
Sbjct: 212 ----------EGISYDTK--ADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSK---P 256

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLN-STFLQPFM-ISESIMEDLI 735
                 N + + K   E +  CL  +P +R T DK+L+ S F++ +     S++++LI
Sbjct: 257 ARLEGKNHDPLLK---EFIAMCLDEDPQERPTADKLLHESAFIKHYKNTHTSVLKELI 311

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 116/232 (50%), Gaps = 31/232 (13%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI         
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 502 XRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNM--SLDFNFVRFYAKEMLQCIK 557
             +++L D    +  L L+ E  D+DL + ++ R  GN    L+ N V+++  ++LQ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLA 122

Query: 558 VVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 614
             H+  I+H DLKP N ++ K G LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 615 ALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQN 666
            L+       +               D+WSCGCI+ +MI GKP    F G N
Sbjct: 179 VLMGSRTYSTS--------------IDIWSCGCILAEMITGKP---LFPGTN 213

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 144/317 (45%), Gaps = 56/317 (17%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           SQ++++E LG G  + VYK       +Y ALK V  D+ + +     + EI         
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 502 XRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNM----SLDFNFVRFYAKEMLQCIK 557
             +++L D    +  L L+ E  D+DL + ++ R +      L+ + V+++  ++LQ + 
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRVDREMPRGLELSLVKYFQWQLLQGVA 122

Query: 558 VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 614
             H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 615 ALV-AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM- 672
            L+ + +Y  +                D+WSCGCI+ +MI GK  +       +L  I  
Sbjct: 179 VLMGSRSYCTS---------------IDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFE 223

Query: 673 -------------------NPDVKIPFPE------HTSNDEKIPKSAIELMKACLYRNPD 707
                              NP + +  P+        + +EKI    I L+   L  NPD
Sbjct: 224 TLGTPTEQMWPGASQLPDYNPQIPLYPPKDLKQLLQPTTNEKISDILISLLHGLLQLNPD 283

Query: 708 KRWTVDKVLNSTFLQPF 724
            R +  + LN  + + +
Sbjct: 284 MRLSAQQALNHHWFEEY 300

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 146/313 (46%), Gaps = 30/313 (9%)

Query: 428 TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSID 486
           +A   +  ++I      Y +   LG GG +R ++++    K++A K V+      + +  
Sbjct: 128 SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIRDDSGKLFAAKTVAKLSIKTEKTRK 187

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
               EI           ++Q +D    D  +Y+++E C +  L ++L +R  ++     V
Sbjct: 188 KLLSEIQIHKSMKHQ-NIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE--V 244

Query: 546 RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 604
           RF+  ++   IK +H   ++H DLK  N    +   LKI DFG+A  +       +  T 
Sbjct: 245 RFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKF--TV 302

Query: 605 IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            GTPNY+APE L+          +H G+ ++V    D+WS G +VY ++ GKPP+ +   
Sbjct: 303 CGTPNYIAPEVLMG---------KHSGHSYEV----DVWSIGVMVYALLVGKPPFQAKDV 349

Query: 665 QNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ-- 722
                 I   D   P  +  S++ K+      L++  L  +P +R ++ ++++  + +  
Sbjct: 350 NTIYERIKCCDFIFPKEKPISHEAKV------LVQDLLSLDPLERPSISEIMDYVWFRGI 403

Query: 723 -PFMISESIMEDL 734
            P  I  ++M ++
Sbjct: 404 FPPYIQSNVMTEV 416

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 114/225 (50%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LYL++E  +  +L  +L +RG +  +   +RF+ ++++  +   H  
Sbjct: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGVSYCHAL 150

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A    E  +    ET  G+P+Y APE +  + Y
Sbjct: 151 GIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSCGSPHYAAPEIVSGIPY 207

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR--LLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  R  LL +   + ++P
Sbjct: 208 Q--------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELP 253

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +D++I + A +L+   L  +P++R     +L    LQ +
Sbjct: 254 ------SDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKY 292

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 115/225 (51%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LY+++E  +  +L  +L ++G +  +   +RF+ ++++  I   H  
Sbjct: 89  VLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQ-EQEAIRFF-RQIIIGISYCHAL 146

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A      T +   ET  G+P+Y APE +  + Y
Sbjct: 147 GIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIVSGIPY 203

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  +N LL + + + ++P
Sbjct: 204 H--------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMP 249

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +D++I   A +L+   L  +P+KR     +L    LQ +
Sbjct: 250 ------SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKY 288

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 82/318 (25%), Positives = 143/318 (44%), Gaps = 54/318 (16%)

Query: 441 NDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           + SQ++++E LG G  + VYK +  +  +  ALK V  D+ + +     + EI       
Sbjct: 3   SGSQFKQLEKLGNGTYATVYKGLNKTTGEFVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 500 XXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GN--MSLDFNFVRFYAKEMLQC 555
               +++L D    +  L L+ E  D DL + ++ R  GN  + L+ + V+++  ++L+ 
Sbjct: 62  HE-NIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTVGNAPVGLELHLVKYFQWQLLEG 120

Query: 556 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 612
           +   H+  I+H DLKP N ++  KG LKI DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGQLKIGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           P+ L+       +               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNEEEQLKLIF 222

Query: 673 N----------------PDVKIPFPEHTSNDEK----------IPKSAIELMKACLYRNP 706
                            P     FP+H   + K          +  + I L+   L  NP
Sbjct: 223 ETMGTPNEQSWPGISSLPKYNPGFPQHLPKNLKSILQAHCASDLDDTLIALLHGLLQLNP 282

Query: 707 DKRWTVDKVLNSTFLQPF 724
           D R +  + L+  +   +
Sbjct: 283 DMRLSAKQALHHPWFAEY 300

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 134/299 (44%), Gaps = 55/299 (18%)

Query: 440 VNDSQYEKIELLGRGGSSRVYKVKGSGNKVY----ALKRVSFDAFDDSSIDGFKGEIXXX 495
           + D  Y  + L     S + Y VK    +       +K V+ +      ++G KG     
Sbjct: 131 LGDGSYSSVVLATARESGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTKG----- 185

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQ 554
                   +I+L      +  LY ++E   H D   ++ + G  SL+    R+YA +++ 
Sbjct: 186 --------IIRLFFTFQDEASLYFLLEYAPHGDFLGLIKKYG--SLNEICARYYASQIID 235

Query: 555 CIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVN---------IYRETQ 604
            +  +H  GI+H D+KP N +L K + +K+ DFG A  +PE   N         +Y +++
Sbjct: 236 AVDSLHSIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSK 295

Query: 605 --IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSF 662
             +GT  Y++PE L        ND+  D          D+W+ GCI+YQM+ GKPP   F
Sbjct: 296 SFVGTAEYVSPELL--------NDSYTDSR-------CDIWAFGCILYQMLAGKPP---F 337

Query: 663 QGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           +  N  L      +KI +    +     P+   +L+K  L R+P+ R  ++++    F 
Sbjct: 338 KAANEYLTFQKV-MKIQY----AFTAGFPQIVKDLVKKLLVRDPNDRLAIEQIKAHVFF 391

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/324 (23%), Positives = 149/324 (45%), Gaps = 38/324 (11%)

Query: 441  NDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRVSFDAFDDSS------IDGFKGEIX 493
            N+  + K E++G+G    V+  +  +  ++ A+K++   ++   S      ++  K E+ 
Sbjct: 1131 NEFAWMKGEMIGKGSFGAVFLSLNITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVS 1190

Query: 494  XXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEM 552
                      ++Q L +EM   +  L +E      +  ++   G    D   +R    ++
Sbjct: 1191 TLKDLDHL-NIVQYLGFEMKHNIYSLFLEYVAGGSVGSLIRMYGR--FDDKLIRHLTNQV 1247

Query: 553  LQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTP 608
            L+ +  +H  GI+H D+K  N +L + GI KI DFGI+    + + +IY  +++   GT 
Sbjct: 1248 LEGLSYLHSQGILHRDMKADNLLLDQDGICKISDFGIS----KKSEDIYSNSEMTMRGTV 1303

Query: 609  NYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL 668
             +MAPE +          +   G   KV    D+WS GC+V +M  GK P+ +F+    +
Sbjct: 1304 FWMAPEMV----------DTKQGYNAKV----DIWSLGCVVLEMFAGKRPWSNFEVVTAM 1349

Query: 669  LAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL---QPFM 725
              I       P PE T   + I  +A   +  C + +P +R T  ++L   F      F+
Sbjct: 1350 YKIGQSKSAPPIPEDTK--DLISPTAKNFLNQCFHIDPKERPTAGQLLEHPFCYNDDSFI 1407

Query: 726  ISESIMEDLIRNAVRYGSEKPQIS 749
             +++ + + I++  +  S K +I+
Sbjct: 1408 FNKTKLAEFIKSNDKINSTKLRIT 1431

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 143/298 (47%), Gaps = 32/298 (10%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           S  ++ E++GRG    VYK      K VYA+K ++ D+ D   ++  + EI         
Sbjct: 42  SSIKRTEVIGRGKFGVVYKGYHLKTKHVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQV 100

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             + +     + D  L++IME C    L  +L  R  M +D  ++    +E+L  ++ +H
Sbjct: 101 PNITRYYGSYLQDTNLWIIMEYCAGGSLRTLL--RPGM-IDEKYIGVIMRELLTALQCIH 157

Query: 561 DAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
              ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++  
Sbjct: 158 KDNVIHRDIKAANVLITNEGKVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEG 215

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL-LAIMNPDVKI 678
            Y             KV    D+WS G   Y++  G PPY   +    + L   +   ++
Sbjct: 216 VYYDT----------KV----DIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARL 261

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMIS-ESIMEDLI 735
              +++S  +       E +  CL  +P +R + +++  S F++    S  +I+++LI
Sbjct: 262 EGRQYSSGLK-------EFIALCLDEDPKERLSAEELQKSKFIKAHKSSPTAILKELI 312

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 135/290 (46%), Gaps = 27/290 (9%)

Query: 436 NMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXX 494
           ++I      Y +   LG GG +R +++K    KV+A K V+      + +      EI  
Sbjct: 81  SLIKTRGRDYHRGHFLGEGGFARCFQMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQI 140

Query: 495 XXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                    ++Q  D    D  +Y+++E C +  + ++L QR +++     VRF   +++
Sbjct: 141 HKSMKHP-NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPE--VRFCMIQII 197

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 612
             I+ +H   ++H DLK  N    K   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 198 GAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKY--TICGTPNYIA 255

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L           +H G+ ++V    D+WS G ++Y +++GKPP+ + + +     I 
Sbjct: 256 PEVLTG---------KHTGHSYEV----DIWSIGVMLYALLFGKPPFQAKEVETIYERIK 302

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
             D   P  +  S+D K       L+   L  NP  R ++ ++ ++ + +
Sbjct: 303 CRDFIFPADKPVSSDAK------NLISHLLQLNPAARPSLYEITDNVWFR 346

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 133/300 (44%), Gaps = 55/300 (18%)

Query: 440 VNDSQYEKIELLGRGGSSRVYKVKGSGNKVY----ALKRVSFDAFDDSSIDGFKGEIXXX 495
           + D  Y  + L     S + Y VK    +       +K V+ +      ++G KG     
Sbjct: 130 LGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTKG----- 184

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQ 554
                   +I+L      +  LY ++E   H D   ++ + G  SL+    R+YA +++ 
Sbjct: 185 --------IIRLFFTFQDEASLYFLLEYAPHGDFLALIKKYG--SLNEQCARYYASQIID 234

Query: 555 CIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT-----------VNIYRE 602
            +  +H  GI+H D+KP N +L K + +K+ DFG A  +PE             +N   +
Sbjct: 235 AVDSLHTIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSK 294

Query: 603 TQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSF 662
           + +GT  Y++PE L        ND+  D          D+W+ GCI++QM+ GKPP   F
Sbjct: 295 SFVGTAEYVSPELL--------NDSYTDSR-------CDIWAFGCILFQMVAGKPP---F 336

Query: 663 QGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
           +  N  L      +KI +    +     P+   +L+K  L + P+ R T++++    F Q
Sbjct: 337 KASNEYLTFQKV-MKIQY----AFTAGFPQIIKDLVKKLLVKEPNDRLTIEQIKAHIFFQ 391

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 151/317 (47%), Gaps = 39/317 (12%)

Query: 445 YEKIELLGRGGSSRVYKV--KGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           Y   + +GRG    VYK   K +G ++ A+K V+ ++  D  I+    EI          
Sbjct: 21  YSIQDCVGRGNFGDVYKAIDKLTG-EIVAIKVVNLES-SDEDIELIAQEIFFLAELKSPY 78

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            +   +   + D  ++++ME CG    S ++    N  L  + V F  K +L+ ++ +H+
Sbjct: 79  -ITNYITTMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE 137

Query: 562 AGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
              +H D+K AN +L   G++K+ DFG++  +        R T +GTP +MAPE +    
Sbjct: 138 QRKIHRDVKAANVLLTDDGLVKLADFGVSGQLRS---TAKRNTFVGTPYWMAPEII---- 190

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
               +++ H  N+      +D+WS G  VY+++ G PPY  +     +  I         
Sbjct: 191 ----SNSSHGYNE-----KADIWSLGITVYELLKGCPPYAKYDAGKVMRNI--------- 232

Query: 681 PEHTSNDEKIPKS--AIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE---SIMEDLI 735
           P+    D  +  S  A   + ACL ++PD+R T  ++L   F++   I++    +ME  I
Sbjct: 233 PKKNLQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQPFVKNIKITDLRNEVME--I 290

Query: 736 RNAVRYGSEKPQISHDN 752
           +   + G++ P+ S DN
Sbjct: 291 KRTRKEGNKVPKYSLDN 307

>Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 96.3 bits (238), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 104/235 (44%), Gaps = 62/235 (26%)

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  LL Y  G  L Y + E G              +LD   V FYA E+   ++ +H  
Sbjct: 227 KLYLLLQYIPGGELFYHLKEHG--------------TLDETTVSFYAAEISCALRFLHTK 272

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAV----------PEHTVNIYRETQIGTPNYM 611
           G+V+ DLKP N +L  +G L + DFG++             PE+   +Y  + IGTP Y 
Sbjct: 273 GVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSVVDEEDPENVNALY--SIIGTPEYC 330

Query: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
           APE L+   YTQN D       W        +S GC++Y M+ GKPPY    G N  + I
Sbjct: 331 APEILLGRAYTQNCD-------W--------YSLGCLLYDMLVGKPPY---TGSNHKVII 372

Query: 672 -------MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNST 719
                    P  KIPF         + +   +++ A L R   KRW VDK    T
Sbjct: 373 NKIQQNKQGP--KIPF--------YLSEGMKDILNALLKRETSKRWNVDKYWTKT 417

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 112/225 (49%), Gaps = 32/225 (14%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V+ LL+       LYL++E  D  +L   L  +G +S +   V ++  +++Q +   H  
Sbjct: 188 VMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLS-EPEAVHYFT-QIIQGVSYCHSF 245

Query: 563 GIVHSDLKPANFVLVKG--ILKIIDFGIAN-AVPEHTVNIYRETQIGTPNYMAPEALVAM 619
            I H DLKP N +L K   ++KI DFG+A   +P    N   ET  G+P+Y +PE ++  
Sbjct: 246 NICHRDLKPENLLLDKKNKVIKIADFGMAALELP----NKLLETSCGSPHYASPEIVMGK 301

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
            Y       H G       PSD+WSCG I++ ++ G  P+     +  LL +     +  
Sbjct: 302 PY-------HGG-------PSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQ--AGRFQ 345

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
            P + +ND K      +L+   L  NP+KR T++++LN   ++ +
Sbjct: 346 LPPYLTNDAK------DLITRILVTNPEKRLTINEILNHPLIKKY 384

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 95.1 bits (235), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 132/285 (46%), Gaps = 34/285 (11%)

Query: 444 QYEKIELLGRGGSSRVYKVKG-SGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           QYE ++ +GRG    VYK +  + N++ A+K V+ +  D+  ID    EI          
Sbjct: 19  QYEILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEP-IDLLAQEIFFLSEL---- 73

Query: 503 RVIQLLDYE---MGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
           R   + +Y+   + D  ++++ME CG    +++L       +      F   E+L  +  
Sbjct: 74  RSPYITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDY 133

Query: 559 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 617
           +H    +H D+K AN +L   G +K+ DFG++    +  V   R+T +GTP +MAPE + 
Sbjct: 134 LHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG---QMMVTRKRDTFVGTPFWMAPEVI- 189

Query: 618 AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVK 677
                       D NK      +D+WS G  V +++ G PP   +     L+A       
Sbjct: 190 ------------DRNKQGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMA------- 230

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
           IP  +    D++    A + +  CL ++P +R T  ++L   F++
Sbjct: 231 IPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKHRFVK 275

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 141/305 (46%), Gaps = 30/305 (9%)

Query: 436 NMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXX 494
           ++I      Y + + LG GG +R +++K    K++A K V+      + +      EI  
Sbjct: 133 SLIKTRGRDYRRGQFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTRRKLLSEIQI 192

Query: 495 XXXXXXXXRVIQLLD-YEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                    ++Q +D +E    +  L+  C +  L ++L +R  ++     VRF+  ++ 
Sbjct: 193 HKSMKHQ-NIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE--VRFFTVQIC 249

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 612
             IK +H   ++H DLK  N    +   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 250 GAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIA 307

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L+          +H G+ ++V    D+WS G +++ ++ GKPP+ +         I 
Sbjct: 308 PEVLLG---------KHSGHSYEV----DIWSIGVMIFALLIGKPPFQAKDVNTIYSRIK 354

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ---PFMISES 729
           N +   P       ++ I + A  L++  L  +P  R ++++++   + +   P M S +
Sbjct: 355 NSEYTFPI------NKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNT 408

Query: 730 IMEDL 734
           +  ++
Sbjct: 409 VFTEI 413

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 115/225 (51%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LY+++E  +  +L  +L ++G +  +   +RF+ ++++  +   H  
Sbjct: 91  VLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP-ENEAIRFF-RQIIIGMSYCHAL 148

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L   + +KI DFG+A      T +   ET  G+P+Y APE +  + Y
Sbjct: 149 GIVHRDLKPENILLDHKLNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIVSGLPY 205

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  +D+WSCG I++ ++ G+ P+    G  +N LL +   + ++P
Sbjct: 206 H--------------GLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMP 251

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                  D++I K A +L+   L  +P+KR    ++L    LQ +
Sbjct: 252 ------GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 140/298 (46%), Gaps = 27/298 (9%)

Query: 428 TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSID 486
           +A   +  ++I      Y +   LG GG +R +++K    K++A K V+      + +  
Sbjct: 60  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQMKDDSGKIFAAKTVAKISIKSEKTRK 119

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
               EI           ++Q +D    D  +Y+++E C +  L  +L +R  ++     V
Sbjct: 120 KLLSEIQIHKSMKHP-NIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPE--V 176

Query: 546 RFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 604
           R++  +++  IK +H+  ++H DLK  N        LKI DFG+A  +       Y  T 
Sbjct: 177 RYFTTQIVGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKY--TV 234

Query: 605 IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            GTPNY+APE L           +H G+ ++V    D+WS G ++Y ++ GKPP+ + + 
Sbjct: 235 CGTPNYIAPEVLAG---------KHSGHSYEV----DIWSIGVMIYALLIGKPPFQAKEV 281

Query: 665 QNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                 I + D   P  + TS      K  + L++  L  +P +R ++D++++  + +
Sbjct: 282 NIIYERIKSGDYIFPREKPTS------KEVMVLIQDILSIDPIERPSLDEIMDYVWFR 333

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 142/298 (47%), Gaps = 36/298 (12%)

Query: 445 YEKIELLGRGGSSRVYK---VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           +++ E++GRG    VYK   +K   N+V A+K ++ D+ DD  ++  + E+         
Sbjct: 19  FKRTEVIGRGKFGIVYKGYYIKT--NRVCAIKVLNLDSADDE-VEDVQKEVQFLSSLKQV 75

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             +       + +  L++IME C    L  +L       +   ++    +E+L  +  +H
Sbjct: 76  PNITHYYGSYLNNTELWVIMEYCAGGSLRTLLRPG---KIGEQYIGVIMRELLIALMHIH 132

Query: 561 DAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
             G++H D+K AN ++   G +K+ DFG+A  + +    I R+T  GTP +MAPE ++  
Sbjct: 133 KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMAGTPYWMAPEVIMEG 190

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL-LAIMNPDVKI 678
            Y             KV    D+WS G   Y++  G PPY   +    + L   +   ++
Sbjct: 191 VYYDT----------KV----DIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRL 236

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFM-ISESIMEDLI 735
              +H+S       +  E +  CL  +P +R + +++L + F++    +S SI+++LI
Sbjct: 237 EGRQHSS-------ALKEFIALCLDEDPKERPSAEELLKTKFIRLHKNVSASILKELI 287

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 148/312 (47%), Gaps = 35/312 (11%)

Query: 429 ATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDG 487
           A + S+R+ ++   + +++ E++GRG    VYK   +  K V A+K ++ D+ DD  ++ 
Sbjct: 6   ANNGSSRSSVS---TLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDE-VED 61

Query: 488 FKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVR 546
            + EI           +       + D  L++IME C    L  +L       +   ++ 
Sbjct: 62  VQKEIQFLSSLKQVPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLRPG---KIGEQYIG 118

Query: 547 FYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI 605
              +E+L  +  +H  G++H D+K AN ++   G +K+ DFG+A  + +    I R+T  
Sbjct: 119 VIMRELLTALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMA 176

Query: 606 GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQ 665
           GTP +MAPE ++   Y             KV    D+WS G   Y++  G PPY   +  
Sbjct: 177 GTPYWMAPEVIMEGVYYDT----------KV----DIWSLGITAYEIATGNPPYCEVEAL 222

Query: 666 NRL-LAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
             + L   +   ++   +H+S       +  E++  CL  +P +R + + +L + F++  
Sbjct: 223 RAMQLITKSKPPRLEGRQHSS-------ALKEIIALCLDEDPKERPSAEDLLKTKFIKLH 275

Query: 725 M-ISESIMEDLI 735
             +  SI+++LI
Sbjct: 276 KNVPVSILKELI 287

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 114/225 (50%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V+ L D    +  LY+I+E  +  +L  +L ++G +  +   VRF+ ++++  I   H  
Sbjct: 96  VLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP-EKEAVRFF-RQIIIGISYCHAL 153

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A      T +   ET  G+P+Y APE +  + Y
Sbjct: 154 GIVHRDLKPENLLLDHKFNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIVSGIPY 210

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  +N LL + +   ++P
Sbjct: 211 H--------------GFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +D+++ + A +L+   L  +P KR    ++L    LQ +
Sbjct: 257 ------DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKY 295

>Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/230 (31%), Positives = 102/230 (44%), Gaps = 62/230 (26%)

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  LL Y  G  L Y + E G              +LD   V FYA E+   +K +H  
Sbjct: 227 KLYLLLQYIPGGELFYHLKEHG--------------TLDETTVSFYAAEISCALKFLHSK 272

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAV----------PEHTVNIYRETQIGTPNYM 611
           G+V+ DLKP N +L  +G L + DFG++             PE+   +Y  + IGTP Y 
Sbjct: 273 GVVYRDLKPENCLLNQRGHLVLTDFGLSKKSAHDSMADEEDPENVKALY--SIIGTPEYC 330

Query: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
           APE L+   YTQN                D +S GC++Y M+ GKPPY    G N  + I
Sbjct: 331 APEILLGKAYTQN---------------CDWYSLGCLLYDMLVGKPPY---TGNNHKVII 372

Query: 672 -------MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDK 714
                    P  KIPF         + +   +++ A L +   KRW VDK
Sbjct: 373 NKIQQNKQGP--KIPF--------YLSEGMKDILNALLKKETSKRWNVDK 412

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 84/320 (26%), Positives = 146/320 (45%), Gaps = 58/320 (18%)

Query: 441 NDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           + SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI       
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 500 XXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GN--MSLDFNFVRFYAKEMLQC 555
               +++L D    +  L L+ E  D DL + ++ R  GN    L+ + V+++  ++ + 
Sbjct: 62  HD-NIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTTGNSPQGLELSLVKYFQWQLFEG 120

Query: 556 IKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 612
           I   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 ISFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 613 PEALV-AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
           P+ L+ + +Y+ +                DMWSCGCI+ +M+ GKP +     + +L  I
Sbjct: 177 PDVLMGSRSYSTS---------------IDMWSCGCILAEMLTGKPLFPGTNDEEQLKLI 221

Query: 672 MN----------PDVKIPFPEHTSN-----------------DEKIPKSAIELMKACLYR 704
            +          P V    P++ SN                  E++    I+L+   L  
Sbjct: 222 FDMMGTPTESTWPTVTT-LPKYNSNFSIQVPKDLKKLLQPFTKEQLDDIVIDLLNGLLQL 280

Query: 705 NPDKRWTVDKVLNSTFLQPF 724
           NP  R +  + L+  +   +
Sbjct: 281 NPSMRLSAKQALHHPWFSEY 300

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 98/208 (47%), Gaps = 30/208 (14%)

Query: 517 LYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYL++E     +L   L  RG   L       Y K+++Q +   H+  I H DLKP N +
Sbjct: 139 LYLVLEYVEGGELFDYLIARGK--LPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPENLL 196

Query: 576 LVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNK 633
           L K    +KI DFG+A      T N   ET  G+P+Y +PE ++   Y            
Sbjct: 197 LDKKNKTVKIADFGMAAL---ETTNRLLETSCGSPHYASPEIVMGQKYH----------- 242

Query: 634 WKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKS 693
              G PSD+WSCG I++ ++ G  P+     +  LL + +   ++P          + K 
Sbjct: 243 ---GSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP--------SNVSKE 291

Query: 694 AIELMKACLYRNPDKRWTVDKVLNSTFL 721
           A +L+   L  +P+KR TVDK+L    L
Sbjct: 292 AKDLISKILVVDPEKRITVDKILEHPLL 319

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 150/327 (45%), Gaps = 40/327 (12%)

Query: 416 VTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK---VKGSGNKVYAL 472
            T  V  + P  T   S + ++     S + + E++GRG    VYK   VK    +VYA+
Sbjct: 21  TTDNVTTIAPKHTLAQSQDSDVC----SSFRRTEVIGRGKFGVVYKGYHVKTQ--QVYAI 74

Query: 473 KRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQI 531
           K ++ D+  D  ++  + E+           +I+     + D  L++IM+ C    +  +
Sbjct: 75  KVLNLDSESDE-VEDVQREVQFLSSLKQFPNIIRYFGSYLKDTNLWIIMDYCAGGSIRTL 133

Query: 532 LNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIAN 590
           L       +D  ++    +E+L  ++ +H   ++H D+K AN ++  +G +K+ DFG+A 
Sbjct: 134 LRPG---KIDEKYIGIIMREILIALQYIHKDNVIHRDIKAANVLVTNEGKVKLCDFGVAA 190

Query: 591 AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVY 650
            +  +   + R+T  GTP +MAPE ++   Y                  +D+WS G   Y
Sbjct: 191 QL--NQTKLRRQTMAGTPYWMAPEVIMEGAYYDTK--------------ADIWSLGITAY 234

Query: 651 QMIYGKPPYGSFQGQNRL-LAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKR 709
           ++  G PPY   +    + L   +   ++    +++       S  E +  CL  +P +R
Sbjct: 235 EIATGNPPYCEIEALRAMQLITKSKPARLEGRSYST-------SLKEFIALCLDEDPKER 287

Query: 710 WTVDKVLNSTFLQP-FMISESIMEDLI 735
            + +++  + F++    +  +I+++LI
Sbjct: 288 LSAEELQKTKFIKSQRAVPTTILKELI 314

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 157/355 (44%), Gaps = 36/355 (10%)

Query: 380  NKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPARTATSSSNRNMIT 439
            N+RLKR+     I  +E    + + V   R   K   TK VEI +    + + S  +   
Sbjct: 1274 NRRLKRTKTIRTI-AHEANEKRRKSVKLKRQNTKMWGTKVVEITKKTNVSINKSKNDRGE 1332

Query: 440  VNDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRVSFDAFDD------SSIDGFKGEI 492
              +  + K EL+G+G    VY  +  +  ++ A+K+V    F        S+++  + E+
Sbjct: 1333 YKEFAWVKGELIGKGSFGSVYLSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEV 1392

Query: 493  XXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKE 551
                       ++Q L +E  + +  L +E      +  ++   G    D + +R    +
Sbjct: 1393 TLLKDLDHI-NIVQYLGFEKKNNIYSLFLEYVAGGSIGSLIRMYGR--FDESLIRHSTTQ 1449

Query: 552  MLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQI---GT 607
            +L  +  +H  GI+H D+K  N +L  +GI KI DFGI+      + +IY  +++   GT
Sbjct: 1450 ILAGLSYLHSKGILHRDMKADNILLDGEGICKISDFGIS----RKSKDIYSNSEMTMRGT 1505

Query: 608  PNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR 667
              +MAPE +          +   G   KV    D+WS GCI+ +M  GK P+ + +    
Sbjct: 1506 VFWMAPEMV----------DTKQGYSAKV----DIWSLGCIILEMFAGKRPWSNLEVVAA 1551

Query: 668  LLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
            +  I       P PE T     I +   + +  C   +P+KR T +++L+  F Q
Sbjct: 1552 MFKIGQSKSAPPIPEDTL--PLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLFSQ 1604

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 141/314 (44%), Gaps = 47/314 (14%)

Query: 421 EIVEPART----ATSSSNRNM-ITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKVYALKR 474
           +I+EP R+    A S SN+   ITV    +EKI LLG+G   +VY V+    N+++ALK 
Sbjct: 291 DIIEPRRSRRLRAKSFSNKFQDITVEPQSFEKIRLLGQGDVGKVYLVRERDTNQIFALKV 350

Query: 475 VS-FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQIL 532
           +S  +      I     E            V     ++  D  LYL ME C   +  + L
Sbjct: 351 LSKHEMIKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTED-FLYLCMEYCMGGEFFRAL 409

Query: 533 NQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA 591
             R +  +     +FYA E++  ++ +H  G ++ DLKP N +L + G + + DF ++  
Sbjct: 410 QTRKSKRITEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQ 469

Query: 592 V-----PEHTVNIYRETQ-----------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWK 635
                 P    + Y +T+           +GT  Y+APE +           R +G+   
Sbjct: 470 ATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI-----------RGNGHTAA 518

Query: 636 VGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAI 695
           V    D W+ G +VY+M++G  P+           I+  DVK P      +D++I K   
Sbjct: 519 V----DWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFP------HDKEISKHCK 568

Query: 696 ELMKACLYRNPDKR 709
           +L+K  L +N  KR
Sbjct: 569 DLIKRLLNKNESKR 582

>Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {ON}
           YBR028C - Hypothetical ORF [contig 184] FULL
          Length = 515

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 104/350 (29%), Positives = 152/350 (43%), Gaps = 73/350 (20%)

Query: 414 PPVTKKVEIV--EPARTATSSSNRNMITVNDSQ-------YEKIELLGRGGSSRVYKVKG 464
           PP T+++ +   EP  + +  S+    +V D         +  + +LGRG   +V  VK 
Sbjct: 85  PPNTRRITLSTEEPQGSNSERSSYCAPSVFDKHGTRTLEDFAPVRVLGRGAYGKVLLVKD 144

Query: 465 S-GNKVYA---LKRVSFDAFDDSSIDGFK-GEIXXXXXXXXXXRVI--QL-------LDY 510
           S  +++YA   LK+      D SS +G     +          R I  QL       L Y
Sbjct: 145 SHTSRLYAMKQLKKAEILIHDGSSEEGQPDSNLEKRLERTFAERTILSQLEHPNIVKLFY 204

Query: 511 EMGDGL-LYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSD 568
              D   LYLI++     +L   L ++G  +LD + V FYA E+   ++ +H  G+V+ D
Sbjct: 205 SFHDHHKLYLILQFIPGGELFYHLKEQG--TLDEDTVAFYAAEISCALRFLHKRGVVYRD 262

Query: 569 LKPANFVL-VKGILKIIDFGIANAVP---------------EHTVNIYRETQIGTPNYMA 612
           LKP N +L  +G L + DFG++                   E        + IGTP Y A
Sbjct: 263 LKPENCLLDERGHLVLTDFGLSKVSASDDSADGGDVNTNGHEGESVCTLHSIIGTPEYCA 322

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L    YTQN                D +S GC+++ M+ GKPPY    G N  + I+
Sbjct: 323 PEILEGKPYTQN---------------CDWYSLGCLIFDMLIGKPPY---TGVNHKV-IL 363

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMK----ACLYRNPDKRWTVDKVLNS 718
           N  +K   P       KIP    E MK    A L ++  KRW VDK  N+
Sbjct: 364 NKILKDKIP-------KIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNT 406

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 135/284 (47%), Gaps = 37/284 (13%)

Query: 444 QYEKIELLGRGGSSRVYKVKGSG-NKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           +Y  +  +GRGGS+ VY     G N   A+K+++ +      +     EI          
Sbjct: 612 KYANLVKIGRGGSALVYTAYEVGTNLSVAIKQINLEKQPRKQL--ILNEIIVMKKSQHP- 668

Query: 503 RVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            ++  +D  + DG L++IME  +   L+ ++ +     L    +    +E+L+ +  +H 
Sbjct: 669 NIVNFIDSYLVDGKLWVIMEYMEAGSLTDVVTR---CILREGQIGAVCREVLKGLVFLHS 725

Query: 562 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
            G++H D+K  N +L + G +K+ DFG    +  + +++ R T +GTP +MAPE +   +
Sbjct: 726 KGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQL--NDIHLKRNTMVGTPYWMAPEIVEKKH 783

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM---NPDVK 677
           Y             KV    D+WS G ++ +MI G+PPY +      L  I     P +K
Sbjct: 784 YCP-----------KV----DIWSLGVMIIEMIEGEPPYLNEPPLRALYLIATNGTPKLK 828

Query: 678 IPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
            P        EK+ ++  E +  CL+ +P+ R T  ++LN  F+
Sbjct: 829 DP--------EKLSETLSEFINCCLFVDPELRKTAAELLNHRFI 864

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 140/318 (44%), Gaps = 35/318 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRV 475
            T+ VE+ +    +   S  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1146 TRVVEVTDKGMVSIDKSKNSRGEYKEFAWIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQV 1205

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                F        S ++  + E+           ++Q L +E  + +  L +E      +
Sbjct: 1206 EVPKFGSQDEATISVVEALRSEVSTLKNLDHL-NIVQYLGFENKNSIYSLFLEYVAGGSV 1264

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFG 587
              ++   G    D + +RF   ++L+ +  +H  GI+H D+K  N +L + G+ KI DFG
Sbjct: 1265 GSLIRLYGR--FDESLIRFLTVQVLRGLSYLHSRGILHRDMKADNLLLDLDGVCKISDFG 1322

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1323 IS----RKSNDIYCNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1364

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M  GK P+ + +    +  I       P PE T     I K   E + AC   
Sbjct: 1365 LGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKTAPPIPEDTL--PLISKEGREFLDACFEI 1422

Query: 705  NPDKRWTVDKVLNSTFLQ 722
            +P++R T D +L   F +
Sbjct: 1423 DPERRPTADTLLRHRFCE 1440

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
            similar to Ashbya gossypii AFR092W
          Length = 1397

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 141/312 (45%), Gaps = 45/312 (14%)

Query: 433  SNRNMITVNDSQ----------YEKIELLGRGGSSRVY-KVKGSGNKVYALKRVSFDAFD 481
            +++ M+++N S+          + K E++G+G    VY  +  +  ++ A+K+V    F 
Sbjct: 1076 TDKRMVSINKSKNSKGEYREFAWIKGEIIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFG 1135

Query: 482  D------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQ 534
                   ++++    E+           ++Q L +E  +G+  L +E      +  ++  
Sbjct: 1136 SQDQITVTNVEALISEVSTLKNLDHLN-IVQYLGFENKNGIYSLFLEYVAGGSVGSLIRL 1194

Query: 535  RGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVP 593
             G+   D   +RF  K++L+ +  +H  GI+H D+K  N +L   G+ KI D GI+    
Sbjct: 1195 YGH--FDEQLIRFLTKQVLEGLAYLHRRGILHRDMKADNLLLDNNGVCKISDLGIS---- 1248

Query: 594  EHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVY 650
              + NIY   ++   GT  +MAPE +   + TQ       G   KV    D+WS GC+V 
Sbjct: 1249 RKSNNIYSNAEMTMRGTVFWMAPEMV---DTTQ-------GYSAKV----DIWSLGCVVL 1294

Query: 651  QMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRW 710
            +M  GK P+ + +    +  I       P PE T     I K     +  C   +P+KR 
Sbjct: 1295 EMFAGKRPWSNLEVVAAMFQIGKSKTAPPIPEKTL--PLISKDGRVFIDDCFKIDPEKRP 1352

Query: 711  TVDKVLNSTFLQ 722
            T D +L+  F Q
Sbjct: 1353 TADTLLSHPFCQ 1364

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 113/225 (50%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D       LY+++E  +  +L  +L +RG +  +   VRF+ ++++  I   H  
Sbjct: 101 VLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLP-ENEAVRFF-RQIIIGISYCHAL 158

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A      + +   ET  G+P+Y APE +  + Y
Sbjct: 159 GIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLPY 215

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR--LLAIMNPDVKIP 679
                          G  SD+WSCG I+Y ++ G+ P+    G  R  LL + + + ++P
Sbjct: 216 H--------------GFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSGEYEMP 261

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 NDE I   A +L+   L  +PD+R    ++L    LQ +
Sbjct: 262 -----GNDE-ISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKY 300

>TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.229
           YBR028C
          Length = 493

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 156/355 (43%), Gaps = 73/355 (20%)

Query: 410 PAPKPPVTKKVEIVEPARTATSSSNRNMITVNDS---------QYEKIELLGRGGSSRVY 460
           P   PP T++V I   +   TS S    I+ ND           +  + +LG+G   +V 
Sbjct: 64  PVSTPPCTRRVSITAASNPFTSGSLDLGISPNDGGTGLTRSLRDFRPVRVLGKGAYGKVV 123

Query: 461 KVKG-SGNKVYALKRVS----FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLD------ 509
            V+    +K+YA+K++         D   ++G K              ++  L+      
Sbjct: 124 LVEDEQTSKLYAMKQLQKADIIITKDSEELNGDKNVSKLIERTFAERTILSELEHPNIVK 183

Query: 510 --YEMGD-GLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIV 565
             Y   D   LYLI++     +L   L ++G  +LD + V FYA E+   +K +H  GIV
Sbjct: 184 LFYSFHDNSKLYLILQYIPGGELFFHLKEQG--TLDEDTVAFYAAEISCALKFLHSKGIV 241

Query: 566 HSDLKPANFVLVK-GILKIIDFGIA-----------------NAVPEHTVNIYRETQIGT 607
           + DLKP N +L + G L + DFG++                 + + E   +++  + IGT
Sbjct: 242 YRDLKPENCLLDQHGHLVLTDFGLSKKSVVQRDNPLSSSTEGDLLGEEVTSLH--SIIGT 299

Query: 608 PNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR 667
           P Y APE L  + YT+N                D +S GC++Y M+ GKPP+    G N 
Sbjct: 300 PEYCAPEILQGIPYTKN---------------CDWYSLGCLMYDMMTGKPPH---TGANH 341

Query: 668 --LLAIMNPDVKIP-FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNST 719
             +L  +  D + P  P + S+  K      +++ A L +   KRW VD+   +T
Sbjct: 342 KVILNKIQKDKQGPKIPYYLSDGMK------DMLSALLKKEHTKRWDVDQYWKNT 390

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 115/235 (48%), Gaps = 35/235 (14%)

Query: 504  VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
            V+Q    E+    + L ME C    L+Q+L + G +  D    + YA +ML+ +  +H +
Sbjct: 1294 VVQYYGVEVHRDKVNLFMEYCEGGSLAQLL-EHGRIE-DEMVTQVYALQMLEGLAYLHQS 1351

Query: 563  GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYR----------ETQIGTPNYM 611
             +VH D+KP N +L   G++K +DFG A ++  +   +             + +GTP YM
Sbjct: 1352 SVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKVANNGSEGKTDGVNSMMGTPMYM 1411

Query: 612  APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
            +PE++                K K G  SD+WS GC++ +M  G+ P+ +   +    AI
Sbjct: 1412 SPESVTG------------AKKGKFGS-SDIWSLGCVILEMATGRRPWFNLDNE---WAI 1455

Query: 672  MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMI 726
            M        P+  S DE  P+    L+K CL ++PDKR T  ++L    + P+MI
Sbjct: 1456 MYHVAAGHVPQLPSRDEISPQGTDFLLK-CLKQDPDKRATAMELL----VHPWMI 1505

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 112/225 (49%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LYL++E  +  +L  +L +RG +  +   +RF+ ++++  +   H  
Sbjct: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-ENEAIRFF-RQIIIGVSYCHAL 150

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A    E  +    ET  G+P+Y APE +  + Y
Sbjct: 151 GIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETSCGSPHYAAPEIVSGIPY 207

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR--LLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  R  LL +     ++P
Sbjct: 208 Q--------------GFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +D+++ + A +L+   L  +P +R     +L    LQ +
Sbjct: 254 ------SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKY 292

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 143/305 (46%), Gaps = 31/305 (10%)

Query: 445 YEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           +++ E++GRG    VYK   +  K VYA+K ++ D  +D  ++  + EI           
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDE-VEDVQKEIQFLASLKQVPN 83

Query: 504 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           + +     + D  L++IME C    L  +L       +D  ++    +++L  +  +H  
Sbjct: 84  ITRYYGSYLYDTKLWVIMEYCAGGSLRTLLRPG---KIDEKYLGVIVRKLLIALVYIHKD 140

Query: 563 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
            ++H D+K AN ++  +G +K+ DFG+A  +     N  R+T  GTP +MAPE ++   Y
Sbjct: 141 NVIHRDIKAANVLITNEGHVKLCDFGVAAQL--TAANHKRQTMAGTPYWMAPEVIMEGVY 198

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFP 681
                             +D+WS G   Y++  G PPY   +    +  I     K P  
Sbjct: 199 YNTK--------------ADIWSLGITAYEIATGNPPYCDVEALRAMQLITK--SKPPRL 242

Query: 682 EHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFM-ISESIMEDLIRNAVR 740
           E   N   + K  I L   CL  +P++R T + +L+S F++     S +I+++LI   + 
Sbjct: 243 E-GRNYSPLLKEFIAL---CLDEDPEERPTAEDLLSSKFVKAHKGSSATILKELISRYLL 298

Query: 741 YGSEK 745
           + SEK
Sbjct: 299 F-SEK 302

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 143/316 (45%), Gaps = 35/316 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ E    + + S  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1247 TRMVEVTEKHMVSINKSKNSRGEYKEFAWMKGEMIGKGSFGAVYLCLNLTTGEMMAVKQV 1306

Query: 476  S---FDAFDDS---SIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                + A D +   +++  + E+           ++Q L +E    +  L +E  G   +
Sbjct: 1307 EVPKYSAQDQNILDTVEALRSEVSTLKDLDHLN-IVQYLGFENDHDIYSLFLEYVGGGSV 1365

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFG 587
              ++   G    D   +RF   ++L+ +  +H  GI+H D+K  N +L + G+ KI DFG
Sbjct: 1366 GSLIRLYGR--FDEALIRFLTVQVLEGLAYLHSKGILHRDMKADNLLLDLDGVCKISDFG 1423

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1424 IS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1465

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M  GK P+ + +    +  I       P PE T     I +   + + AC   
Sbjct: 1466 LGCVVLEMFAGKRPWSNLEVVAAMFKIGKNKSAPPIPEDTL--PLISQDGRQFLNACFEI 1523

Query: 705  NPDKRWTVDKVLNSTF 720
            +PD R T DK+L+  F
Sbjct: 1524 DPDLRPTADKLLSHPF 1539

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 142/304 (46%), Gaps = 29/304 (9%)

Query: 437 MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXXX 495
           +I      Y +   LG GG +R +++K    KV+A K V+      + + +    EI   
Sbjct: 90  LIKSKGKDYYRGHFLGEGGFARCFQMKDDDGKVFAAKTVAKISIKSEKARNKLLSEIQIH 149

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQ 554
                   ++  +D    D  +Y+++E C +  L  +L +R  ++     VRF+  ++  
Sbjct: 150 KNMRHQ-NIVHFIDCFEDDINVYILLEICPNGSLMDLLKRRKILTEPE--VRFFTTQICG 206

Query: 555 CIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAP 613
            +  +H   I+H DLK  N    K   LKI DFG+A  +  +  N  + T  GTPNY+AP
Sbjct: 207 ALDHMHSRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAII--NNENERKYTICGTPNYIAP 264

Query: 614 EALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMN 673
           E ++          +  G+ ++V    D+WS G +++ MI GKPP+ + +       I +
Sbjct: 265 EVIMG--------GKQIGHSFEV----DIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKH 312

Query: 674 PDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ---PFMISESI 730
            +   P  ++ S D K      +L++  L  NP +R T+ ++LN  + +   P  +   +
Sbjct: 313 CNYSFPTDKYVSKDVK------KLIQDILSMNPMERPTIQEILNYNWFKGNFPPCMPIDV 366

Query: 731 MEDL 734
           M D+
Sbjct: 367 MNDI 370

>YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}
           YPK3An AGC kinase phosphorylated by cAMP-dependent
           protein kinase (PKA) in a TORC1-dependent manner
          Length = 525

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 107/235 (45%), Gaps = 62/235 (26%)

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  LL Y  G  L Y + E G              +LD   V FYA E+   ++ +H  
Sbjct: 226 KLYLLLQYIPGGELFYHLKEHG--------------TLDETTVSFYAAEISCALRFLHTK 271

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIA------NAV----PEHTVNIYRETQIGTPNYM 611
           G+V+ DLKP N +L  +G L + DFG++      +AV    PE+   +Y  + IGTP Y 
Sbjct: 272 GVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSAVDEEDPENVNALY--SIIGTPEYC 329

Query: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
           APE L+   Y+QN D       W        +S GC++Y M+ GKPPY    G N  + I
Sbjct: 330 APEILLGKAYSQNCD-------W--------YSLGCLLYDMLVGKPPY---TGSNHKVII 371

Query: 672 -------MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNST 719
                    P  KIPF         + +   +++ A L +   KRW VDK    T
Sbjct: 372 NKIQQNKQGP--KIPF--------YLSEGMKDILNALLKKETAKRWNVDKYWAKT 416

>TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {ON}
           Anc_3.229 YBR028C
          Length = 629

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 102/238 (42%), Gaps = 61/238 (25%)

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  LL Y  G  L Y + E G              +LD + V FYA E+   +K +H+ 
Sbjct: 254 KLYLLLQYIPGGELFYHLKEQG--------------TLDEDTVAFYAAEISCALKFLHEK 299

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGI-----------------ANAVPEHTVNIYRETQ 604
           GIV+ DLKP N +L  KG L + DFG+                 A  +     +I  E +
Sbjct: 300 GIVYRDLKPENCLLNEKGHLVLTDFGLSKKSLSESRTPSAVDLKAKLISNEDYSIVSEEE 359

Query: 605 --------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGK 656
                   IGTP Y APE L+   YTQN                D +S GC++Y M+ GK
Sbjct: 360 DVVALHSIIGTPEYCAPEILMGQPYTQN---------------CDWYSLGCLIYDMLVGK 404

Query: 657 PPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDK 714
           PP+     +  L  I    V    P + S+  K      +++ A L ++  KRW VDK
Sbjct: 405 PPFTGNNHKVILNKIQKEKVGPKIPYYLSDGMK------DMLGALLKKDNSKRWNVDK 456

>KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 519

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 100/318 (31%), Positives = 145/318 (45%), Gaps = 74/318 (23%)

Query: 445 YEKIELLGRGGSSRVYKVKGS-GNKVYA---LKRVSFDAFDDSSIDGFKGE---IXXXXX 497
           ++ I +LGRG   +V  V+ S  +++YA   LK+      +D S D  + +   +     
Sbjct: 124 FKPIRVLGRGAYGKVLLVRDSHTHRLYAMKQLKKAEILIHEDKSSDTEETKDDALEKRLE 183

Query: 498 XXXXXRVI--QL-------LDYEMGDGL-LYLIME-CGDHDLSQILNQRGNMSLDFNFVR 546
                R+I  QL       L Y   D   LYL+++     +L   L ++G  +LD N V 
Sbjct: 184 RTFAERIILSQLEHPNIVKLFYSFHDHHKLYLVLQFIPGGELFYHLKEQG--TLDENTVT 241

Query: 547 FYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA---------------- 589
           FYA E+   +K +H+ GIV+ DLKP N +L  +G L + DFG++                
Sbjct: 242 FYAAEISCALKFLHERGIVYRDLKPENCLLDERGHLVLTDFGLSKKSAADSDTPERSDID 301

Query: 590 -NAVPEHT---VN-IYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            +A+  H+   VN +Y  + IGTP Y APE L    YTQN                D +S
Sbjct: 302 GDALNSHSGEPVNKLY--SIIGTPEYCAPEILEGKPYTQN---------------CDWYS 344

Query: 645 CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMK----A 700
            GC+V+ M+ GKPPY     +  L  I+    K P         KIP    E MK    A
Sbjct: 345 LGCLVFDMLIGKPPYTGVNHKVILGKILKD--KTP---------KIPSYLSEGMKDYLGA 393

Query: 701 CLYRNPDKRWTVDKVLNS 718
            L ++  KRW VDK  +S
Sbjct: 394 LLKKDVTKRWDVDKFWDS 411

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 88/315 (27%), Positives = 148/315 (46%), Gaps = 49/315 (15%)

Query: 433 SNRNMITVNDSQ---YEKIELLGRGGSSRV-YKVKGSGNKVYALKRVSFDAFD------D 482
           SNR++ TV  ++   ++  E LG G + +V      S N+  A+K +S   F+      D
Sbjct: 5   SNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKD 64

Query: 483 SSID---------GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQIL 532
           SS+          G + EI           V++L D    +  LY+++E     +L  +L
Sbjct: 65  SSVAASTPDSLPYGIEREIIIMKLLNHPN-VLRLYDVWETNSNLYMVLEYAQKGELFNLL 123

Query: 533 NQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA 591
            +RG +  +   +RF+ ++++  I   H  GIVH DLKP N +L  K  +KI DFG+A  
Sbjct: 124 VERGPLP-EKEAIRFF-RQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 181

Query: 592 VPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQ 651
               T +   ET  G+P+Y APE +  + Y               G  SD+WSCG I++ 
Sbjct: 182 ---ETEDKLLETSCGSPHYAAPEIVSGIPYH--------------GFASDVWSCGVILFA 224

Query: 652 MIYGKPPYGSFQG--QNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKR 709
           ++ G+ P+    G  +N LL + +   ++P       D++I   A +L+   L  +P++R
Sbjct: 225 LLTGRLPFDDEDGNIRNLLLQVQSGRYEMP------GDDEISPDAQDLIARILTVDPEQR 278

Query: 710 WTVDKVLNSTFLQPF 724
                +L    LQ +
Sbjct: 279 IKARDILKHPLLQKY 293

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 141/308 (45%), Gaps = 69/308 (22%)

Query: 445 YEKIELLGRGGSSRVYKVKGS-GNKVYALKR------------VSFDAFDDSSID----- 486
           ++ I +LG+G  S+V  VK    NK+YA+K+            V  D+ D +++      
Sbjct: 114 FKPIRVLGKGAYSKVVLVKDHHSNKLYAMKQLKKAEILINEKEVREDSEDPTTLQKRIER 173

Query: 487 GFKGEIXXXXXXXXXXRVIQLLDYEMGD-GLLYLIME-CGDHDLSQILNQRGNMSLDFNF 544
            F   I           V++L  Y   D   LYLI++     +L   L +RG  +LD + 
Sbjct: 174 TFAERIILSKLEHP--NVVKLF-YSFHDHSKLYLILQYIPGGELFFHLKERG--TLDEDT 228

Query: 545 VRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAV----------- 592
           V FYA E+   +K +HD GIV+ DLKP N +L  +G L + DFG++              
Sbjct: 229 VAFYAAEISVALKFLHDNGIVYRDLKPENCLLSQRGHLVLTDFGLSKEAVDNVSDNESTE 288

Query: 593 ---PEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIV 649
              PE    ++  + IGTP Y APE L  + Y +N                D +S GC++
Sbjct: 289 LNSPEDIYTLH--SIIGTPEYAAPEILQGLPYNKN---------------CDWYSLGCLL 331

Query: 650 YQMIYGKPPYGSFQGQNR--LLAIMNPDVKIP-FPEHTSNDEKIPKSAIELMKACLYRNP 706
           + M+ GKPPY    G N   +L  +  D + P  P + S+  K      +++   L ++ 
Sbjct: 332 FDMLVGKPPY---TGTNHKVILNKIQKDKQGPRIPFYLSDGMK------DMLNWLLKKDK 382

Query: 707 DKRWTVDK 714
            KRW VDK
Sbjct: 383 TKRWDVDK 390

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 112/227 (49%), Gaps = 33/227 (14%)

Query: 504 VIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           +I+L      +  LY ++E   + DL  ++ + G  SL+     +Y  +++  IK +H  
Sbjct: 235 IIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFG--SLNEECCCYYGAQIIDAIKFMHSK 292

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIA----NAVPEHTVNIYRETQ--IGTPNYMAPEA 615
           GI+H D+KP N +L K + +KI DFG A    N  P  + ++   ++  +GT  Y++PE 
Sbjct: 293 GIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPEL 352

Query: 616 LVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPD 675
           L        NDN  D         SD+W+ GCIV+QMI GKPP   F+  N  L      
Sbjct: 353 L--------NDNYTDAR-------SDIWAFGCIVFQMIAGKPP---FKATNEYLTFQK-V 393

Query: 676 VKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
           +K+ +    +     P    +L+K  L + P++R T++ +    F +
Sbjct: 394 MKVQY----AFTAGFPTVVRDLVKRILIKAPEQRLTIEAIEKHHFFR 436

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 157/354 (44%), Gaps = 38/354 (10%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ E    A + S  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1068 TRMVEVTEKQLVAINKSKNSRGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQV 1127

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +        S+++  + E+           ++Q L +E  D +  L +E      +
Sbjct: 1128 EVPKYSSQDENIISTVEALRSEVSTLKDLDHLN-IVQYLGFENKDNIYSLFLEYVAGGSV 1186

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D   +R    ++L+ +  +H  GI+H D+K  N +L + G+ KI DFG
Sbjct: 1187 GSLIRMYGR--FDEAMIRHLTIQVLRGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFG 1244

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1245 IS----RKSNDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1286

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M  GK P+ + +    +  I       P PE T     I +   + + +C   
Sbjct: 1287 LGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTL--PLISQDGRQFLDSCFEI 1344

Query: 705  NPDKRWTVDKVLNSTFLQ---PFMISESIMEDLIRNAVRYGSEKPQISHDNLND 755
            +P+ R T DK+L+  F +    F    + +   I++  +  S K +++  ++ND
Sbjct: 1345 DPESRPTADKLLSHAFSKVYPSFNFKSTELCKFIKSNDKINSSKLRVASKDVND 1398

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 141/300 (47%), Gaps = 36/300 (12%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           S +++ E++G G    VYK   +  K VYA+K ++ D+ D+  ++  + E+         
Sbjct: 27  SVFKRTEVIGTGKFGVVYKGHHARTKQVYAIKVLNLDS-DEDEVEDVQREVQFLASMKQT 85

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             +       + D  L++I+E C    L  +L       +D  ++    +E+L  +K +H
Sbjct: 86  PNITHYYGSYLKDTTLWIIIEYCAGGSLRTLLRPG---KIDEKYIGIIMREVLIALKYIH 142

Query: 561 DAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV-A 618
              ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++  
Sbjct: 143 KDNVIHRDIKAANVLITNEGHVKLCDFGVAAQL--NQSSLKRQTMAGTPYWMAPEVIMEG 200

Query: 619 MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
           ++Y             KV    D+WS G   Y++  G PPY   +    +  I     K 
Sbjct: 201 VSYDT-----------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLITK--SKP 243

Query: 679 PFPE--HTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF-MISESIMEDLI 735
           P  E  H S   K      E +  CL  +P +R + D +L S  ++     S +++++LI
Sbjct: 244 PRLEGRHYSPMLK------EFIALCLDEDPKERLSADDLLKSKLIKHHRTASTTVLKELI 297

>TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1621

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 87/365 (23%), Positives = 152/365 (41%), Gaps = 55/365 (15%)

Query: 388  DDAIINENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDS---- 443
            DD I+  N  + VK  E   +     P    KV         T S N+ ++++  S    
Sbjct: 1250 DDEILMVNSQLRVKAIEELENTMTHNPRQIGKV------LDDTDSGNKYLLSLASSMSNV 1303

Query: 444  --QYEKIELLGRGGSSRVYKVKGSGN-KVYALKRVSF-DAFDDSSIDGFKGEIXXXXXXX 499
              +++K + +G G    V+     GN ++ A+K +   DA     +     +        
Sbjct: 1304 SIKWQKRQFVGSGTFGTVFSAVNLGNGEILAVKEIKIQDAKAMKKVFPLIKDEMSVLEML 1363

Query: 500  XXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
                ++Q    E+    + L ME C    L+ +L + G +  D    + Y+ E+L+ +  
Sbjct: 1364 NHPNIVQYYGIEVHRDKVNLFMEFCEGGSLAGLL-EHGRIE-DEMVTQMYSLELLEGLVY 1421

Query: 559  VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ------------- 604
            +H +GIVH D+KP N +L   GI+K +DFG A  + E+   +  +               
Sbjct: 1422 LHQSGIVHRDIKPENILLDFNGIIKFVDFGAARKIAENNTKVEGQNDSISDNEGTIEDAT 1481

Query: 605  --------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGK 656
                    +GTP YMAPE +                K + G   D+WS GC++ +MI GK
Sbjct: 1482 SSKGVHNIVGTPMYMAPETITG-----------SAVKGQFG-ADDVWSLGCVILEMITGK 1529

Query: 657  PPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVL 716
             P+     +  ++  +      PFP    N  ++ K+    +K  + + PDKR T  ++L
Sbjct: 1530 RPWAHLDNEWAIMYHVAAGHIPPFP----NKNELSKAGFTFLKRAIVQKPDKRATAVELL 1585

Query: 717  NSTFL 721
               ++
Sbjct: 1586 THPWI 1590

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 113/225 (50%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LY+++E  +  +L  +L ++G ++ +   VRF+ ++++  +   H  
Sbjct: 105 VLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLA-ENEAVRFF-RQIIIGMSYCHAL 162

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A    E  +    ET  G+P+Y APE +  + Y
Sbjct: 163 GIVHRDLKPENILLDHKSNIKIADFGMAALETEDKL---LETSCGSPHYAAPEIVSGLPY 219

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  +D+WSCG I++ ++ G+ P+    G  +N LL +   + ++P
Sbjct: 220 N--------------GLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMP 265

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
             +  S +      A +L+   L  NP +R    ++L    LQ +
Sbjct: 266 GSDELSLE------AQDLIGKILTVNPKQRIKTREILKHPLLQKY 304

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 147/327 (44%), Gaps = 28/327 (8%)

Query: 436 NMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVS-FDAFDDSSIDGFKGEIXX 494
           ++I      Y + + LG GG +R +++K    K++A K V+      + +      EI  
Sbjct: 72  SLIKTRGRDYHRGQFLGEGGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEI-Q 130

Query: 495 XXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                    ++Q +D    +  +Y+++E C +  L +++ +R  ++     VRF+  ++ 
Sbjct: 131 IHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEP--EVRFFMTQIC 188

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 612
             I+ +H   ++H DLK  N    +   LKI DFG+A  +       +  T  GTPNY+A
Sbjct: 189 GGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKF--TICGTPNYIA 246

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ +         I 
Sbjct: 247 PEVLMG---------KHSGHSYEV----DIWSIGVMLYALLIGKPPFQAKDVNTIYERIK 293

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIME 732
             +   P       D+KI + A  L+   L  NP +R ++ ++++  + +        + 
Sbjct: 294 QRNFAYP------KDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRG-TFPPYTLN 346

Query: 733 DLIRNAVRYGSEKPQISHDNLNDVVET 759
            ++     Y    PQ S  N  + +E 
Sbjct: 347 SVMTTVPDYSHITPQESFMNFQNCLEA 373

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 148/316 (46%), Gaps = 22/316 (6%)

Query: 449 ELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQL 507
           E++G+G  + V K V+ S  K +A+K +S      S++DG   E+          R+++L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMDGVSRELEVLQRLDHP-RIVRL 264

Query: 508 LDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVH 566
             +       Y++ME     DL   +   G +  D    R  ++++L+ IK +H  GI H
Sbjct: 265 KGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAG--REISRQILEAIKYIHSMGISH 322

Query: 567 SDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN--- 620
            DLKP N ++ +    ++KI DFG+A      T   + +T  GT  Y+APE +   N   
Sbjct: 323 RDLKPDNILIEQDDPVLVKITDFGLAKVQDNGT---FMKTFCGTLAYVAPEIISGKNDGE 379

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY-GSFQGQNRLLAIMNPDVKIP 679
             +N D   + N++      DMWS GC+VY ++ G  P+ GS Q Q     +     +  
Sbjct: 380 LRENADANSERNEY--SSLVDMWSMGCLVYVILTGHLPFSGSTQKQ-----LYKQISRGS 432

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAV 739
           + E    D +I   A + + + L   P+ R T +K L   +++    S+S +++   N+V
Sbjct: 433 YHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIKMAQFSQSFVKNNSVNSV 492

Query: 740 RYGSEKPQISHDNLND 755
               +K      +L D
Sbjct: 493 NETDDKDSCFQVSLTD 508

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 132/297 (44%), Gaps = 30/297 (10%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           S Y++ E++GRG    VYK      K + A+K ++ D  +D  ++  + EI         
Sbjct: 24  SIYKRTEVIGRGKFGVVYKGYHIRTKQICAIKVLNLDTSEDE-VEDVQKEIQFLSSLKQV 82

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             +       + D  L++IME C    L  +L       +D  ++    +E+L  +  +H
Sbjct: 83  PNITHYYGSYLYDTKLWIIMEYCAGGSLRTLLRPG---KIDEKYIGVIMRELLVALLYIH 139

Query: 561 DAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
              ++H D+K AN ++   G +K+ DFG+A  + +   N+ R+T  GTP +MAPE ++  
Sbjct: 140 KDNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQS--NVRRQTMAGTPYWMAPEVIMEG 197

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
            Y             KV    D+WS G   Y++  G PPY   +    +  I        
Sbjct: 198 VYYDT----------KV----DIWSLGITTYEITTGNPPYCDVEALRAMQLITKSK---- 239

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMIS-ESIMEDLI 735
            P      +  P    E +  CL  +P +R   + +L + F++    S  SI+++LI
Sbjct: 240 -PPRLEGRQYSPLLK-EFIALCLDEDPKERLAAEDLLKTRFIKTHKSSPTSILKELI 294

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 102/211 (48%), Gaps = 30/211 (14%)

Query: 517 LYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYL++E  D  +L   L  +G ++ +   VR++ K++++ ++  H   I H DLKP N +
Sbjct: 235 LYLVLEYVDGGELFDYLVSKGKLT-ELEAVRYF-KQIIRGVQYCHSFNICHRDLKPENLL 292

Query: 576 LVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNK 633
           L K   ++KI DFG+A        N   +T  G+P+Y +PE ++   Y            
Sbjct: 293 LDKKRKLIKIADFGMAAL---QVSNTLLKTSCGSPHYASPEIVMGKTYN----------- 338

Query: 634 WKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKS 693
              G PSD+WSCG I++ ++ G  P+     +  L+ + N   ++P          + K 
Sbjct: 339 ---GGPSDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMP--------NYLSKD 387

Query: 694 AIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
           A +L+   L  NP  R T +++L    +  +
Sbjct: 388 AKDLISRILLVNPKARLTTEQILEHPLITKY 418

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 114/231 (49%), Gaps = 38/231 (16%)

Query: 504 VIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L      +  LY ++E   + D   ++ + G  SLD    R+YA +++  I  +H  
Sbjct: 240 VVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG--SLDETCARYYAAQIIDAIDYLHSN 297

Query: 563 GIVHSDLKPANFVLVKGILKI--IDFGIA-------NAV--PEHTVNIYRETQIGTPNYM 611
           GI+H D+KP N +L+ G +KI   DFG A       N+V  PE+ ++   ++ +GT  Y+
Sbjct: 298 GIIHRDIKPEN-ILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYV 356

Query: 612 APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
           +PE L        ND+  D          D+W+ GCI++QMI GKPP   F+  N  L  
Sbjct: 357 SPELL--------NDSFTDYR-------CDIWAFGCILFQMIAGKPP---FKATNEYLTF 398

Query: 672 MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
               +K+ +    +     P    +L+K  L +N D+R T+ ++    F +
Sbjct: 399 QKV-MKVQY----AFTPGFPLIIRDLVKKILVKNLDRRLTISQIKEHHFFK 444

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 117/235 (49%), Gaps = 35/235 (14%)

Query: 504  VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
            V+Q    E+    + L ME C    L+Q+L + G +  D    + YA +ML+ +  +H +
Sbjct: 1310 VVQYYGVEVHRDKVNLFMEYCEGGSLAQLL-EHGRIE-DEMVTQIYALQMLEGLAYLHQS 1367

Query: 563  GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTV---NIYRE-------TQIGTPNYM 611
             +VH D+KP N +L   G++K +DFG A ++  +     N+  E       + +GTP YM
Sbjct: 1368 SVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYM 1427

Query: 612  APEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
            +PE++                K K G   D+WS GC++ +M+ G+ P+ +   +    AI
Sbjct: 1428 SPESITG------------AKKGKFGS-GDIWSLGCVILEMVTGRRPWFNLDNE---WAI 1471

Query: 672  MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMI 726
            M        P+  + +E  P+  I+ +  CL ++P+KR T  ++L    L P+MI
Sbjct: 1472 MYHVAAGHVPQLPTKEELSPQ-GIDFLLRCLKQDPNKRSTAMELL----LHPWMI 1521

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 114/224 (50%), Gaps = 37/224 (16%)

Query: 504  VIQLLDYEMGDGLLY----LIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            ++QLLD+   D   Y    L  E G  DL  ++  + NM+   +  R    +++  IK +
Sbjct: 1175 IMQLLDFFEDDDYYYIETPLHGETGCIDLFDLIEFKSNMTE--SEARLIFIQVVLGIKHL 1232

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD+ IVH D+K  N ++  KG +K+IDFG A  V     +++    +GT +Y APE L  
Sbjct: 1233 HDSNIVHRDVKDENVIVDAKGFVKLIDFGSAAYVNSGPFDVF----VGTIDYAAPEVLSG 1288

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
              Y              +G+P D+W+ G ++Y +++ + P+ +         I+  ++KI
Sbjct: 1289 EPY--------------LGKPQDIWAIGILLYTIMFKENPFYNID------EILEAELKI 1328

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                  +N     +  I+L+K  L +NP+KR T+D+++N  +L+
Sbjct: 1329 ------NNTSDASQDCIDLIKRILTKNPNKRPTIDEIVNDKWLK 1366

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 140/309 (45%), Gaps = 50/309 (16%)

Query: 444  QYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
            +++K + +G G    VY  V     +V A+K +     D  S++     I          
Sbjct: 1207 RWQKRKFVGGGTFGEVYSAVNLDTGEVLAVKEIKIQ--DSKSMEKIFPSIKEEMNVLEML 1264

Query: 503  R---VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKV 558
                ++Q    E+    + + ME C    L+ +L + G +  D    + Y  ++L+ +  
Sbjct: 1265 SHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLL-EHGRIE-DEMVTQVYTLQLLEGLAY 1322

Query: 559  VHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEH-TVNIYRETQ------------ 604
            +H++GIVH D+KP N +L   GI+K +DFG A  + ++ T  + RE              
Sbjct: 1323 LHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREMPDENDDENGKVVG 1382

Query: 605  -------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKP 657
                   IGTP YMAPEA+     T +    H G         D+W+ GC+V +MI GK 
Sbjct: 1383 RNNFNDIIGTPMYMAPEAI-----TGSPKKGHLG-------ADDIWALGCVVLEMITGKR 1430

Query: 658  PYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLN 717
            P+ +   +    AIM        P+  +NDE  P + +  +K CL +NP +R +  ++L 
Sbjct: 1431 PWANLDNE---WAIMYHVAAGQIPQLPTNDEVSP-AGMHFLKRCLKQNPAQRASAVELL- 1485

Query: 718  STFLQPFMI 726
               + P++I
Sbjct: 1486 ---MDPWII 1491

>Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 92.4 bits (228), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 99/234 (42%), Gaps = 60/234 (25%)

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  LL Y  G  L Y + E G              +LD   V FYA E+   ++ +H  
Sbjct: 227 KLYLLLQYIPGGELFYHLKEHG--------------TLDETTVSFYAAEISCALRFLHTK 272

Query: 563 GIVHSDLKPANFVLVK-GILKIIDFGI---------ANAVPEHTVNIYRETQIGTPNYMA 612
           G+V+ DLKP N +L + G L + DFG+         AN      VN      IGTP Y A
Sbjct: 273 GVVYRDLKPENCLLNQNGHLVLTDFGLSKKSADDSMANEEDPENVNTLHSI-IGTPEYCA 331

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI- 671
           PE L    YTQN                D +S GC++Y M+ GKPPY    G N  + I 
Sbjct: 332 PEILSGQAYTQN---------------CDWYSLGCLLYDMLVGKPPY---TGNNHKVIIN 373

Query: 672 ------MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNST 719
                   P  KIPF         + +   +++ A L +   KRW VDK    T
Sbjct: 374 KIQQNKQGP--KIPF--------YLSEGMKDMLNALLKKETSKRWNVDKYWAKT 417

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 110/224 (49%), Gaps = 37/224 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            +++LLD+   D   Y+      E G  DL  ++  + NMS     + F   +++  IK +
Sbjct: 1105 ILRLLDFFEDDDYYYIETPMHGETGCIDLFDLIEFKTNMSEVETKLIFM--QVVSSIKFL 1162

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  +G +K+IDFG A  V     +++    +GT +Y APE L  
Sbjct: 1163 HDQGIVHRDIKDENVIVDSQGFIKLIDFGSAAYVKSGPFDVF----VGTIDYAAPEVL-- 1216

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        G +  VG+P D+W+ G ++Y +I+ + P+ +         I+  ++K 
Sbjct: 1217 ------------GGEPYVGKPQDIWAIGILLYTIIFKENPFYNID------EILEAELKF 1258

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                    D       ++L+K  L RNP KR T+D++ N  +LQ
Sbjct: 1259 NTSTGACED------CVDLIKRILTRNPTKRPTIDEIYNDKWLQ 1296

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 143/311 (45%), Gaps = 43/311 (13%)

Query: 433  SNRNMITVNDSQ----------YEKIELLGRGGSSRVY-KVKGSGNKVYALKRVSFDAF- 480
            +++ M+++N S+          + K E++G+G    VY  +  +  ++ A+K+V    F 
Sbjct: 1102 TDKRMVSINKSKNSKGEYREFAWIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFG 1161

Query: 481  --DDSSIDGFKGEIXXXXXXXXXXR--VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQR 535
              D+++++  +  I             ++Q L +E  + +  L +E      +  ++   
Sbjct: 1162 SQDETTVNNAEALISEVSTLKDLDHLNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLY 1221

Query: 536  GNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPE 594
            G+   D   +RF   ++L+ +  +H  GI+H D+K  N +L   G+ KI DFGI+     
Sbjct: 1222 GH--FDEQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLLDNDGVCKISDFGIS----R 1275

Query: 595  HTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQ 651
             + NIY  +++   GT  +MAPE +   + TQ       G   KV    D+WS GC+V +
Sbjct: 1276 KSNNIYSNSEMTMRGTVFWMAPEMV---DTTQ-------GYSAKV----DIWSLGCVVLE 1321

Query: 652  MIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWT 711
            M  GK P+ + +    +  I       P PE T     I +     +  C   +P++R T
Sbjct: 1322 MFAGKRPWSNLEVVAAMFQIGKSKSAPPIPEDTL--PHISQDGRAFLDDCFMIDPEERPT 1379

Query: 712  VDKVLNSTFLQ 722
             D +L+  F Q
Sbjct: 1380 ADTLLSHPFCQ 1390

>Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W
           (REAL)
          Length = 719

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 157/367 (42%), Gaps = 54/367 (14%)

Query: 368 NANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPAR 427
           N +  D +      RL+R+  +    E      KN+ +  +  A K P     +I+EP R
Sbjct: 248 NGSKMDQVPTDTTPRLRRAASEPFNTE------KNELLHENYIALKQPPNLG-DIIEPKR 300

Query: 428 -----TATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKVYALKRVS-FDAF 480
                T + S+    ITV    +EKI LLG+G   +VY V+    N+++ALK +S  +  
Sbjct: 301 SHRLRTKSFSNKFQDITVEPRSFEKIRLLGQGDVGKVYLVRERDTNQIFALKVLSKHEMI 360

Query: 481 DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMS 539
               I     E            V     ++  D  LYL ME C   +  + L  R +  
Sbjct: 361 KRKKIKRVLTEQEILATSDHPFIVTLYHSFQTED-YLYLCMEYCMGGEFFRALQTRKSKC 419

Query: 540 LDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDF-----GIANAVP 593
           +     +FYA E++  ++ +H  G ++ DLKP N +L + G + + DF      I +  P
Sbjct: 420 IAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQAIGSKNP 479

Query: 594 EHTVNIYRETQI-----------GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDM 642
               + Y +T+I           GT  Y+APE +           R +G+   V    D 
Sbjct: 480 TMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI-----------RGNGHTAAV----DW 524

Query: 643 WSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACL 702
           W+ G +VY+M++G  P+           I+  D K P      + +++ K+  +L+K  L
Sbjct: 525 WTLGILVYEMLFGCTPFKGVNSNETFSNILAKDAKFP------HGKEVSKNCKDLIKKLL 578

Query: 703 YRNPDKR 709
            +N  KR
Sbjct: 579 NKNETKR 585

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 140/316 (44%), Gaps = 35/316 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ E    + + S  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1186 TRTVEVTEKQLVSINKSRNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQV 1245

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +        S+++  + E+           ++Q L +E  D +  L +E      +
Sbjct: 1246 EVPKYSSQDEAIISTVEALRSEVSTLKDLDHL-NIVQYLGFENKDNIYSLFLEYVAGGSV 1304

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D   +R    ++L+ +  +H  GI+H D+K  N +L + G+ KI DFG
Sbjct: 1305 GSLIRMYGR--FDEPLIRHLNTQVLRGLAYLHSRGILHRDMKADNLLLDQDGVCKISDFG 1362

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1363 IS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1404

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GCIV +M  GK P+ +++    +  I       P P  T     I ++  + + AC   
Sbjct: 1405 LGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTL--PLISQNGRDFLDACFEI 1462

Query: 705  NPDKRWTVDKVLNSTF 720
            +PD R T D +L+  F
Sbjct: 1463 DPDNRPTADNLLSHPF 1478

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/290 (28%), Positives = 134/290 (46%), Gaps = 23/290 (7%)

Query: 447 KIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVI 505
           K E++G+G  + V K V+    K +A+K +S       +IDG   E+          R++
Sbjct: 190 KDEVVGQGAFAIVKKAVERKTGKTFAVKIISKRKVM-GNIDGVTRELEVLRRLNHP-RIV 247

Query: 506 QLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGI 564
           +L  +   D   YL+ME     DL   +   G++  D    R   K++L+ +K +H  GI
Sbjct: 248 RLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITKQVLEAVKYIHGMGI 305

Query: 565 VHSDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
            H DLKP N ++ +    ++KI DFG+A      T   + +T  GT  Y+APE +   N 
Sbjct: 306 SHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGT---FMKTFCGTLAYVAPEVISGKNS 362

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY-GSFQGQNRLLAIMNPDVKIPF 680
              + N++     K     DMWS GC+VY ++ G  P+ GS Q Q     +     +  +
Sbjct: 363 EDKSQNKN-----KYSSLVDMWSIGCLVYVILTGHLPFSGSTQDQ-----LYKQISRGSY 412

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESI 730
            E    D +I   A   + + L  NP  R T +K L+  +++      SI
Sbjct: 413 HEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIKIGYTGSSI 462

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 146/317 (46%), Gaps = 44/317 (13%)

Query: 429  ATSSSNRNMITVNDS------QYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFD 481
            AT   N+ ++T+  S      +++K   +G G    VY  V      + A+K + F+  D
Sbjct: 1169 ATDKDNQYLLTLASSLSNVSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFN--D 1226

Query: 482  DSSIDGFKGEIXXXXXXXXXXR---VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGN 537
              +I      I              V+Q    E+    + + ME C    L+ +L   G 
Sbjct: 1227 RKTIKQVFPSIRDEMTVLEMLNHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLL-AHGR 1285

Query: 538  MSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHT 596
            +  D    + Y+ +ML+ +  +H++G+ H D+KP N +L   GI+K +DFG A  +  + 
Sbjct: 1286 IE-DEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNG 1344

Query: 597  ---VNIYR----ETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIV 649
               +N+ +    E  IGTP YM+PEA+    Y +   +             D+WS GC++
Sbjct: 1345 SKKLNLEQHMEGEKMIGTPMYMSPEAISGTGYGKFGSD-------------DIWSLGCVI 1391

Query: 650  YQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKR 709
             +M+ G+ P+ +   Q    AI+        P   S +E + ++ I+ +  CL ++P++R
Sbjct: 1392 LEMVTGRRPWANLDNQ---WAIIYQVAAGQIPMFPSKNE-MSQAGIKFLSRCLIQDPNQR 1447

Query: 710  WTVDKVLNSTFLQPFMI 726
             T  ++L    + P++I
Sbjct: 1448 STAVELL----MDPWII 1460

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 112/230 (48%), Gaps = 36/230 (15%)

Query: 504 VIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           +++L      +  LY ++E   + D   ++ + G++S D    R+Y+ +++  IK +H  
Sbjct: 243 IVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDC--TRYYSAQIIDGIKYLHSK 300

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAV---------PEHTVNIYRETQIGTPNYMA 612
           GI+H D+KP N +L K + +KI DFG A  +         PE  +    ++ +GT  Y++
Sbjct: 301 GIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVS 360

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L        ND+  D          D+W+ GC+V+QMI GKPP   F+  N  L   
Sbjct: 361 PELL--------NDSYVDAR-------CDIWAFGCMVFQMIAGKPP---FKATNEYLTFQ 402

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
              +K+ +    +     P    +L+K  L + P++R T+ ++    F +
Sbjct: 403 KV-MKVQY----AFTAGFPVVVRDLVKRILLKVPEQRLTIPQIEKHHFYK 447

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 128/281 (45%), Gaps = 30/281 (10%)

Query: 445 YEKIELLGRGGSSRVYKV--KGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           YE  E +G+G    VYK   K +GN V A+K V+ +  DD  ID    EI          
Sbjct: 34  YEVQECVGKGNFGDVYKAIDKSTGNTV-AIKVVNLEETDDE-IDLLAQEIYFLAELHSPY 91

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            +       + D  ++++ME CG    S +L      +L    V F  +E+L+ ++ +H 
Sbjct: 92  -ITNYFSTFVEDVSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHS 150

Query: 562 AGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
              +H D+K AN +L   G +K+ DFG++    +      R+T +GTP +MAPE +    
Sbjct: 151 QRKIHRDIKAANILLTDDGKVKLGDFGVSG---QMMATRRRDTFVGTPFWMAPEVIARSE 207

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
              N               +D+WS G  V++++ G+PP         L++I  P  + P 
Sbjct: 208 QGYNEK-------------ADIWSLGITVFELLKGQPPLSQHDPMKVLMSI--PSRRPPK 252

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
            E     ++   +  E +  CL ++P KR T  ++L   F+
Sbjct: 253 LE-----DRYSHAIREFVSLCLNKDPAKRPTASELLKHRFI 288

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 103/225 (45%), Gaps = 35/225 (15%)

Query: 517 LYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LY ++E   H DL  +L + G++S        YA ++L  I  +H  G++H D+KP N +
Sbjct: 219 LYFVLEYAPHGDLLALLRRHGSLSRAVTC--HYAAQLLSAIGALHSVGVIHRDIKPENVL 276

Query: 576 LVKGI-LKIIDFGIANAVPEHTVNIYRETQ------IGTPNYMAPEALVAMNYTQNNDNR 628
           L      K+ DFG A  +P+   N+ + ++      +GT  Y+ PE L A          
Sbjct: 277 LDSHYRAKLTDFGTAALLPQTHSNLEQVSRHVTTSFVGTAEYVPPELLAA--------GH 328

Query: 629 HDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNP-DVKIPFPEHTSND 687
            DG         D+W+  C+V+Q+I G+PP   FQ +N  L   N   V+  +P    +D
Sbjct: 329 ADGT-------CDLWAWACVVFQLIAGRPP---FQARNEFLTFQNVMAVRYTYPPGFPSD 378

Query: 688 EKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIME 732
            K      +L++  L   P +R    ++    F      SE++ +
Sbjct: 379 LK------DLLRRVLRHEPRQRLLQPQITQHQFFAHTDFSEALWD 417

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 140/314 (44%), Gaps = 47/314 (14%)

Query: 421 EIVEP-----ARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKVYALKR 474
           +IVEP      RT +  +    ITV    +EKI LLG+G   +VY V+    N+++ALK 
Sbjct: 295 DIVEPRRSRRLRTKSFGNKFQDITVEPQSFEKIRLLGQGDVGKVYLVRERDTNQIFALKV 354

Query: 475 VS-FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQIL 532
           ++  +      I     E            V     ++  D  LYL ME C   +  + L
Sbjct: 355 LNKHEMIKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKD-YLYLCMEYCMGGEFFRAL 413

Query: 533 NQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIA-- 589
             R +  +     +FYA E++  ++ +H  G ++ DLKP N +L + G + + DF ++  
Sbjct: 414 QTRKSKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQ 473

Query: 590 ---NAVPEHTVNIYRETQI-----------GTPNYMAPEALVAMNYTQNNDNRHDGNKWK 635
              +  P    + Y +T+I           GT  Y+APE +           R +G+   
Sbjct: 474 ATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI-----------RGNGHTAA 522

Query: 636 VGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAI 695
           V    D W+ G ++Y+M++G  P+           I+  DVK P      +D+++ K+  
Sbjct: 523 V----DWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFP------HDKEVSKNCK 572

Query: 696 ELMKACLYRNPDKR 709
           +L+K  L +N  KR
Sbjct: 573 DLIKKLLNKNEAKR 586

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 112/225 (49%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D       LY+++E  +  +L  +L QRG +  +   VRF+ ++++  I   H  
Sbjct: 90  VLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP-ENEAVRFF-RQIIIGISYCHAL 147

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +K+ DFG+A      + +   ET  G+P+Y APE +  + Y
Sbjct: 148 GIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLPY 204

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  SD+WSCG I+Y ++ G+ P+    G  +N LL + +   +IP
Sbjct: 205 H--------------GFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIP 250

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                  +++I   A +L+   L   P++R    ++L    LQ +
Sbjct: 251 ------GEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKY 289

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 115/223 (51%), Gaps = 37/223 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            +++LLD+   D   Y+      E G  DL  ++  + NM+ +F   +   K+++  IK +
Sbjct: 1164 ILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMT-EFE-AKLIFKQVVAGIKHL 1221

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  KG +KIIDFG A  V     +++    +GT +Y APE L  
Sbjct: 1222 HDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPEVL-- 1275

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        GN ++ G+P D+W+ G ++Y +++ + P+ +         I+  D+K 
Sbjct: 1276 -----------GGNPYE-GQPQDIWAIGILLYTVVFKENPFYNID------EILEGDLKF 1317

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
                  +N E++ +  IEL+K+ L R   KR T+D + N  +L
Sbjct: 1318 ------NNAEEVSEDCIELIKSILNRCVPKRPTIDDINNDKWL 1354

>Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 147/325 (45%), Gaps = 68/325 (20%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRV---SFDAFDDSSIDGFKGEIXXXXX 497
           SQY+ ++L+G G    V     K SG KV A+K++   S   F   +I     EI     
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTI----REIKLLRY 65

Query: 498 XXXXXRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQR--GNMSLDFNFVRFYAK 550
                 +I +LD      +     +YL+ E  + DL +++N +  G+ +L  + V+++  
Sbjct: 66  FHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGSSTLSDDHVQYFTY 125

Query: 551 EMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG--- 606
           ++L+ +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G   
Sbjct: 126 QILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMT 183

Query: 607 ----TPNYMAPEALVAMN-YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY-- 659
               T  Y APE ++    YT                  D+WSCGCI+ +MI GKP +  
Sbjct: 184 EYVATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMISGKPLFPG 228

Query: 660 ----------------GSFQGQNRLLA------IMNPDVKIPFP-EHTSNDEKIPKSAIE 696
                            SF+  N++ +      I N  ++ P P E   +   +    I+
Sbjct: 229 RDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVCSKTGLNPDMID 288

Query: 697 LMKACLYRNPDKRWTVDKVLNSTFL 721
           L+   L  NPDKR +  + L   +L
Sbjct: 289 LLNKMLQFNPDKRISAAEALRHPYL 313

>KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {ON}
           
          Length = 508

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 145/324 (44%), Gaps = 65/324 (20%)

Query: 427 RTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGS-GNKVYALKRVS--------- 476
            T+   ++RN+       ++ + +LG+G   +V  VK    NK++A+K++          
Sbjct: 114 HTSGDPNSRNL-----QDFQPVRVLGKGAYGKVILVKDQKSNKLFAMKQLKKAEILINEQ 168

Query: 477 -------FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGD-GLLYLIME-CGDHD 527
                   D  D+ +I+    E            +++L  Y   D   LYLI++     +
Sbjct: 169 EIKDDAKEDKPDNKNIERTFAE-KTILSELEHPNIVKLF-YSFHDVSKLYLILQYVPGGE 226

Query: 528 LSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDF 586
           L   L + G  +LD + V FYA E+   +K +HD GIV+ DLKP N +L  +G L + DF
Sbjct: 227 LFFHLKEHG--TLDEDTVSFYAAEISCALKFLHDKGIVYRDLKPENCLLNDRGHLVLTDF 284

Query: 587 GIA------NAVPEHTVNIYR-ETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRP 639
           G++      N +     +++   + IGTP Y APE L  + Y +N               
Sbjct: 285 GLSKKSLEDNDMSNQVDDVFTLHSIIGTPEYAAPEILQGLPYNKN--------------- 329

Query: 640 SDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMK 699
            D +S GC+++ M+ GKPPY    G N  + I     KI   +   N  KIP    E MK
Sbjct: 330 CDWYSLGCLLFDMLVGKPPY---TGTNHKVIIN----KI---QKDKNGPKIPYYLSEGMK 379

Query: 700 ----ACLYRNPDKRWTVDKVLNST 719
                 L ++  KRW VDK    T
Sbjct: 380 DMLNWLLKKDKLKRWQVDKYWAET 403

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 91/381 (23%), Positives = 169/381 (44%), Gaps = 60/381 (15%)

Query: 395  NEDVNVKNQEVFYHRPAPKPPVTKKVEIVEPARTATSSSNRNMITVNDS-----QYE--- 446
            +E    + Q V   R   K   TK VE+ +          + M+++N++     QY+   
Sbjct: 1074 HEASEARKQSVKLGRQNTKMWGTKTVEVTD----------KRMVSINNTKNSRGQYKEFA 1123

Query: 447  --KIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDS------SIDGFKGEIXXXXX 497
              K E++G+G    VY  +  +  ++ A+K+V    +         +++  + E+     
Sbjct: 1124 WIKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKN 1183

Query: 498  XXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCI 556
                  ++Q L +E  D +  L +E      +  ++   G    D   ++    ++L+ +
Sbjct: 1184 LDHLN-IVQYLGFEAKDHMNSLFLEYVAGGSVGSLIRMYGR--FDEVMIKHLTTQVLRGL 1240

Query: 557  KVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMA 612
              +H  GI+H D+K  N +L  +G+ KI DFGI+      + +IY  +++   GT  +MA
Sbjct: 1241 SYLHSRGILHRDMKADNLLLDQEGVCKISDFGIS----RKSKDIYSNSEMTMRGTVFWMA 1296

Query: 613  PEAL-VAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAI 671
            PE +  A  Y+            KV    D+WS GC+V +M  GK P+ + +    +  I
Sbjct: 1297 PEMVDTAQGYSA-----------KV----DIWSMGCVVLEMFAGKRPWSNLEVVAAMFKI 1341

Query: 672  MNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL---QPFMISE 728
                   P PE T     I +S  + + AC   +P+ R T DK L+  F+   + F    
Sbjct: 1342 GKSKSAPPIPEDTL--PLISQSGRDFIDACFQIDPEARPTADKQLSHPFILEKENFDFKS 1399

Query: 729  SIMEDLIRNAVRYGSEKPQIS 749
            + + +LI++  +  S K ++S
Sbjct: 1400 TKLAELIKSNDKVNSTKLRVS 1420

>Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {ON}
           complement(45186..47825) [2640 nt, 880 aa]
          Length = 879

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 136/314 (43%), Gaps = 50/314 (15%)

Query: 424 EPART----ATSSSNRNM-ITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVS- 476
           EP R+    A S SN+   I V+ + +EKI LLG+G   +VY VK    N++YALK  S 
Sbjct: 455 EPKRSQRLRAKSFSNKFQDIIVSPNSFEKIRLLGQGDVGKVYLVKEKKSNRLYALKIFSK 514

Query: 477 FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQR 535
            +      I     E            ++ L      +  LYL ME C   +  + L  R
Sbjct: 515 AEMIKRKKIKRILAE-QEILATSDHPFIVNLYHSFQSEDYLYLCMEYCMGGEFFRALQTR 573

Query: 536 GNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGI---ANA 591
               +  +  RFYA E++  ++ +H  G ++ DLKP N +L K G + + DF +   A  
Sbjct: 574 KTKCISEDDSRFYASEVVAALEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSIQAKD 633

Query: 592 VPEHTVNIYRETQ----------------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWK 635
             +  V  + ++                 +GT  Y+APE +           R +G+   
Sbjct: 634 AKDPVVKKFAQSTVVDTKVCSDGFRTNSFVGTEEYIAPEVI-----------RGNGHTAA 682

Query: 636 VGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAI 695
           V    D W+ G ++Y+M++G  P+           ++  DV  P      N+ +I ++  
Sbjct: 683 V----DWWTLGILIYEMLFGFTPFKGDNTNETFCNVLKNDVNFP------NNNEISRTCK 732

Query: 696 ELMKACLYRNPDKR 709
           +L+K  L +N  KR
Sbjct: 733 DLIKKLLAKNEAKR 746

>AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR028C
          Length = 536

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 90/307 (29%), Positives = 135/307 (43%), Gaps = 62/307 (20%)

Query: 445 YEKIELLGRGGSSRVYKVKGS-GNKVYALKR-----VSFDAFDDSSIDGFKGEIXXXXXX 498
           ++ + +LGRG   +V  VK    +K++A+K+     +   A ++ S DG    +      
Sbjct: 146 FKPVRVLGRGAYGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGEDAVLLPAVVE 205

Query: 499 XXXXRVI-------QL-------LDYEMGDGL-LYLIME-CGDHDLSQILNQRGNMSLDF 542
               R         QL       L Y   D   LYL+++     +L   L ++G  +LD 
Sbjct: 206 KRVERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQG--TLDE 263

Query: 543 NFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN---------AV 592
             V FYA E+   +K +H  GIV+ DLKP N +L  KG L + DFG++            
Sbjct: 264 VTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLG 323

Query: 593 PEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQM 652
            E    +Y  + IGTP Y APE L    YTQN                D +S G + Y M
Sbjct: 324 GEQVEELY--SIIGTPEYCAPEILCGQPYTQN---------------CDWYSLGSLTYDM 366

Query: 653 IYGKPPYGSFQGQNR--LLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRW 710
           + GKPP   F G N   +L+ +  D  I  P + S+  K      + + A L ++  KRW
Sbjct: 367 LIGKPP---FTGANHKVILSKIKQDKGIKIPHYLSDGMK------DYLNALLKKDIGKRW 417

Query: 711 TVDKVLN 717
            VD+  +
Sbjct: 418 DVDRFWD 424

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 140/312 (44%), Gaps = 40/312 (12%)

Query: 426 ARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAFDDSSI 485
           A T T ++ ++  T+   +  +   +G  G  R+ + +G+ +K  A+K +S   F+    
Sbjct: 4   ANTETQTAAKSSSTIGPWKLGETLGVGSAGKVRLAQHEGTAHKT-AVKIISKSIFNTEGN 62

Query: 486 DGFKGEIXXXXXXXXXXRVIQLLDYEMGDGL---------LYLIMECGDH-DLSQILNQR 535
            G  G +           +++LL +    GL         LYLI+E  +  +L  +L  R
Sbjct: 63  YGNHGSVLPYNIEREIV-IMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDR 121

Query: 536 GNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPE 594
           G +        F  ++++  +   H  GIVH DLKP N +L     +K+ DFG+A     
Sbjct: 122 GALPEREAMKCF--RQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAAL--- 176

Query: 595 HTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIY 654
            T     ET  G+P+Y APE +  + Y               G  SD+WSCG I++ ++ 
Sbjct: 177 QTDAALLETSCGSPHYAAPEIVSGLPYE--------------GFSSDVWSCGVILFALLT 222

Query: 655 GKPPYGSFQGQNR--LLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTV 712
           G+ P+    G  R  LL +     ++P      +D +I K A +L+   L  +P +R  +
Sbjct: 223 GRLPFDEENGNIRTLLLKVQRGQFEMP------DDTEISKDAQDLISKILVVDPAQRIKI 276

Query: 713 DKVLNSTFLQPF 724
             +L+   L+ +
Sbjct: 277 RDILSHPLLKRY 288

>NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6.371
          Length = 886

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 132/305 (43%), Gaps = 43/305 (14%)

Query: 427 RTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVS-FDAFDDSS 484
           RT + S+    ITV+   +EKI+LLGRG   +VY VK  + N++YALK  S  +      
Sbjct: 459 RTKSFSNKFKDITVSPQSFEKIKLLGRGDVGKVYLVKEKNTNRLYALKIFSKAEMIKRKK 518

Query: 485 IDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNF 544
           I     E            V     ++  D + + +  C   +  + L  R    +    
Sbjct: 519 IKRVLAEQEILATSNHPFIVTLYHSFQTEDYVYFCMEYCMGGEFFRALQTRKTKCICEED 578

Query: 545 VRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYR-- 601
            +FYA E+   ++ +H  G ++ DLKP N +L K G + + DF ++    +  + + +  
Sbjct: 579 AKFYASEVTAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKIPVMKGM 638

Query: 602 ------ETQI-----------GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
                 +T+I           GT  Y+APE +           R +G+   V    D W+
Sbjct: 639 DESTIIDTKIVSDGFRTNSFVGTEEYIAPEVI-----------RGNGHTAAV----DWWT 683

Query: 645 CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
            G ++Y+M++G  P+           I+  DV  P      N+  I ++  +L+K  L +
Sbjct: 684 LGILIYEMLFGMTPFKGSNSNETFSNILKNDVSFP------NNNDISRNCKDLIKKLLCK 737

Query: 705 NPDKR 709
           N +KR
Sbjct: 738 NENKR 742

>Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {ON}
            YCR073C (REAL)
          Length = 1334

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 121/265 (45%), Gaps = 48/265 (18%)

Query: 504  VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
            V+Q    E+    + + ME C    L+ +L+ RG +  D    + Y  E+L+ +  +H +
Sbjct: 1095 VVQYYGVEVHRDKVNIFMEYCEGGSLASLLD-RGRIE-DEMVTQVYTLELLEGLVYLHKS 1152

Query: 563  GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET-----------------Q 604
            G+VH D+KP N +L   GI+K +DFG A  V E +    ++                   
Sbjct: 1153 GVVHRDIKPENILLDFNGIIKYVDFGTARTVVESSTRALQKAATGDLQEAEPETKPVNCM 1212

Query: 605  IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG 664
            +GTP YMAPEA+                K K+G   D+W+ GC+V +M  G+ P+ +   
Sbjct: 1213 MGTPMYMAPEAISGSTV-----------KGKLG-ADDVWALGCVVLEMATGRRPWSNLDN 1260

Query: 665  QNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
            +    AIM        P+  S DE  P +    ++ CL ++P  R T  ++L    + P+
Sbjct: 1261 E---WAIMYHVAAGHVPQLPSTDEMTP-AGRAFLERCLVQDPSMRATATELL----VDPW 1312

Query: 725  MISESIMEDLIRNAVRYGSEKPQIS 749
            M+        IR     GS+K +IS
Sbjct: 1313 MMH-------IREIAFGGSDKDKIS 1330

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 145/318 (45%), Gaps = 35/318 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ +    + + S  +     +  + K E++G+G    V+  +  +  ++ A+K+V
Sbjct: 1154 TRTVEVTDKRLVSINKSKNSKGEYKEFAWIKGEMIGKGSFGAVFLCLNVTTGEMMAVKQV 1213

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +        S+++  + E+           ++Q L +E+ D +  L +E      +
Sbjct: 1214 EVPRYGSQNEAIISTVEALRAEVSTLKDLDHL-NIVQYLGFEVKDSIYSLFLEYVAGGSV 1272

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D   ++    ++L+ +  +H  GI+H D+K  N +L + G+ KI DFG
Sbjct: 1273 GSLIRMYGK--FDEKLIKHLTIQVLRGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFG 1330

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  +++   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1331 IS----RKSKDIYSNSEMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1372

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M  GK P+ + +    +  I       P P+ T     I +S  + +  C   
Sbjct: 1373 LGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPDDTL--PLISQSGRDFLDQCFKI 1430

Query: 705  NPDKRWTVDKVLNSTFLQ 722
            +P++R T DK+L+  FL+
Sbjct: 1431 DPEERPTADKLLSHQFLK 1448

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 113/223 (50%), Gaps = 37/223 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            +++LLD+   D   Y+      E G  DL  ++  + NM+      +   K+++  IK +
Sbjct: 1168 ILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTE--CEAKLIVKQVVAGIKHL 1225

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  KG +KIIDFG A  V     +++    +GT +Y APE L  
Sbjct: 1226 HDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPEVL-- 1279

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        GN ++ G+P D+W+ G ++Y +++ + P+ +         I+  D+K 
Sbjct: 1280 -----------GGNPYE-GKPQDIWAIGILLYTVVFKENPFYNID------EILEGDLKF 1321

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
                  +N E++ +  IEL+K+ L R   KR T+D + N  +L
Sbjct: 1322 ------NNAEEVSEDCIELIKSILNRCVPKRPTIDDINNGKWL 1358

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 113/225 (50%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D       LY+++E  +  +L  +L +RG +  +   VRF+ ++++  I   H  
Sbjct: 88  VLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLP-ENEAVRFF-RQIIIGISYCHAL 145

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +K+ DFG+A      + +   ET  G+P+Y APE +  + Y
Sbjct: 146 GIVHRDLKPENLLLDHKFNVKLADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLPY 202

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  SD+WSCG I+Y ++ G+ P+    G  +N LL + +   ++P
Sbjct: 203 H--------------GFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMP 248

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                  D++I   A +L+   L  +P++R    ++L    L+ +
Sbjct: 249 ------GDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKY 287

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 114/223 (51%), Gaps = 37/223 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            +++LLD+   D   Y+      E G  DL  ++  + NM+ +F   +   K+++  IK +
Sbjct: 1165 ILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMT-EFE-AKLIFKQVVAGIKHL 1222

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  KG +KIIDFG A  V     +++    +GT +Y APE L  
Sbjct: 1223 HDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPEVL-- 1276

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        GN ++ G+P D+W+ G ++Y +++ + P+ +         I+  D+K 
Sbjct: 1277 -----------GGNPYE-GQPQDIWAIGILLYTVVFKENPFYNID------EILEGDLKF 1318

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
                  +N E + +  IEL+K+ L R   KR T+D + N  +L
Sbjct: 1319 ------NNAEGVSEDCIELIKSILNRCVPKRPTIDDINNDKWL 1355

>CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {ON}
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047w or uniprot|P25341 Saccharomyces cerevisiae
           YCR091w KIN82
          Length = 895

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 140/321 (43%), Gaps = 50/321 (15%)

Query: 417 TKKVEIVEPARTA----TSSSNRNM-ITVNDSQYEKIELLGRGGSSRVYKVKGS-GNKVY 470
           TK  EI EP R++     S SN+   ITV    +EKI LLG+G   +VY VK    N++Y
Sbjct: 464 TKLEEIKEPRRSSRLRNKSFSNKFQDITVGPQSFEKIRLLGQGDVGKVYLVKEKRTNRLY 523

Query: 471 ALKRVS-FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
           ALK  S  +      I     E            V+ L      +  LYL ME C   + 
Sbjct: 524 ALKIFSKSEMIKRKKIKRILAE-QEILATSNHPFVVTLYHSFQSEDYLYLCMEYCMGGEF 582

Query: 529 SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
            + L  R +  +     +FYA E+   ++ +H  G ++ DLKP N +L + G + + DF 
Sbjct: 583 FRALQTRKSKCISEEDAKFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFD 642

Query: 588 IANAVPEHTVNIYR--------ETQI-----------GTPNYMAPEALVAMNYTQNNDNR 628
           ++    +  V + +        +T+I           GT  Y+APE +           R
Sbjct: 643 LSIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI-----------R 691

Query: 629 HDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDE 688
            +G+   V    D W+ G ++Y+M++G  P+           I+  DV  P      N+ 
Sbjct: 692 GNGHTAAV----DWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFP------NNN 741

Query: 689 KIPKSAIELMKACLYRNPDKR 709
           ++ ++  +L+K  L +N  KR
Sbjct: 742 EVSRNCKDLIKKLLIKNESKR 762

>Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {ON}
           similar to Ashbya gossypii AEL083W
          Length = 537

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 137/307 (44%), Gaps = 62/307 (20%)

Query: 445 YEKIELLGRGGSSRVYKVKGS-GNKVYA---LKRVSFDAFDDSSIDGFKGE-------IX 493
           ++ I +LG+G   +V  VK    NK+YA   LK+          ID +  E       I 
Sbjct: 146 FKPIRVLGKGAYGKVLLVKDQLTNKLYAIKQLKKAEILITQQEGIDEYADEDNTINTTIK 205

Query: 494 XXXXXXXXXRVI--QL-------LDYEMGDG-LLYLIME-CGDHDLSQILNQRGNMSLDF 542
                    R I  QL       L Y   D   LYL+++     +L   L ++G  +LD 
Sbjct: 206 KRVERTFAERSILSQLEHPNIVKLFYSFHDHHRLYLLLQYIPGGELFYHLKEQG--TLDE 263

Query: 543 NFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV---PEHTVN 598
             V FYA E+   +K +H  GIV+ DLKP N +L  +G L + DFG++      P++ ++
Sbjct: 264 TTVAFYAAELSCALKFLHGKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVHQPDYPIS 323

Query: 599 ------IYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQM 652
                 +Y  + IGTP Y APE L  + YTQN                D +S G + Y M
Sbjct: 324 GESVNELY--SIIGTPEYCAPEILEGLPYTQN---------------CDWYSLGSLAYDM 366

Query: 653 IYGKPPYGSFQGQNR--LLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRW 710
           + GKPP   F G N   +L+ +  +  +  P + S+  K      + + A L ++  KRW
Sbjct: 367 LIGKPP---FTGINHKVILSKIQREKSVKLPSYLSDGMK------DYLNALLKKDTLKRW 417

Query: 711 TVDKVLN 717
            VD   N
Sbjct: 418 DVDIFWN 424

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 137/282 (48%), Gaps = 23/282 (8%)

Query: 447 KIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVI 505
           K E++G+G  + V K V+ S  K +A+K ++       ++DG   E+          R++
Sbjct: 195 KDEVVGQGAFAIVKKAVERSTGKTFAVKIINKRKVM-GNMDGVTRELDVLRKLDHP-RIV 252

Query: 506 QLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGI 564
           +L  +   +   YL+ME     DL   +   G++  D    R   +++L+ +K +H  GI
Sbjct: 253 RLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVKYIHLQGI 310

Query: 565 VHSDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
            H DLKP N ++ +    ++KI DFG+A      T   + +T  GT  Y+APE +   N 
Sbjct: 311 SHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPEVIGGKNS 367

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY-GSFQGQNRLLAIMNPDVKIPF 680
            + N++R + +        DMWS GC+VY ++ G  P+ GS Q Q     +     +  +
Sbjct: 368 AEENEDRIEYSSL-----VDMWSIGCLVYVILTGHLPFSGSTQDQ-----LYKQICRGSY 417

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
            E    D +I   A + + + L  +P+KR T  K LN  +++
Sbjct: 418 HEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 452

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 146/333 (43%), Gaps = 61/333 (18%)

Query: 413 KPPVTKKVEIVEPARTATSSSNRNMITVNDSQ-----------YEKIELLGRGGSSRVYK 461
           K  V +K  +V P       S R  ++V + Q           ++ + +LG+G   +V  
Sbjct: 41  KSSVLEKFPVVAPLH-----SRRLSLSVGEGQGQGVDPRLLADFKPVRVLGKGAYGKVVL 95

Query: 462 VKGS-GNKVYALKRVSFDAF---DDSSIDGFKGEIXXXXXXXXXXR-----VIQLLDYEM 512
           VK    +K+YA+K++        +D S D  K             +     V++L     
Sbjct: 96  VKDERTSKLYAMKQLQKAEIIIENDESQDVSKRVERIFAERTILSQLDHPNVVKLFYTFH 155

Query: 513 GDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKP 571
            +  LYL+++     +L   L +RG  +LD +   FYA E+   +K +H+ GIV+ DLKP
Sbjct: 156 DNSRLYLLLQYIPGGELFYHLKERG--TLDEDTAAFYAAEISCALKFLHEKGIVYRDLKP 213

Query: 572 ANFVL-VKGILKIIDFGIAN---------AVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
            N +L   G L + DFG++          + PE    ++  + IGTP Y APE L    Y
Sbjct: 214 ENCLLDADGHLVLTDFGLSKKSVDDNNSLSAPEDVSVLH--SIIGTPEYCAPEILKGEPY 271

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFP 681
           T+N                D +S GC+VY M+ GKPPY     +  L  I         P
Sbjct: 272 TRN---------------CDWYSLGCLVYDMLVGKPPYTGVNHKVILNKIQKEKQGPRLP 316

Query: 682 EHTSNDEKIPKSAIELMKACLYRNPDKRWTVDK 714
            + S+  K      + + A L ++ +KRW VD+
Sbjct: 317 YYLSDGMK------DWLGALLKKDCNKRWDVDR 343

>YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/Thr
           protein kinase that regulates the putative phospholipid
           translocases Lem3p-Dnf1p/Dnf2p; phosphorylates and
           inhibits upstream inhibitory kinase, Ypk1p; localizes to
           the cytoplasm, early endosome/TGN compartments, and
           plasma membrane
          Length = 893

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 146/354 (41%), Gaps = 52/354 (14%)

Query: 412 PKPPVTKKVEIVEP-----ARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVK-GS 465
           P+ P  K  +  EP      RT + S+    I V    +EKI LLG+G   +V+ V+   
Sbjct: 458 PQEPSPKISDFPEPRRSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKK 517

Query: 466 GNKVYALKRVSFDAF-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-C 523
            N+VYALK +S D     + I     E            ++ L      +  LYL ME C
Sbjct: 518 TNRVYALKVLSKDEMIKRNKIKRVLTE-QEILATSNHPFIVTLYHSFQSEDYLYLCMEYC 576

Query: 524 GDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILK 582
              +  + L  R    +  +  RFYA E+   ++ +H  G ++ DLKP N +L + G + 
Sbjct: 577 MGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIM 636

Query: 583 IIDFGIANAVPEHTVNIYRETQ-------------------IGTPNYMAPEALVAMNYTQ 623
           + DF ++    +  V + + +                    +GT  Y+APE +       
Sbjct: 637 LSDFDLSIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVI------- 689

Query: 624 NNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEH 683
               R +G+   V    D W+ G ++Y+M++G  P+           I+  +V  P    
Sbjct: 690 ----RGNGHTAAV----DWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFP---- 737

Query: 684 TSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRN 737
             N+ +I ++  +L+K  L +N  KR             PF   + +   L+RN
Sbjct: 738 --NNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFF--KKVQWSLLRN 787

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 139/300 (46%), Gaps = 40/300 (13%)

Query: 445 YEKIELLGRGGSSRVYKVKG-SGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           Y++ +++G+G    VYK       KV+A+K ++ D  D + I   + EI           
Sbjct: 6   YKRTKVIGKGKFGTVYKGHSIKSKKVFAIKVLNLDC-DINEIQDIQNEIKFLSLLRYAPN 64

Query: 504 VIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFN--FVRFYAKEMLQCIKVVHD 561
           +       + +  +++IME  +    + L + G     FN  ++    +E+L  ++ +H 
Sbjct: 65  ITYYYHSYLINRKIWIIMEYCNGGSVRNLIKIGR----FNEIYISVILRELLYALEYIHH 120

Query: 562 AGIVHSDLKPANFVLVK-GILKIIDFGIANAV----PEHTVNIYRETQIGTPNYMAPEAL 616
             I+H D+K AN ++ + G +K+ DFGIA  +    P+      R+T  GTP +MAPE +
Sbjct: 121 DNIIHRDIKAANILINQNGGIKLCDFGIAAKLEFSKPK------RQTMAGTPYWMAPEVI 174

Query: 617 VAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDV 676
           +         + +D         +D+WS G   Y++  G PPY  +     +  I    +
Sbjct: 175 IE-------SSLYDTK-------ADIWSVGITAYEITTGNPPYCEYDATKAMQLIT--KL 218

Query: 677 KIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISES-IMEDLI 735
           K P  E     +   KS  E +  CL  +P +R T  K+L + F++ +  + + I+ DLI
Sbjct: 219 KPPRLE----GKMYSKSLKEFIALCLDEDPSERLTSTKLLETEFIKEYQETPTKILIDLI 274

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 108/225 (48%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V+ L D    D  LYLI+E  +  +L  +L  RG +  +   ++ + K+++  I   H  
Sbjct: 89  VLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLP-EREAIKCF-KQIIIAISYCHAL 146

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L     +KI DFG+A      T     ET  G+P+Y APE +  + Y
Sbjct: 147 GIVHRDLKPENLLLDNSYNIKIADFGMAAL---QTDAGMLETSCGSPHYAAPEIVSGLPY 203

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR--LLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  R  LL +     ++P
Sbjct: 204 E--------------GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 N+ +I   A +L++  L  +P +R  +  +L+   L+ +
Sbjct: 250 ------NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288

>KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3.92
           YDR490C
          Length = 1095

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 147/347 (42%), Gaps = 76/347 (21%)

Query: 439 TVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYAL--KRVSFDAFDDSSIDGFKGEIXXXX 496
           T+ D  Y  + L     S R Y VK   NK Y +  K+V +   + +++           
Sbjct: 152 TIGDGAYSTVVLATSKDSGRKYAVK-MLNKEYLIRQKKVKYVNIEKNALQ---------- 200

Query: 497 XXXXXXRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQC 555
                  V++L      +  LY ++E   + D   ++ + G  SL+ +  ++Y+ +++  
Sbjct: 201 RVNDSPMVVRLFFTFQDEASLYFLLEFAPNGDFLSLMKKFG--SLNEDAAKYYSAQIIDA 258

Query: 556 IKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAV------------PEHTVNIYRE 602
           I  +H  GIVH D+KP N +L K   +KI DFG A  +            PE+ +    +
Sbjct: 259 IGFLHSRGIVHRDMKPENILLDKNWKIKITDFGTAKILEKTAQQEAGGSGPEYNLLTRSK 318

Query: 603 TQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSF 662
           + +GT  Y++PE L        ND+  D          D+W+ GCIVYQM+ GKPP   F
Sbjct: 319 SFVGTAEYVSPELL--------NDSFVDYR-------CDIWAFGCIVYQMLAGKPP---F 360

Query: 663 QGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF-- 720
           +  N  L      +K+ +    +     P    +L+K  L ++ DKR TV ++    F  
Sbjct: 361 KATNEYLTFQK-VMKVQY----AFTAGFPLVIRDLVKRILVKDLDKRLTVQQIQRHHFFK 415

Query: 721 ----------------LQPFMISESIME------DLIRNAVRYGSEK 745
                           L PF I+   M+      D+ +    YG+ K
Sbjct: 416 GVNFKDGSVWSARVPELSPFKINAKSMQPVAALKDIYKKPTHYGAPK 462

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 114/223 (51%), Gaps = 37/223 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            +++LLD+   D   Y+      E G  DL  ++  + NM+ +F   +   K+++  IK +
Sbjct: 1164 ILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMT-EFE-AKLIFKQVVAGIKHL 1221

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  KG +KIIDFG A  V     +++    +GT +Y APE L  
Sbjct: 1222 HDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPEVL-- 1275

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        GN ++ G+P D+W+ G ++Y +++ + P+ +         I+  D+K 
Sbjct: 1276 -----------GGNPYE-GQPQDIWAIGILLYTVVFKENPFYNID------EILEGDLKF 1317

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
                  +N E++ +  IEL+K+ L R    R T+D + N  +L
Sbjct: 1318 ------NNAEEVSEDCIELIKSILNRRVPNRPTIDDINNDKWL 1354

>Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACL191C
          Length = 365

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 147/325 (45%), Gaps = 65/325 (20%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRVSFDAFDDSS-IDGFKGEIXXXXXXX 499
           S+Y+ ++L+G G    V     K +G KV A+K++    F  +  +     E+       
Sbjct: 11  SRYKLVDLIGEGAYGTVCSAIHKPTGTKV-AIKKIQ--PFTRAMFVTRTLRELKLLKFFH 67

Query: 500 XXXRVIQLLD------YEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
               +I +LD      Y+  D + YL+ E  + DL +I++Q  N   D + ++++  ++L
Sbjct: 68  SHENIISVLDIVRPTSYQEFDAV-YLVQELMETDLQRIISQTNNFLSD-DHIQYFTYQIL 125

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP------EHTVNIYRETQIG 606
           + +K +H A ++H DLKP+N +L     LK+ DFG++  +       E+ V    E  + 
Sbjct: 126 RALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTE-YVA 184

Query: 607 TPNYMAPEALVAMN-YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQ 665
           T  Y APE +++   YT                  D+WSCGCI+ +MI GKP +      
Sbjct: 185 TRWYRAPEIMLSFQEYTT---------------AMDIWSCGCILAEMISGKPLFPGRDYH 229

Query: 666 NRLLAIM----NPD----------------------VKIPFPEHTSNDEKIPKSAIELMK 699
           ++L  I+     P                       +KIP+      ++  P  A++L+ 
Sbjct: 230 HQLWVILEILGTPSYEDFAQIKSKRAKAYILNLPMRLKIPWNVALGTNDINP-LAMDLLD 288

Query: 700 ACLYRNPDKRWTVDKVLNSTFLQPF 724
             L  NPDKR + ++ L   +L+ +
Sbjct: 289 KMLTFNPDKRISAEEALKHPYLETY 313

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 139/316 (43%), Gaps = 35/316 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ E    + + +  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1147 TRMVEVTENHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQV 1206

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +        S+++  + E+           ++Q L +E  D +  L +E      +
Sbjct: 1207 EVPKYSSQNEAILSTVEALRSEVSTLKDLDHL-NIVQYLGFENKDNIYSLFLEYVAGGSV 1265

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D   ++    ++L+ +  +H  GI+H D+K  N +L + GI KI DFG
Sbjct: 1266 GSLIRMYGR--FDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFG 1323

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1324 IS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1365

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GCIV +M  GK P+ + +    +  I       P PE T     I +     + AC   
Sbjct: 1366 LGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTL--PLISQVGRGFLDACFEI 1423

Query: 705  NPDKRWTVDKVLNSTF 720
            NP+KR T  ++L+  F
Sbjct: 1424 NPEKRPTATELLSHRF 1439

>NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa]
           {ON} Anc_3.229
          Length = 509

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 105/231 (45%), Gaps = 57/231 (24%)

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  LL Y  G  L + + E G              +LD + V FYA E+   +K +HD 
Sbjct: 209 KLYLLLQYIPGGELFFHLKEQG--------------TLDEDTVAFYAAEISCALKFLHDK 254

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIA-------NAVPEHTVNIYRETQ--------IG 606
           GIV+ DLKP N +L  KG L + DFG++       +A P    ++   ++        IG
Sbjct: 255 GIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTSLNEPSEDLSTLHSIIG 314

Query: 607 TPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQN 666
           TP Y APE L  + Y +N                D +S GC++Y M+ GKPPY    G N
Sbjct: 315 TPEYCAPEILQGLPYNKN---------------CDWYSLGCLIYDMLSGKPPY---TGAN 356

Query: 667 R--LLAIMNPDVKIP-FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDK 714
              +L  +  D + P  P + S   K      +++   L ++  KRW VDK
Sbjct: 357 HKVILNKIQKDKQGPKIPYYLSEGMK------DMLNWLLKKDQSKRWDVDK 401

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 99/203 (48%), Gaps = 30/203 (14%)

Query: 517 LYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYL++E  D  +L   L  RG +  +   V ++ K+++Q +   H   I H DLKP N +
Sbjct: 191 LYLVLEYVDGGELFDYLVSRGRL-CEREAVHYF-KQIIQGVSYCHAFNICHRDLKPENLL 248

Query: 576 LVK--GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNK 633
           L K    +KI DFG+A        N   +T  G+P+Y +PE ++   Y       H G  
Sbjct: 249 LDKKNSTIKIADFGMAAL---EVSNKLLQTSCGSPHYASPEIVMGKQY-------HGG-- 296

Query: 634 WKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKS 693
                PSD+WSCG I++ ++ G  P+     +  LL + +   ++P        + + K 
Sbjct: 297 -----PSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMP--------QNLSKE 343

Query: 694 AIELMKACLYRNPDKRWTVDKVL 716
           A +L+   L  NP KR T +++L
Sbjct: 344 AQDLIAKILTVNPAKRLTTEEIL 366

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 113/238 (47%), Gaps = 29/238 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  +D  +  G L+++ME  +   L+ ++    +  L    +    +E L+ ++ +H  
Sbjct: 677 IVNFIDSYLAKGDLWIVMEYMEGGSLTDVVT---HCLLSEGQIGAVCRETLKGLQFLHSK 733

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           G++H D+K  N +L +KG +K+ DFG    + E+  N+ R T +GTP +MAPE +    Y
Sbjct: 734 GVLHRDIKSDNILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPYWMAPEVVSRKEY 791

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL-LAIMNPDVKIPF 680
                          G   D+WS G ++ +MI G+PPY +      L L   N   K+  
Sbjct: 792 ---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKE 836

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNA 738
           PE  S+      +  + +  CL  +P +R T  ++L+  F+       S +  L++ A
Sbjct: 837 PEALSD------TLTKFLDWCLKVDPSERATATELLDDPFITEIAEDNSSLSPLVKLA 888

>NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 bp,
           323 aa] {ON} Anc_8.482
          Length = 323

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 120/238 (50%), Gaps = 33/238 (13%)

Query: 438 ITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXX 496
           ++ + SQ++++E LG G  + VYK +  S     ALK V  D+ + +     + EI    
Sbjct: 1   MSSSSSQFKQLEKLGNGTYATVYKGLNKSTGAFVALKEVKLDSEEGTPSTAIR-EISLMK 59

Query: 497 XXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNM--SLDFNFVRFYAKEM 552
                  +++L D    +  L L+ E  D+DL + ++ +  GN    L+ N V+++  ++
Sbjct: 60  ELKHE-NIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSQSTGNTPRGLELNLVKYFQWQL 118

Query: 553 LQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPN 609
            + +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  
Sbjct: 119 FEGLAFCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLW 174

Query: 610 YMAPEALV-AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQN 666
           Y AP+ L+ +  YT +                D+WSCGCI+ +MI GK     F G N
Sbjct: 175 YRAPDVLMGSRTYTTS---------------IDIWSCGCILAEMITGK---ALFPGTN 214

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 126/270 (46%), Gaps = 39/270 (14%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V+ L +       LYL++E  D  +L   L  +G +S +   V ++ K+++Q +   H  
Sbjct: 198 VMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLS-EKEAVHYF-KQIIQGVSYCHSF 255

Query: 563 GIVHSDLKPANFVLVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
            I H DLKP N +L K    +KI DFG+A        N   +T  G+P+Y +PE ++  +
Sbjct: 256 NICHRDLKPENLLLDKKNKSIKIADFGMAAL---ELPNKLLQTSCGSPHYASPEIVMGKS 312

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
           Y       H G       PSD+WSCG I++ ++ G  P+     +  LL +     ++P 
Sbjct: 313 Y-------HGG-------PSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMP- 357

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF------MISESIMEDL 734
                    +   A +L+   L  +P KR T D++LN   +  +      M+S     DL
Sbjct: 358 -------STLSPEAQDLISRILVIDPSKRITTDRILNHPLILKYEPAGKNMVSGKSNSDL 410

Query: 735 IRNAVRYGSEKPQISHDNLNDVVETVLRKF 764
             + + + S +P IS  + ND+  ++L+  
Sbjct: 411 --HVLEHISPQP-ISLTSRNDIDASILKNL 437

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 140/316 (44%), Gaps = 35/316 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ E    + + +  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1153 TRMVEVTENHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQV 1212

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +        S+++  + E+           ++Q L +E  + +  L +E      +
Sbjct: 1213 EVPKYSSQNEAILSTVEALRSEVSTLKDLDHL-NIVQYLGFENKNSIYSLFLEYVAGGSV 1271

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D + ++    ++L+ +  +H  GI+H D+K  N +L + GI KI DFG
Sbjct: 1272 GSLIRMYGR--FDESLIKHLTTQVLRGLAYLHSKGILHRDMKADNLLLDQDGICKISDFG 1329

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1330 IS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1371

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GCIV +M  GK P+ + +    +  I       P PE T     I +     + AC   
Sbjct: 1372 LGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTL--PLITRVGRSFLDACFEI 1429

Query: 705  NPDKRWTVDKVLNSTF 720
            +P+KR T  K+L+  F
Sbjct: 1430 DPEKRPTATKLLSHQF 1445

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 138/305 (45%), Gaps = 31/305 (10%)

Query: 445 YEKIELLGRGGSSRVYKVKGSGNK-VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           + + E++GRG    VYK      K VYA+K ++ D  +D  ++  + E+           
Sbjct: 23  FRRTEIVGRGKFGVVYKAYHVKTKQVYAIKVLNLDCPEDE-VEDVQKEVQFLSSLKQVPN 81

Query: 504 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           + Q     + +  L++IME C    L  +L       +D  ++    + +L  +  +H  
Sbjct: 82  ITQYYGSFLYETKLWVIMEYCAGGSLRTLLRPG---KIDEKYLGVIVRNLLVALLYIHKD 138

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
            ++H D+K AN ++  G  +K+ DFG+A  +   T N  R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNGGHVKLCDFGVAAQL--TTANHKRQTMAGTPYWMAPEVIMEGVY 196

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFP 681
                             +D+WS G   Y++  G PPY   +    +  I     K P  
Sbjct: 197 YNTK--------------ADIWSLGITTYEIATGNPPYCDVEALRAMQLITK--SKPPRL 240

Query: 682 EHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE-SIMEDLIRNAVR 740
           E   N   + K   E +  CL  +P+ R T +++L +  ++    S  +I+++LI   + 
Sbjct: 241 EG-RNYSPLLK---EFIALCLDEDPEARPTAEELLTTKLVKTHKGSSVTILKELISRYLL 296

Query: 741 YGSEK 745
           + SEK
Sbjct: 297 F-SEK 300

>Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047W
           (REAL)
          Length = 895

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 156/382 (40%), Gaps = 56/382 (14%)

Query: 384 KRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKVEIVEP-----ARTATSSSNRNMI 438
           K S    I N+N   +V     F+    P+ P  K  +  EP      RT + S+    I
Sbjct: 436 KTSASTNINNKNPGQSVLPSNSFF----PQEPPPKISDFQEPRRSRRLRTKSFSNKFQDI 491

Query: 439 TVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVSFDAF-DDSSIDGFKGEIXXXX 496
            V    +EK+ LLG+G   +V+ V+    N+VYALK +S D     + I     E     
Sbjct: 492 MVGPQSFEKVRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEMIKRNKIKRVLTE-QEIL 550

Query: 497 XXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQC 555
                  ++ L      +  LYL ME C   +  + L  R    +  +  RFYA E+   
Sbjct: 551 ATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCICEDDARFYASEVTAA 610

Query: 556 IKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQ---------- 604
           ++ +H  G ++ DLKP N +L + G + + DF ++    +  V + + +           
Sbjct: 611 LEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDSKVPVVKGSAQSTLVDTKIC 670

Query: 605 ---------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYG 655
                    +GT  Y+APE +           R +G+   V    D W+ G +VY+M++G
Sbjct: 671 SDGFRTNSFVGTEEYIAPEVI-----------RGNGHTAAV----DWWTLGILVYEMLFG 715

Query: 656 KPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKV 715
             P+           I+  +V  P      N+ +I ++  +L++  L +N  KR      
Sbjct: 716 FTPFKGDNTNETFTNILKNEVSFP------NNNEISRTCKDLIRKLLTKNESKRLGCKMG 769

Query: 716 LNSTFLQPFMISESIMEDLIRN 737
                  PF   + +   L+RN
Sbjct: 770 AADVKKHPFF--KKVQWSLLRN 789

>Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa]
           {ON} complement(128841..130379) [1539 nt, 513 aa]
          Length = 512

 Score = 89.4 bits (220), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 97/217 (44%), Gaps = 37/217 (17%)

Query: 517 LYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYL+++     +L   L + G +  D   V FY  E+   +K +H  GIV+ DLKP N +
Sbjct: 213 LYLLLQYIPGGELFFHLKEHGTLQEDT--VAFYTAEISCALKFLHSKGIVYRDLKPENCL 270

Query: 576 L-VKGILKIIDFGIANAVPEHTVNIYRETQ------------IGTPNYMAPEALVAMNYT 622
           L  +G L + DFG++    E   ++  + +            IGTP Y APE L  + Y+
Sbjct: 271 LNERGHLVLTDFGLSKIAVEQNEDVGEDHEAEGENITELYSIIGTPEYCAPEILQGLPYS 330

Query: 623 QNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPE 682
           QN                D +S GC++Y M+ GKPPY     +  L  I         P 
Sbjct: 331 QN---------------CDWYSLGCLIYDMLIGKPPYTGVNHKIILNKIQKDKQGPKLPY 375

Query: 683 HTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNST 719
           + S+  K      +++ A L +   KRW VD+    T
Sbjct: 376 YLSDGMK------DVLGALLKKESKKRWDVDQYWKET 406

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 85/311 (27%), Positives = 142/311 (45%), Gaps = 38/311 (12%)

Query: 429 ATSSSNRNMITVNDSQYEKIE--------LLGRGGSSRVYK-VKGSGNKVYALK----RV 475
           A+SS ++  I++  ++ + I         ++G+G  + V K V+ S  K +A+K    R 
Sbjct: 168 ASSSKSKYQISMGHTELKGIHKYYSISDSIVGQGAFATVKKAVERSTGKTFAVKIIHKRK 227

Query: 476 SFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQ 534
             D FD     G K E+          R+++L D+   +   Y++ME     DL   +  
Sbjct: 228 VMDKFD-----GVKRELDVLQKLNHP-RIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAA 281

Query: 535 RGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKG---ILKIIDFGIANA 591
            G +  D    R   +++L+ +K +HD GI H DLKP N ++ +    ++KI DFG+A  
Sbjct: 282 HGTVGEDAG--REITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKV 339

Query: 592 VPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQ 651
                 N +  T  GT  Y+APE +   N  ++  NR            DMWS GC+VY 
Sbjct: 340 ---QNQNTFLNTFCGTLAYVAPEVIDGKN-AEDKTNRD-----LYSSLVDMWSIGCLVYV 390

Query: 652 MIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWT 711
           ++ G  P+ S Q QN L   +    +  + E    D +I + A   +   L  +P +R  
Sbjct: 391 ILTGHLPF-SGQSQNELFKQIK---RGSYHEGPLKDYRISEEARNFIDCLLNVDPKERMN 446

Query: 712 VDKVLNSTFLQ 722
             K L   +++
Sbjct: 447 AGKALQHPWMK 457

>Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C
           (PHO85) - cyclin-dependent protein kinase [contig 27]
           FULL
          Length = 246

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 114/251 (45%), Gaps = 51/251 (20%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--GNMSLDF--NFVRFYAKEMLQCIKVV 559
           +++L D    +  L L+ E  D+DL + ++ R  GN    F  + V+++  ++LQ +   
Sbjct: 9   IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVAFC 68

Query: 560 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPEAL 616
           H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+ L
Sbjct: 69  HENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVL 124

Query: 617 VAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMN--- 673
           +       +               D+WSCGCI+ +MI G+P +     + +L  I     
Sbjct: 125 MGSRTYSTS--------------IDIWSCGCILAEMITGRPLFPGTNDEEQLKLIFETMG 170

Query: 674 -------------PDVKIPFPEHTSND----------EKIPKSAIELMKACLYRNPDKRW 710
                        P      P+H   D          EK+  + I+L+   L  NPD+R 
Sbjct: 171 TPTERTWPGVSTLPKYNPQLPQHLPKDLGALLQSQTREKMDLTLIDLLYGLLQPNPDRRL 230

Query: 711 TVDKVLNSTFL 721
           +  + LN  + 
Sbjct: 231 SAKQALNHPWF 241

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 141/299 (47%), Gaps = 23/299 (7%)

Query: 429 ATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDG 487
           ++S++NR  + ++ S   K E++G+G  + V K V+ S  K +A K +S       ++DG
Sbjct: 179 SSSTNNRTGVFMDFSI--KDEVVGQGAFATVKKAVERSTGKTFAAKIISKRKVM-GNMDG 235

Query: 488 FKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVR 546
              E+          ++++L  +   D   YL+ME     DL   +   G++  D    R
Sbjct: 236 VTRELEVLRKLNHP-KIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAG--R 292

Query: 547 FYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRET 603
              +++L+ +K +H  GI H DLKP N ++ +    ++KI DFG+A      T   + +T
Sbjct: 293 EITRQVLEGVKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKT 349

Query: 604 QIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQ 663
             GT  Y+APE +      + N+ R++ +        DMWS GC+VY ++ G  P+    
Sbjct: 350 FCGTLAYVAPEVIAGKANAEENEKRNEYSSL-----VDMWSMGCLVYVILTGHLPFSGST 404

Query: 664 GQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
            +     I N      + E    D +I   A + + + L  NP+ R T  K L   +++
Sbjct: 405 QEQLYKQIKNGS----YHEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 131/300 (43%), Gaps = 37/300 (12%)

Query: 445 YEKIELLGRGGSSRVYKVKG-SGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           Y  +  +G+G S  VY     S N+  A+K+++ +      +     EI           
Sbjct: 627 YTNLVKIGQGASGGVYIANDVSTNESIAIKQMNLEKQPKKEL--IINEILVMKGSKHP-N 683

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  +D  + DG L++IME  +   L+ ++       L    +    +E L  ++ +H  
Sbjct: 684 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVVTH---CILTEGQIGAVCRETLSGLQFLHSK 740

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           G++H D+K  N +L + G +K+ DFG    V E T  + R T +GTP +MAPE +    Y
Sbjct: 741 GVLHRDIKSDNILLSINGNIKLTDFGFCAQVNETT--LKRTTMVGTPYWMAPEVVSRKEY 798

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM---NPDVKI 678
                          G   D+WS G ++ +MI G+PPY +      L  I     P++K 
Sbjct: 799 ---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELK- 842

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNA 738
                    EK+       +  CL  NPD+R +  ++L   F+  +  +   +  L++ A
Sbjct: 843 -------EREKLSDVLKHFLDWCLSVNPDQRASATELLEDVFITEYADANESLAPLVKLA 895

>NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177
           YAR019C
          Length = 897

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/330 (24%), Positives = 140/330 (42%), Gaps = 55/330 (16%)

Query: 412 PKPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVY 470
           P+P ++   +  E  R  + S+     TV+   ++KI+LLG+G   +VY VK  S N +Y
Sbjct: 459 PRPRISSSPKRSERLRNKSFSNKFQDSTVSPQSFQKIKLLGQGDVGKVYLVKEKSTNALY 518

Query: 471 ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR--VIQLLDYEMGDGLLYLIME-CGDHD 527
           A+K   ++  D       K  I             ++ L      +  LYL ME C   +
Sbjct: 519 AMK--IYNKNDMLKRKKIKRVITEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGE 576

Query: 528 LSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDF 586
             + L  R +  +D +  +FYA E++  ++ +H  G ++ DLKP N +L K G + + DF
Sbjct: 577 FFRALQTRESKCIDEDAAQFYASEVIAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDF 636

Query: 587 GIANAVPE----------------HTVNIYRETQI-----------GTPNYMAPEALVAM 619
            ++    +                   N+  +T+I           GT  Y+APE +   
Sbjct: 637 DLSIQAKDSKNPTFMKNGILSTNNSNSNLIIDTKICSDGFRTNSFVGTEEYIAPEVI--- 693

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
                   R +G+   V    D W+ G ++Y+M++GK P+           I++ D   P
Sbjct: 694 --------RGNGHTVAV----DWWTLGILIYEMLFGKTPFKGKNTNETFANILSHDFTFP 741

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKR 709
                 N   I ++   L+K  L +N  KR
Sbjct: 742 ------NTNNISRNCKNLIKKLLIKNETKR 765

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/348 (23%), Positives = 152/348 (43%), Gaps = 38/348 (10%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKVYALKRV 475
            T+ +E+ E    + + +  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1150 TRTIEVTENHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQV 1209

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +         +++  + E+           ++Q L +E  + +  L +E      +
Sbjct: 1210 EVPKYSSQNEAILGTVEALRSEVSTLKDLDHL-NIVQYLGFENKNNIYSLFLEYVAGGSV 1268

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D + +R    ++L+ +  +H  GI+H D+K  N +L + GI KI DFG
Sbjct: 1269 GSLIRMYGR--FDESLIRHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFG 1326

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1327 IS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1368

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GCIV +M  GK P+ + +    +  I       P PE T     I +     + AC   
Sbjct: 1369 LGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTL--PLISQVGRSFLDACFEI 1426

Query: 705  NPDKRWTVDKVLNSTFLQ---PFMISESIMEDLIRNAVRYGSEKPQIS 749
            NP++R T  ++L+  F Q    F    + +   I++  R  S K +I+
Sbjct: 1427 NPEERPTATELLSHQFSQVDTTFDFKSTRLAKFIKSNDRLNSSKLRIT 1474

>Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 147/325 (45%), Gaps = 68/325 (20%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRV---SFDAFDDSSIDGFKGEIXXXXX 497
           SQY+ ++L+G G    V     K SG KV A+K++   S   F   +I     EI     
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTI----REIKLLRY 65

Query: 498 XXXXXRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQR--GNMSLDFNFVRFYAK 550
                 +I +LD      +     +YL+ E  + DL +++N +  G+ +L  + ++++  
Sbjct: 66  FHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGSSTLSDDHIQYFTY 125

Query: 551 EMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG--- 606
           ++L+ +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G   
Sbjct: 126 QILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMT 183

Query: 607 ----TPNYMAPEALVAMN-YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY-- 659
               T  Y APE ++    YT                  D+WSCGCI+ +M+ GKP +  
Sbjct: 184 EYVATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMLSGKPLFPG 228

Query: 660 ----------------GSFQGQNRLLA------IMNPDVKIPFP-EHTSNDEKIPKSAIE 696
                            SF+  N++ +      I N  ++ P P E+      +    I+
Sbjct: 229 RDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWENVWAKTDLNPDMID 288

Query: 697 LMKACLYRNPDKRWTVDKVLNSTFL 721
           L+   L  NPDKR +  + L   +L
Sbjct: 289 LLNKMLQFNPDKRISAAEALRHPYL 313

>NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {ON}
           Anc_6.371
          Length = 804

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 132/302 (43%), Gaps = 53/302 (17%)

Query: 438 ITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXX 496
           I VN   +EKI+LLG+G   +V+ VK    N +YA+K   ++  D    +  K  I    
Sbjct: 398 IKVNPQSFEKIKLLGQGDVGKVFLVKEKKTNGLYAMK--IYNKKDMIKREKIKRVITEQE 455

Query: 497 XXXXXXR--VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                    ++ L      +  LYL ME C   +  + L  R +  +  +  RFYA E+L
Sbjct: 456 ILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVL 515

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIA--------------NAVPEHTVN 598
             ++ +H  G ++ DLKP N +L K G + + DF ++                +P    N
Sbjct: 516 AALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVHAKDSKNPIFMKDGILPTTNSN 575

Query: 599 IYRETQI-----------GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGC 647
           +  +T+I           GT  Y+APE +           R +G+   V    D W+ G 
Sbjct: 576 LIVDTKICSEGFRTNSFVGTEEYIAPEVI-----------RGNGHTVAV----DWWTLGI 620

Query: 648 IVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPD 707
           ++++M++GK P+           I++ D + P     SND  I ++   L+K  L +N  
Sbjct: 621 LIFEMLFGKTPFKGDTTNETFANILSKDFEFP----NSND--ITRNCKNLIKKLLTKNET 674

Query: 708 KR 709
           KR
Sbjct: 675 KR 676

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 112/228 (49%), Gaps = 45/228 (19%)

Query: 504  VIQLLDYEMGDGLLYLIME----CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            + Q++D+   D   Y+ +E     G  DL  ++  + NM+ +F   +   K+++  IK +
Sbjct: 863  ITQIMDFFEDDDYYYIELESHGETGSIDLFDLIELKTNMT-EFE-AKLIFKQIVSGIKYL 920

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++   G +K+IDFG A         ++    +GT +Y APE L  
Sbjct: 921  HDQGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFEVF----VGTIDYAAPEIL-- 974

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGS----FQGQNRLLAIMNP 674
                        GN +K G+P D+W+ G ++Y +IY + P+ +     +GQ R     N 
Sbjct: 975  -----------GGNPYK-GKPQDIWALGVLLYTLIYKENPFYNVDEILEGQLRFDGTCN- 1021

Query: 675  DVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                           + +  I+L++  L ++ + R ++D+++NS +LQ
Sbjct: 1022 ---------------VTQDCIDLIRWILTKSVNDRPSIDEIVNSEWLQ 1054

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 115/230 (50%), Gaps = 36/230 (15%)

Query: 504 VIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L      +  LY ++E   + D   ++ + G  S+D N   +YA +++  I  +H  
Sbjct: 241 VVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYG--SIDENCACYYAAQIIDAIDYLHSN 298

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIA-------NAV--PEHTVNIYRETQIGTPNYMA 612
           GI+H D+KP N +L + + +K+ DFG A       N+V  P++ ++   ++ +GT  Y++
Sbjct: 299 GIIHRDIKPENILLDEEMRIKLTDFGTAKLLSPTSNSVSKPKYDLSTRSKSFVGTAEYVS 358

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE L        ND+  D          D+W+ GCI++QMI GKPP   F+  N  L   
Sbjct: 359 PELL--------NDSFTDYR-------CDIWAFGCILFQMIAGKPP---FKATNEYLTFQ 400

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
              +K+ +    +     P    +L+K  L +N D+R T++++    F +
Sbjct: 401 KV-MKVQY----AFTPGFPLVIRDLVKRILVKNLDQRLTINQIKEHYFFK 445

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 131/287 (45%), Gaps = 37/287 (12%)

Query: 439 TVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXX 497
           ++    Y   +++GRG    VY+ VK   NK  A+K++ F+  D+S ++    EI     
Sbjct: 4   SIAHGTYALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFE--DESELNEHMLEIDLLKN 61

Query: 498 XXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCI 556
                 +++   +      LY+I+E C    L  IL     +  D      Y  + L  +
Sbjct: 62  LRHQ-NIVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLLEDD---TVNYVTQTLYGL 117

Query: 557 KVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEA 615
           + +H+ G++H D+K AN +L + GI+K+ DFG++       +N    T  G+PN+MAPE 
Sbjct: 118 QYLHEQGVIHRDIKAANLLLTEEGIVKLADFGVST-----RINRMAMTYAGSPNWMAPEV 172

Query: 616 LVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPD 675
           +                       SD+WS G  V +++ G PP+ +   ++   AI+N +
Sbjct: 173 MTGQG---------------ASTVSDIWSLGATVVELLTGNPPFHNLVNESACYAIVNEE 217

Query: 676 VKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
             IP P   S + K      + +  C  +N  KR T  ++L   +L+
Sbjct: 218 Y-IP-PLTLSAECK------DFLSRCFQKNMFKRATAQELLAHIWLK 256

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 140/316 (44%), Gaps = 35/316 (11%)

Query: 417  TKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRV 475
            T+ VE+ E    + + +  +     +  + K E++G+G    VY  +  +  ++ A+K+V
Sbjct: 1147 TRMVEVTENHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQV 1206

Query: 476  SFDAFDD------SSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDL 528
                +        S+++  + E+           ++Q L +E  + +  L +E      +
Sbjct: 1207 EVPKYSSQNEAILSTVEALRSEVSTLKDLDHL-NIVQYLGFENKNNIYSLFLEYVAGGSV 1265

Query: 529  SQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 587
              ++   G    D   ++    ++L+ +  +H  GI+H D+K  N +L + GI KI DFG
Sbjct: 1266 GSLIRMYGR--FDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFG 1323

Query: 588  IANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
            I+      + +IY  + +   GT  +MAPE +          +   G   KV    D+WS
Sbjct: 1324 IS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWS 1365

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GCIV +M  GK P+ + +    +  I       P PE T     I +     + AC   
Sbjct: 1366 LGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTL--PLISQIGRNFLDACFEI 1423

Query: 705  NPDKRWTVDKVLNSTF 720
            NP+KR T +++L+  F
Sbjct: 1424 NPEKRPTANELLSHPF 1439

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 135/294 (45%), Gaps = 47/294 (15%)

Query: 439 TVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALK--RVSFDAFDDSSIDGFKGEIXXXX 496
           T+ D  Y  + L     S++ Y VK   NK Y +K  +V +   + +++   K       
Sbjct: 160 TLGDGSYSTVLLATSIESNKKYAVK-ILNKEYLIKQKKVKYVNIEKNTLQRLKN------ 212

Query: 497 XXXXXXRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQC 555
                  +I L      +  LY ++E   + DL  ++ + G  S++    ++YA +++  
Sbjct: 213 ----TKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHG--SVNEKCTQYYAAQIIDA 266

Query: 556 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVP-------EHTVNIYRETQIGT 607
           +  +HD G++H DLKP N +L V   +K+ DFG A  +        ++ +     + +GT
Sbjct: 267 LGFMHDKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGT 326

Query: 608 PNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR 667
             Y++PE L        NDN  D          D+W+ GCI++QMI GKPP   F+  N 
Sbjct: 327 AEYVSPELL--------NDNYVDFR-------CDIWAFGCILFQMIAGKPP---FKANNE 368

Query: 668 LLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
            L      +K+ F    +     P +  +L+K  L +NP++R  ++++    F 
Sbjct: 369 YLTFQKV-MKVQF----AFTAGFPMTVRDLVKNILIKNPERRLLINQIKAHQFF 417

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 131/292 (44%), Gaps = 54/292 (18%)

Query: 440 VNDSQYEKIEL-LGRGGSSRVYKVKGSGNKVYALK--RVSFDAFDDSSIDGFK---GEIX 493
           + D  Y ++ L   +  SS+ Y VK   NK Y +K  +V +   + +++   K   G I 
Sbjct: 124 LGDGSYSQVFLATSKTDSSKTYAVK-VLNKEYLIKQKKVKYVNIEKTALQNLKSVTGVIN 182

Query: 494 XXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEML 553
                     +  LL+Y      L LI + G       LN+   +        +Y+ +++
Sbjct: 183 LSFTFQDEANLYFLLEYAPNGDFLSLIKKFG------TLNEECTI--------YYSAQII 228

Query: 554 QCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIA---------NAVPEHTVNIYRET 603
             I  +H  GI+H D+KP N +L   + +K+ DFG A         N  P + +     +
Sbjct: 229 DAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSS 288

Query: 604 QIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQ 663
            +GT  Y++PE L++ NYT           +K     D+W+ GC+VYQMI GKPP   F+
Sbjct: 289 FVGTAEYVSPE-LLSDNYTD----------YKC----DIWAFGCLVYQMIAGKPP---FK 330

Query: 664 GQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKV 715
             N  L      +K+ F    +     P    +L+K  L + P+KR T+ ++
Sbjct: 331 ATNEYLTFQKV-MKVQF----AFTAGFPTIIRDLVKNILVKQPEKRLTIPQI 377

>TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.229
           YBR028C
          Length = 513

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 99/208 (47%), Gaps = 35/208 (16%)

Query: 517 LYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYLI++     +L   L ++G ++ D   V FY  E+   +K +H+ GIV+ DLKP N +
Sbjct: 215 LYLILQYIPGGELFFHLKEQGTLNEDV--VAFYGAEISCALKFLHEKGIVYRDLKPENCL 272

Query: 576 L-VKGILKIIDFGIA-----NAVP---EHTVNIYRETQIGTPNYMAPEALVAMNYTQNND 626
           L   G L + DFG++       +P   E    +Y  + IGTP Y APE L  + YTQN  
Sbjct: 273 LNYTGHLVLTDFGLSKKGVKKEIPGADEDVAELY--SIIGTPEYCAPEILEGLPYTQN-- 328

Query: 627 NRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSN 686
                         D +S GC++Y M+ GKPP+     +  L  I         P + S+
Sbjct: 329 -------------CDWYSLGCLIYDMLVGKPPFVGANHKIILNKIKKDKTGAKIPYYLSD 375

Query: 687 DEKIPKSAIELMKACLYRNPDKRWTVDK 714
             K      +++   L ++  KRW VDK
Sbjct: 376 GMK------DILCWLLKKDCSKRWDVDK 397

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/315 (26%), Positives = 139/315 (44%), Gaps = 43/315 (13%)

Query: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKG--SGNKVYALKRVSFD 478
           EIV+P    T  + + +I      ++  E++G G  S V       SG K YA+K ++ +
Sbjct: 149 EIVDPE---TGQTTKQVIKKGIKDFKFGEMIGDGAYSTVLLATSIDSGKK-YAVKVLNKE 204

Query: 479 AF-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRG 536
                  +     E            +I+L      +  LY ++E   + D   ++ + G
Sbjct: 205 YLIRQKKVKYVNIEKIALQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDFLSVMKKYG 264

Query: 537 NMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEH 595
             SL+     +Y  ++L  I  +H  GI+H D+KP N ++ K + +KI DFG A  + E 
Sbjct: 265 --SLNEECACYYGAQILDAIGFMHTRGIIHRDIKPENILMDKDMKVKITDFGTAKILDEK 322

Query: 596 T---------VNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCG 646
           T         +    ++ +GT  Y++PE L        NDN  D          D+W+ G
Sbjct: 323 TNGNNKTSYELLTRSKSFVGTAEYVSPELL--------NDNYSDSR-------CDIWAFG 367

Query: 647 CIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNP 706
           CI+YQMI GKPP   F+  N  L      +K+ +    +     P    +L+K  L + P
Sbjct: 368 CILYQMIAGKPP---FKATNEYLTFQK-VMKVQY----AFTAGFPTIIRDLIKRILLKVP 419

Query: 707 DKRWTVDKVLNSTFL 721
           ++R T+ ++ +  F 
Sbjct: 420 EQRLTIGQIKSHLFF 434

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 128/281 (45%), Gaps = 31/281 (11%)

Query: 445 YEKIELLGRGGSSRVYKV--KGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           Y+  E +G+G    VY+   K +G  V A+K ++ +   D  ID    EI          
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMV-AVKIINLEETQDD-IDVLAQEIYFLSELRAPF 93

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
                  Y + D  ++++ME CG    + +L       L  N V +  +E+L  ++ +H 
Sbjct: 94  VTTYYKTY-VEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHS 152

Query: 562 AGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
              +H D+K AN +L  +G +K+ DFG++  +      + R T +GTP +MAPE +    
Sbjct: 153 QRKIHRDVKAANILLTDEGEVKLGDFGVSGQI---MATLKRNTFVGTPYWMAPEIIA--- 206

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
                DN +D         +D+WS G    +++ G+PPY  +   + +  +MN    IP 
Sbjct: 207 ----RDNGYD-------EKADIWSLGITAMELLTGQPPYAKY---DPMKVLMN----IPL 248

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
            +      +   SA + +  CL ++P  R T   +L+  FL
Sbjct: 249 RKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLLSHKFL 289

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 136/310 (43%), Gaps = 45/310 (14%)

Query: 433  SNRNMITVNDSQ----------YEKIELLGRGGSSRVY-KVKGSGNKVYALKRVSFDAFD 481
            +++N I +N S+          + K E++G+G    VY  +  +  ++ A+K+V    + 
Sbjct: 1129 TDKNTIEINKSKNARGEYKEFAWMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYG 1188

Query: 482  DSS------IDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQ 534
              +      ++  K E+           ++Q L  E+   +  L +E      +  ++  
Sbjct: 1189 TQNELVKDMVEALKSEVATLKDLDHLN-IVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRL 1247

Query: 535  RGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVP 593
             G    D   +R    ++L  +K +H  GI+H D+K  N +L + GI KI DFGI+    
Sbjct: 1248 YGR--FDEKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGIS---- 1301

Query: 594  EHTVNIYRETQI---GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVY 650
            + + NIY  + +   GT  +MAPE +          +   G   KV    D+WS GC+V 
Sbjct: 1302 KKSKNIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWSLGCVVL 1347

Query: 651  QMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRW 710
            +M  GK P+ + +    +  I       P P+ T   + I     + +  C   +P+KR 
Sbjct: 1348 EMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPDDTI--QLISSKGKDFLSKCFEIDPEKRP 1405

Query: 711  TVDKVLNSTF 720
            T D +L  +F
Sbjct: 1406 TADDLLEHSF 1415

>NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON}
           Anc_6.371
          Length = 918

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 123/294 (41%), Gaps = 43/294 (14%)

Query: 438 ITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVS-FDAFDDSSIDGFKGEIXXX 495
           ITV    +EKI+LLG+G   +VY V+    N++YALK  S  +      I     E    
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEIL 571

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQC 555
                   V     ++  D L + +  C   +  + L  R    +  +  RFYA E+   
Sbjct: 572 ATSNHPFVVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAA 631

Query: 556 IKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQ---------- 604
           ++ +H  G ++ DLKP N +L K G + + DF ++    +  V + + +           
Sbjct: 632 LEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKVPVMKGSAESTVVDTKIC 691

Query: 605 ---------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYG 655
                    +GT  Y+APE +           R +G+   V    D W+ G ++Y+M++G
Sbjct: 692 SDGFRTNSFVGTEEYIAPEVI-----------RGNGHTAAV----DWWTLGILIYEMLFG 736

Query: 656 KPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKR 709
             P+           I+  DV  P      N+  I ++  +L+K  L +N  KR
Sbjct: 737 FTPFKGSSSNETFSNILKNDVSFP------NNNDISRNCKDLIKKLLCKNEAKR 784

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 97/208 (46%), Gaps = 30/208 (14%)

Query: 517 LYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYL++E     +L   L  RG   L       Y K+++Q +   H   I H DLKP N +
Sbjct: 142 LYLVLEYVEGGELFDYLISRGK--LPEQEAVHYFKQIVQGVSYCHHFNICHRDLKPENLL 199

Query: 576 LVKGIL--KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNK 633
           L K  L  KI DFG+A      T +   ET  G+P+Y +PE ++   Y            
Sbjct: 200 LDKKNLSVKIADFGMAAL---ETTDKLLETSCGSPHYASPEIVMGQKYH----------- 245

Query: 634 WKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKS 693
              G PSD+WSCG I++ ++ G  P+     +  LL + +   K   P++ SN+ K    
Sbjct: 246 ---GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQS--GKYQMPQNISNEAK---- 296

Query: 694 AIELMKACLYRNPDKRWTVDKVLNSTFL 721
             +L+   L  +P  R T+D+VL    L
Sbjct: 297 --DLIAKILIVDPAMRITIDEVLEHPLL 322

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 109/225 (48%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LY+++E  +  +L  +L + G   L  N    + ++++  +   H  
Sbjct: 94  VLRLYDVWETNPSLYMVLEYAEKGELFNLLVENG--PLPENEAVCFFRQIIIGVSYCHAL 151

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L   + +KI DFG+A      T +   ET  G+P+Y APE +  + Y
Sbjct: 152 GIVHRDLKPENLLLDHDLNIKIADFGMAAL---ETEDKLLETSCGSPHYAAPEIVSGIPY 208

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  SD+WSCG I + ++ G+ P+    G  +N LL + +   ++P
Sbjct: 209 H--------------GFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMP 254

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +D++I   A +L+   L  +P+ R    ++L    LQ +
Sbjct: 255 ------DDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKY 293

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 139/291 (47%), Gaps = 32/291 (10%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXX 500
           S Y   + +GRG    VYK   K SG KV A+K V+ +  D+  I+    EI        
Sbjct: 15  SLYSIKQCVGRGNFGDVYKACEKVSG-KVVAVKVVNLEHTDED-INLLAQEIFFLAELKS 72

Query: 501 XXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
              +   +     D  +++IME CG    + +L    N  L  +   +  +E+L+ ++ +
Sbjct: 73  PY-ITNYITTMTEDVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYL 131

Query: 560 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
           H+   +H D+K AN +L  +G +K+ DFG++  +      + R T +GTP +MAPE +  
Sbjct: 132 HEQKKIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATLKRGTFVGTPFWMAPEVV-- 186

Query: 619 MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
              ++++D   +         +D+WS G  VY+++ G PP   ++     + +  P  K 
Sbjct: 187 ---SKDSDGYDEK--------ADIWSLGITVYELLKGSPPL--YKCDPMKVMVNLPKRKP 233

Query: 679 P-FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISE 728
           P    H S+      +A   + +CL +NP  R +  ++LNS F+    IS+
Sbjct: 234 PVLHGHYSS------AAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQISD 278

>KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.341
            YNR031C
          Length = 1656

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 110/241 (45%), Gaps = 40/241 (16%)

Query: 504  VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
            +IQ    E+    + + ME C    L+ +L + G +  D    + Y  E+L+ +  +H++
Sbjct: 1419 IIQYYGVEVHRDKVNIFMEYCEGGSLASLL-EHGRIE-DEMVTQVYTLELLEGLAYLHES 1476

Query: 563  GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET----------------QI 605
            GIVH D+KP N +L   GI+K +DFG A  +  +   I                     I
Sbjct: 1477 GIVHRDIKPENILLDFNGIIKYVDFGAARKIASNETKIRTAGSGSSPGTSSSTDNLRDMI 1536

Query: 606  GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQ 665
            GTP YMAPE +                K   G   D+WS GC+V +M+ G+ P+ +   +
Sbjct: 1537 GTPMYMAPETITG-----------SKTKGSFGV-DDVWSLGCVVLEMVTGRRPWSNLDNE 1584

Query: 666  NRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFM 725
                AIM        P+  + DE I ++  +  K CL  +P+KR T  ++L    + P++
Sbjct: 1585 ---WAIMYHVAAGHIPQLPAKDE-ISEAGAKFFKRCLVYDPNKRATAVELL----MDPWI 1636

Query: 726  I 726
            +
Sbjct: 1637 V 1637

>Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 88/324 (27%), Positives = 146/324 (45%), Gaps = 55/324 (16%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRV---SFDAFDDSSIDGFKGEIXXXXX 497
           SQY+ ++L+G G    V     K SG KV A+K++   S   F   +I     EI     
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTI----REIKLLRY 65

Query: 498 XXXXXRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQR--GNMSLDFNFVRFYAK 550
                 +I +LD      +     +YL+ E  + DL +++N +  G+ +L  + ++++  
Sbjct: 66  FHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNNGSSTLSDDHIQYFTY 125

Query: 551 EMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG--- 606
           ++L+ +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G   
Sbjct: 126 QILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMT 183

Query: 607 ----TPNYMAPEALVAMN-YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGS 661
               T  Y APE ++    YT                  D+WSCGCI+ +M+ GKP +  
Sbjct: 184 EYVATRWYRAPEIMLTFQEYTT---------------AMDIWSCGCILAEMVSGKPLFPG 228

Query: 662 FQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
               ++L  I+       F +      K  K  I    A L   P   W  D V + T L
Sbjct: 229 RDYHHQLWLILEVLGTPTFEDFNQIKSKRAKEYI----ANLPMRPPLSW--DTVWSRTDL 282

Query: 722 QPFMISESIMEDLIRNAVRYGSEK 745
            P MI      DL+   +++  +K
Sbjct: 283 NPDMI------DLLNKMLQFNPDK 300

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 105/224 (46%), Gaps = 30/224 (13%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V+ L +    +  LYL++E  D  +L   L  +G ++ +   V ++ K+++  I   H  
Sbjct: 197 VMALYEVWENNNELYLVLEYVDGGELFDYLVSKGKLT-ESEAVHYF-KQIINGISYCHSF 254

Query: 563 GIVHSDLKPANFVLVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
            I H DLKP N +L K   I+KI DFG+A        N   +T  G+P+Y +PE ++   
Sbjct: 255 NICHRDLKPENLLLDKKRRIIKIADFGMAAL---QVSNRLLQTSCGSPHYASPEIVMGKC 311

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
           Y               G PSD+WSCG I++ ++ G  P+     +  L+ + N   ++P 
Sbjct: 312 YN--------------GAPSDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMP- 356

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                    I + A  L+   L  +P KR + +++L+   L  +
Sbjct: 357 -------SYISQEAKNLISRILVVDPSKRISTEQILSHPLLTKY 393

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 140/313 (44%), Gaps = 30/313 (9%)

Query: 443 SQYEKIELLGRGGSSRVYKV-KGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           S +++ E++GRG    VYK       +VYA+K ++ D  +D  ++  + EI         
Sbjct: 14  SLFKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDE-VEDIRKEIQFLSSLKQT 72

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             +       + D  L++IME C    L  +L  R  + ++  ++    +E+L  +  +H
Sbjct: 73  PNITHYYGSYLIDTKLWVIMEYCAGGSLRTLL--RPGI-IEEKYIGVIMREILVALISIH 129

Query: 561 DAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
              ++H D+K AN ++   G +K+ DFG+A  + +  +   R+T  GTP +MAPE ++  
Sbjct: 130 RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIMEG 187

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
            Y             KV    D+WS G   Y++  G PPY   +    +  I     K P
Sbjct: 188 VYYDT----------KV----DIWSLGITAYEIATGNPPYCHMEAIRAMQMITK--SKPP 231

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL-QPFMISESIMEDLIRNA 738
             E     + +     E +  CL  +P +R   +++  S  + Q    S  I+++LI   
Sbjct: 232 RLEGREYSQPLK----EFIALCLDEDPKERPYAEELFKSKLIKQEKGTSTVILKELITRY 287

Query: 739 VRYGSEKPQISHD 751
           + +  +  Q  H+
Sbjct: 288 LLFREKNEQYKHE 300

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 131/302 (43%), Gaps = 38/302 (12%)

Query: 431 SSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKVYALKRVSFDAFDDSSID--- 486
           +S  RN  TV   +  K   LG+G S RV   K     K+ A+K V       + I    
Sbjct: 61  TSKRRNRDTVGPWKLGKT--LGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLP 118

Query: 487 -GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNF 544
            G + EI           V+ L +       LYL++E     +L   L  +G   L  + 
Sbjct: 119 YGIEREIIIMKLISHP-NVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGK--LPESE 175

Query: 545 VRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL--VKGILKIIDFGIANAVPEHTVNIYRE 602
              Y K+++Q +   H   I H DLKP N +L   K  +KI DFG+A      T +   E
Sbjct: 176 AIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAAL---ETSDKLLE 232

Query: 603 TQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSF 662
           T  G+P+Y +PE ++   Y               G PSD+WSCG I++ ++ G  P+   
Sbjct: 233 TSCGSPHYASPEIVLGRKYH--------------GSPSDVWSCGIILFALLTGHLPFNDD 278

Query: 663 QGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
             +  LL + +   ++P        + +   A +L+   L  +P++R T+D++L    L 
Sbjct: 279 NVKKLLLKVQSGKYQMP--------QWLSVEAKDLISRILVVDPNRRITIDQILQHELLT 330

Query: 723 PF 724
            +
Sbjct: 331 KY 332

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 108/226 (47%), Gaps = 33/226 (14%)

Query: 504 VIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           +I+L      +  LY ++E   + D   I+ + G  SL+    R+Y  ++L  I  +H  
Sbjct: 265 IIKLFFTFQDEANLYFLLEYAPNGDFLSIMKKYG--SLNEECARYYGAQILNGIYFLHRH 322

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIA------NAVPEHTVNIYRETQIGTPNYMAPEA 615
           GI+H D+KP N +L K + +K+ DFG A      +   E+ +    ++ +GT  Y++PE 
Sbjct: 323 GIIHRDIKPENILLDKSMKVKLTDFGTAKLLNRKDGTEEYDLTTRSKSFVGTAEYVSPEL 382

Query: 616 LVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPD 675
           L        ND+      W V    D+W+ GCI++QMI GKPP   F+  N  L      
Sbjct: 383 L--------NDS------W-VDHKCDIWAFGCILFQMIAGKPP---FKATNEYLTFQK-V 423

Query: 676 VKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           +K+ +    +     P    +L+K  L + P+ R T+ ++    F 
Sbjct: 424 MKVQY----AFTAGFPMVVRDLVKQILVKKPEHRLTIPQIEKHLFF 465

>Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON}
            similar to Ashbya gossypii AER264C
          Length = 1541

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 140/318 (44%), Gaps = 45/318 (14%)

Query: 429  ATSSSNRNMITVNDSQY------EKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFD 481
            AT   N+ ++++  S Y      +K   +G G    VY  V      + A+K + F   D
Sbjct: 1222 ATDKENQYLLSLASSLYNVSIRWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIRFH--D 1279

Query: 482  DSSIDGFKGEIXXXXXXXXXXR---VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGN 537
              S+      I              ++Q    E+    + + ME C    L+ +L + G 
Sbjct: 1280 RKSMRQVFPSIKDEMTVLEMLNHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLL-EHGR 1338

Query: 538  MSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHT 596
            +  D    + Y+ ++L+ +  +H++G+ H D+KP N +L   GI+K +DFG A  +  + 
Sbjct: 1339 IE-DEMVTQVYSLQLLEGLAYLHESGVHHRDIKPENILLDFNGIIKYVDFGAAKLIATNG 1397

Query: 597  VNIYRE--------TQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCI 648
              +  E          IGTP YM+PE++ A  Y +   +             D+WS GC+
Sbjct: 1398 SKVLTEDNGRDSTDKMIGTPMYMSPESISASGYGKFGSD-------------DIWSLGCV 1444

Query: 649  VYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDK 708
            V +M+ G+ P+ +   Q    AIM        P   +  E  P + I+ +  CL ++P+ 
Sbjct: 1445 VLEMVTGRRPWANLDNQ---WAIMYQVAAGQIPSFPTKHEMSP-TGIKFLSRCLIQDPNM 1500

Query: 709  RWTVDKVLNSTFLQPFMI 726
            R +  ++L    + P+++
Sbjct: 1501 RSSAVELL----MDPWIV 1514

>TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON}
           Anc_6.371 YCR091W
          Length = 837

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/323 (26%), Positives = 139/323 (43%), Gaps = 50/323 (15%)

Query: 415 PVTKKVEIVEPARTA----TSSSNR-NMITVNDSQYEKIELLGRGGSSRVYKVKGS-GNK 468
           P+ K  ++ EP R+      S SN+   ITV    +EK+ LLG+G   +VY VK    N+
Sbjct: 404 PLEKLPDLEEPKRSRRLRNKSFSNKFRDITVGPQSFEKVRLLGQGDVGKVYLVKEKRTNR 463

Query: 469 VYALKRVS-FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDH 526
           +YALK  S  +      I     E            ++ L      +  LYL ME C   
Sbjct: 464 LYALKIFSKAEMIKRKKIKRILAE-QEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGG 522

Query: 527 DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIID 585
           +  + L  R    +  +  RFYA E+   ++ +H  G ++ DLKP N +L K G + + D
Sbjct: 523 EFFRALQTRKTKCISEDDARFYASEVTAALEYLHLMGCIYRDLKPENILLHKSGHIMLSD 582

Query: 586 FGIA-------NAVPEHTV-----------NIYRETQ-IGTPNYMAPEALVAMNYTQNND 626
           F ++       N V + +            N +R    +GT  Y+APE +          
Sbjct: 583 FDLSIQAKDAKNPVVKGSAQSTLVDTKICSNGFRTNSFVGTEEYIAPEVI---------- 632

Query: 627 NRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSN 686
            R +G+   V    D W+ G + Y+M++G  P+           I+  +V  P      N
Sbjct: 633 -RGNGHTAAV----DWWTLGILTYEMLFGFTPFKGDNTNETFCNILKSEVTFP------N 681

Query: 687 DEKIPKSAIELMKACLYRNPDKR 709
           + +I ++  +L+K  L +N  KR
Sbjct: 682 NNEISRACKDLIKKLLTKNESKR 704

>YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}
           KSS1Mitogen-activated protein kinase (MAPK) involved in
           signal transduction pathways that control filamentous
           growth and pheromone response; the KSS1 gene is
           nonfunctional in S288C strains and functional in W303
           strains
          Length = 368

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 87/325 (26%), Positives = 146/325 (44%), Gaps = 68/325 (20%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRV---SFDAFDDSSIDGFKGEIXXXXX 497
           SQY+ ++L+G G    V     K SG KV A+K++   S   F   +I     EI     
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTI----REIKLLRY 65

Query: 498 XXXXXRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQR--GNMSLDFNFVRFYAK 550
                 +I +LD      +     +YL+ E  + DL +++N +  G  +L  + V+++  
Sbjct: 66  FHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTY 125

Query: 551 EMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG--- 606
           ++L+ +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G   
Sbjct: 126 QILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMT 183

Query: 607 ----TPNYMAPEALVAMN-YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY-- 659
               T  Y APE ++    YT                  D+WSCGCI+ +M+ GKP +  
Sbjct: 184 EYVATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMVSGKPLFPG 228

Query: 660 ----------------GSFQGQNRLLA------IMNPDVKIPFP-EHTSNDEKIPKSAIE 696
                            SF+  N++ +      I N  ++ P P E   +   +    I+
Sbjct: 229 RDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMID 288

Query: 697 LMKACLYRNPDKRWTVDKVLNSTFL 721
           L+   L  NPDKR +  + L   +L
Sbjct: 289 LLDKMLQFNPDKRISAAEALRHPYL 313

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 97/379 (25%), Positives = 174/379 (45%), Gaps = 38/379 (10%)

Query: 361 VLRNISINANHADNILQQENKRLKRSLDDAI-INENEDVNVKNQEVFYHRPAPKPPVTKK 419
           +L+++S N    +++  ++ + +     D I + +    +V N  VF +    K   T +
Sbjct: 128 LLKDLSTNGTWLNDVRIEKGQNMILGQGDEITVGKGVQQDVVNIVVFLNDNFQKKLETAR 187

Query: 420 VE-IVEPARTAT--SSSNRNMIT-------VNDSQYEKIELLGRGGSSRVYK-VKGSGNK 468
           +E + +PA+  T  + S R  +T       +ND      E++G+G  + V K V+ +  K
Sbjct: 188 LEGLRKPAKHTTLRTQSPRAPLTGIFKDFSIND------EVVGQGAFATVKKAVERNTGK 241

Query: 469 VYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHD 527
            +A+K ++       ++DG   E+          R++ L  +   D   YL+ME     D
Sbjct: 242 TFAVKIINKRKVM-GNVDGVTRELEVLRRLNHP-RIVSLKGFYEDDESYYLLMEFVSGGD 299

Query: 528 LSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKG---ILKII 584
           L   +   G++  D    R   +++L+ ++ +H+ GI H DLKP N ++ +    ++KI 
Sbjct: 300 LMDFVAAHGSVGEDAG--REITRQILEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKIT 357

Query: 585 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
           DFG+A  + ++T   + +T  GT  Y+APE +   N   N  N   GN +      DMWS
Sbjct: 358 DFGLAK-IQDNTT--FMKTFCGTLAYVAPEVIGGKNPEGNGAN---GNLYS--SLVDMWS 409

Query: 645 CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
            GC+VY ++ G  P+     +     I N      + E    D  I   A + + + L  
Sbjct: 410 IGCLVYVILTGHLPFSGSTQEQLYKQIANGS----YHEGPLKDYWISDEARDFIDSLLQI 465

Query: 705 NPDKRWTVDKVLNSTFLQP 723
           NP  R T ++ L   +L P
Sbjct: 466 NPVDRLTAERALQHPWLHP 484

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 111/224 (49%), Gaps = 37/224 (16%)

Query: 504  VIQLLDYEMGDGLLYLIME----CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            ++++LD+   D   YL  E     G  DL  ++  + NM+ +F   +   K++   IK +
Sbjct: 1037 ILRILDFFEDDDYYYLETEMHGETGSIDLFDLIELKTNMT-EFE-AKLLFKQVASGIKHL 1094

Query: 560  HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  KG +K+IDFG A  V     +++    +GT +Y APE L  
Sbjct: 1095 HDNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVKSGPFDVF----VGTIDYAAPEVLGG 1150

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
              Y               G+P D+W+ G ++Y +IY + P+ +         I++ D++I
Sbjct: 1151 EPYE--------------GKPQDIWAIGVLLYTIIYKENPFYNID------EILDGDLRI 1190

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                   +  ++    + L++  L R+  KR T+D ++  ++LQ
Sbjct: 1191 ------QSTHEVSAECVALIRKILNRSVSKRPTIDDIMEDSWLQ 1228

>NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341
          Length = 1836

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 138/322 (42%), Gaps = 52/322 (16%)

Query: 429  ATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSF-DAFDDSSID 486
            A+S SN +M      +++K   +G G    V+  V     ++ A+K +   D+     I 
Sbjct: 1519 ASSMSNLSM------RWQKRNFIGGGTFGTVFSAVNLDNGEILAVKEIRIQDSTTMKKIF 1572

Query: 487  GFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFV 545
                E            ++Q    E+    + + ME C    L+ +L + G +  D    
Sbjct: 1573 PLIKEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLL-EHGRIE-DEMVT 1630

Query: 546  RFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYR--- 601
            + Y  E+L+ +  +H AG+VH D+KP N +L   GI+K +DFG A  + ++   I     
Sbjct: 1631 QIYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRIPNLNK 1690

Query: 602  -----------------ETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWS 644
                                +GTP YMAPE++              GN  K G   D+WS
Sbjct: 1691 KNGAEPEVEEDADGGKVHDMMGTPMYMAPESITG-----------PGNTGKFGS-DDIWS 1738

Query: 645  CGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYR 704
             GC+V +M+ G+ P+ +   +    AIM        P+  + DE  P +    ++ CL +
Sbjct: 1739 LGCVVLEMVTGRRPWANLDNE---WAIMYHVAAGHTPQLPNADEVTP-AGRAFLQRCLVQ 1794

Query: 705  NPDKRWTVDKVLNSTFLQPFMI 726
            +P  R T  ++L    + P+++
Sbjct: 1795 DPKSRATAVELL----IDPWIV 1812

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 131/284 (46%), Gaps = 33/284 (11%)

Query: 445 YEKIELLGRGGSSRVYKVKGSG-NKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           Y+ +  +G+G S  VY     G N   A+K+++ +      +     EI           
Sbjct: 667 YKNLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKEL--IINEILVMKASKHA-N 723

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  +D  +  G L+++ME  +   L+ ++    +  L    +   ++E L+ ++ +H  
Sbjct: 724 IVNFIDSYLLRGDLWVVMEYMEGGSLTDVVT---HCILTEGQIGAVSRETLKGLQFLHSK 780

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           G++H D+K  N +L + G +K+ DFG    + E  +N+ R T +GTP +MAPE +    Y
Sbjct: 781 GVIHRDIKSDNVLLSMSGEIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVVSRKEY 838

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL-LAIMNPDVKIPF 680
                          G   D+WS G ++ +MI G+PPY +      L L   N   ++  
Sbjct: 839 ---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKD 883

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
            +  S+D K        +  CL+ NPD+R T  ++L+  F+  +
Sbjct: 884 ADSLSDDLK------SFLGWCLHVNPDERATASQLLSDPFISTY 921

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/355 (24%), Positives = 154/355 (43%), Gaps = 68/355 (19%)

Query: 429  ATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDG 487
            A+S SN +M      +++K   +G G    VY  V     ++ A+K +     D +++  
Sbjct: 1253 ASSISNVSM------RWQKRNFVGGGTFGTVYSAVNLDNGEILAVKEIKIQ--DANAMKK 1304

Query: 488  FKGEIXXXXXXXXXXR---VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFN 543
            F   I              V+Q    E+    + + ME C    ++ +L + G +  D  
Sbjct: 1305 FFPSIKEEMSVLEMLSHPNVVQYYGVEVHRDKVNIFMEYCEGGSMASLL-EHGRIE-DEM 1362

Query: 544  FVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVN---- 598
              + Y  E+L+ +  +H +G+VH D+KP N +L   GI+K +DFG A  + ++  +    
Sbjct: 1363 VTQVYTLELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGF 1422

Query: 599  ---------------------IYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVG 637
                                 +  +  +GTP YMAPE++               NK ++G
Sbjct: 1423 ARSVASDSSTGSADNTSEQDGLALQDMMGTPMYMAPESITG-----------SPNKGRLG 1471

Query: 638  RPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIEL 697
               D+WS GC++ +MI G+ P+     +    AIM        P+  SNDE +  +  + 
Sbjct: 1472 -ADDIWSLGCVILEMITGRRPWAKLDNE---WAIMYHVAAGHIPQLPSNDE-VSSAGKKF 1526

Query: 698  MKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDN 752
            ++ CL  NP KR +  ++L    + P+++        IR+     S++ QI  D+
Sbjct: 1527 LRRCLQENPFKRASAVELL----MDPWIVQ-------IRDLAFGPSDQAQIPDDS 1570

>TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056
           bp, 351 aa] {ON} Anc_8.490 YPL042C
          Length = 351

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 118/254 (46%), Gaps = 58/254 (22%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           SQ++++E LG G  + VYK       VY ALK V  D+ + +     + EI         
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHN 63

Query: 502 XRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR-------------------------G 536
             +++L D    +  L L+ E  D DL + ++ R                         G
Sbjct: 64  -NIVRLYDVIHTENKLTLVFEYMDKDLKKFMDARSLAHANQLNANANQNINSGNPMGNNG 122

Query: 537 N-------MSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGI 588
           N       + L+ N V+++  ++L+ +   H+  I+H DLKP N ++  KG LK+ DFG+
Sbjct: 123 NSNSKTQPIGLELNLVKYFQWQLLEGVAYCHENKILHRDLKPQNLLIDNKGQLKLGDFGL 182

Query: 589 ANA--VPEHTVNIYRETQIGTPNYMAPEALV-AMNYTQNNDNRHDGNKWKVGRPSDMWSC 645
           A A  +P +T +    +++ T  Y AP+ L+ + NY+ +                DMWSC
Sbjct: 183 ARAFGIPVNTFS----SEVVTLWYRAPDVLMGSRNYSTS---------------IDMWSC 223

Query: 646 GCIVYQMIYGKPPY 659
           GCI+ +MI GKP +
Sbjct: 224 GCILAEMIAGKPLF 237

>SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 531

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 100/228 (43%), Gaps = 52/228 (22%)

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           R+  +L Y  G  L Y + E G              +LD   V FYA E+   +K +HD 
Sbjct: 225 RLYLVLQYIPGGELFYHLKEQG--------------TLDEQTVSFYAAEISCALKFLHDR 270

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIA-NAVPEHTVNIYRETQ--------------IG 606
           GIV+ DLKP N +L  KG L + DFG++  +V E        T+              IG
Sbjct: 271 GIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVGEAGSPAATATETNHDGEPVTALYSIIG 330

Query: 607 TPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQN 666
           TP Y APE L  + YTQ                 D +S GC+VY M+ GKPPY     + 
Sbjct: 331 TPEYCAPEILQGVPYTQI---------------CDWYSLGCLVYDMLIGKPPYTGANHKV 375

Query: 667 RLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDK 714
            L  I+  D     P + S+  K      + + A L ++  KRW VD+
Sbjct: 376 ILHKIVK-DKTPKIPMYLSDGMK------DFLGALLKKDVGKRWDVDR 416

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 99/211 (46%), Gaps = 30/211 (14%)

Query: 517 LYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYL++E  D  +L   L  RG +  +   V ++ K+++Q +   H   I H DLKP N +
Sbjct: 217 LYLVLEYVDGGELFDYLVSRGKLG-EREAVHYF-KQIVQGVSYCHSFNICHRDLKPENLL 274

Query: 576 LVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNK 633
           L K    +KI DFG+A        N   +T  G+P+Y +PE ++   Y       H G  
Sbjct: 275 LDKKNKSIKIADFGMAAL---EVSNKLLQTSCGSPHYASPEIVMGRPY-------HGG-- 322

Query: 634 WKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKS 693
                PSD+WSCG I++ ++ G  P+     +  LL + +    +P        + +   
Sbjct: 323 -----PSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMP--------QNLSAE 369

Query: 694 AIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
           A +LM   L  NP KR   +++LN   L  +
Sbjct: 370 AKDLMSKILVVNPFKRIATEEILNHPLLTKY 400

>Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {ON}
            YCR073C (REAL)
          Length = 1340

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 131/301 (43%), Gaps = 39/301 (12%)

Query: 444  QYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSF-DAFDDSSIDGFKGEIXXXXXXXXX 501
            +++K   +G G   +VY  +     ++ A+K ++  D      +     E          
Sbjct: 1032 RWQKRSFIGGGAFGKVYSAINLENGEILAVKEINIHDTNTMKKVFPLIKEEMTVLEMLNH 1091

Query: 502  XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
              ++Q    E+    + + ME C    L+  L   G +  D    + Y  E+L+ +  +H
Sbjct: 1092 PNIVQYYGVEVHRDKVNIFMEYCEGGSLASCLLDHGRIE-DEMVTQVYTLELLEGLAYLH 1150

Query: 561  DAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPE-HTVNIYRET-------------QI 605
             +G+VH D+KP N +L   GI+K +DFG A  V E  T  +  ET              +
Sbjct: 1151 RSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVESSTRALQNETSQEIEAEPNPINGMM 1210

Query: 606  GTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQ 665
            GTP YMAPEA+                K K+G   D+W+ GC+V +M  G+ P+ +   +
Sbjct: 1211 GTPMYMAPEAISG-----------SAIKGKLG-ADDIWALGCVVLEMATGRRPWSNLDNE 1258

Query: 666  NRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFM 725
                AIM        P+  S DE  P +    ++ CL ++P +R T  ++L      P+M
Sbjct: 1259 ---WAIMYHVAAGYIPQLPSKDEITP-AGRAFLERCLVQDPTRRATAVELLTD----PWM 1310

Query: 726  I 726
            I
Sbjct: 1311 I 1311

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 126/283 (44%), Gaps = 37/283 (13%)

Query: 445 YEKIELLGRGGSSRVYKVKGSG-NKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           Y  +  +G+G S  VY     G N+  A+K+++ +      +     EI           
Sbjct: 611 YTNLVKIGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKEL--IINEILVMKGSRHP-N 667

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  +D  + DG L++IME  +   L+ ++    +  L    +    +E L  ++ +H  
Sbjct: 668 IVNFIDSYLLDGDLWVIMEYMEGGSLTDVVT---HCILTEGQIGAVCRETLSGLQFLHSK 724

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           G++H D+K  N +L + G +K+ DFG    + E  +N+ R T +GTP +MAPE +    Y
Sbjct: 725 GVLHRDIKSDNILLSISGDIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVVSRKEY 782

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM---NPDVKI 678
                          G   D+WS G ++ +MI G+PPY +      L  I     P++K 
Sbjct: 783 ---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKE 827

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           P        E +       +  CL  +P++R +   +LN  F+
Sbjct: 828 P--------ENLSAVLRNFLDWCLKVDPEQRASATDLLNDVFI 862

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 131/302 (43%), Gaps = 39/302 (12%)

Query: 444 QYEKIELLGRGGSSRVYKVKGSGNKV-YALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           +Y  +  +G+G S  VY       +   A+K+++F+      +     EI          
Sbjct: 564 KYVNLIKIGQGASGGVYTATDVNTEASVAIKKMNFEKQPKKEL--IVNEILVMKASRHE- 620

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            ++  +D    +G L++IME      L+ ++       L    +    +E L  ++ +H 
Sbjct: 621 NIVNFIDSYFLNGNLWVIMEYMKGGSLTDVVTH---CILTEQQISTVTRETLNGLRFLHS 677

Query: 562 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
            G++H D+K  N +L + G +K+ DFG    + E  +N+ R T +GTP +MAPE +    
Sbjct: 678 KGVIHRDIKSDNVLLSLSGDIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVVSRKE 735

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
           Y               G   D+WS G ++ +MI G+PPY +      L  I         
Sbjct: 736 Y---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIAT------- 773

Query: 681 PEHTSNDEKIPKSAIELMKA----CLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIR 736
             + + + K P S  E +KA    CL  +P +R +  ++LN  F+  F      +  L++
Sbjct: 774 --NGTPELKDPDSLSECLKAFLDWCLKVDPHERASATELLNDRFIVEFSEKTETLSPLVK 831

Query: 737 NA 738
            A
Sbjct: 832 LA 833

>Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON}
           (12601..15534) [2934 nt, 978 aa]
          Length = 977

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 134/282 (47%), Gaps = 35/282 (12%)

Query: 444 QYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           QY+   ++G+G    VYK V    N+V A+K V++D  +D  ++    EI          
Sbjct: 62  QYQLKAVIGKGSFGVVYKAVNRKTNQVVAIKEVNYD--NDEELNDIMSEIHLLKNLNHV- 118

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILN-QRGNMSLDFNFVRFYAKEMLQCIKVVH 560
            +++   +      LY+I+E C    L ++++  RG   ++    + Y ++ LQ +  +H
Sbjct: 119 NIVKYHGFIQKMDTLYIILEYCSRGSLKKLISPNRGIPEIE---AQSYIRQTLQGLSYLH 175

Query: 561 DAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
           + G++H D+K AN +L    ++K+ DFG++  V   ++ +   T  G+ N+MAPE +   
Sbjct: 176 EQGVIHRDIKSANLLLDSSNVVKLADFGVSTKVNNASMAM---TLAGSLNWMAPEII--- 229

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
                      GN+      SD+WS G  V +++ G PP+ +    N   AI N D  +P
Sbjct: 230 -----------GNR-GASTLSDIWSLGATVVELLTGNPPFHNLVDVNIYYAIEN-DTYLP 276

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
            PE+     K+   A   +  C  +N   R T  ++L   +L
Sbjct: 277 -PEN-----KVSHVAANFLSCCFQKNMYLRPTAKQLLQHEWL 312

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 134/298 (44%), Gaps = 33/298 (11%)

Query: 445 YEKIELLGRGGSSRVYKVKGSG-NKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
           Y  +  +G+G S  VY     G N   A+K+++ +      +     EI           
Sbjct: 329 YRNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKEL--IINEILVMKGSKHS-N 385

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           ++  +D  +  G L+++ME  +   L+ ++    +  L    +    +E L+ ++ +H  
Sbjct: 386 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVT---HCILTEGQIGAVCRETLKGLQFLHSK 442

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           G++H D+K  N +L + G +K+ DFG    + E  VN+ R T +GTP +MAPE +    Y
Sbjct: 443 GVIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VNLKRTTMVGTPYWMAPEVVSRKEY 500

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL-LAIMNPDVKIPF 680
                          G   D+WS G ++ +MI G+PPY +      L L   N   K+  
Sbjct: 501 ---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKD 545

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNA 738
           PE+ S+  K      E +  CL  +P+ R    ++L+ TF+  +      +  L++ A
Sbjct: 546 PENLSDTLK------EFLGWCLKVDPEDRANAAELLSGTFISTYAEKNECLAPLVKLA 597

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 110/222 (49%), Gaps = 35/222 (15%)

Query: 504 VIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           +I+L      +  LY ++E   + D   I+ + G  SL+     +Y+ +++  IK +H  
Sbjct: 231 IIRLYFTFQDEASLYFLLEYAPNGDFLSIMKKYG--SLNEECTCYYSAQIIDAIKFLHQR 288

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIA------NAVPEHTVNIYRETQ--IGTPNYMAP 613
           GI+H D+KP N +L K + +K+ DFG A      +     T +++  ++  +GT  Y++P
Sbjct: 289 GIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQASGETYDLHTRSKSFVGTAEYVSP 348

Query: 614 EALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMN 673
           E L        NDN      W V    D+W+ GCIV+QMI GKPP   F+  N  L    
Sbjct: 349 ELL--------NDN------W-VDYRCDIWAFGCIVFQMIAGKPP---FKATNEYLTFQK 390

Query: 674 PDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKV 715
             +K+ +    +     P    +L+K  L R PD+R ++ ++
Sbjct: 391 -VMKVQY----AFTAGFPVVVRDLVKRILLRQPDQRLSIPQI 427

>KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]
           {ON} highly similar to uniprot|P14681 Saccharomyces
           cerevisiae YGR040W KSS1 Mitogen-activated protein kinase
           (MAPK) involved in signal transduction pathways that
           control filamentous growth and pheromone response
          Length = 365

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/319 (25%), Positives = 139/319 (43%), Gaps = 59/319 (18%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXX 500
           S Y+ +EL+G G    V     K SG KV A+K++   A     +     E+        
Sbjct: 11  SCYQLVELVGEGAYGTVCSAVHKPSGTKV-AIKKIQPFA-KQMFVTRTLRELKLLKLFHS 68

Query: 501 XXRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQC 555
              +I +LD      +     +YL+ E  + DL ++++  G+ SL  + ++++  ++L+ 
Sbjct: 69  HENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISGGGS-SLSDDHIQYFTYQILRA 127

Query: 556 IKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT-----VNIYRETQIGTPN 609
           +K +H A ++H D+KP+N +L     LK+ DFG+A  +   T     +  +    + T  
Sbjct: 128 LKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSTHSRQNLVGFMTEYVATRW 187

Query: 610 YMAPEALVAM-NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRL 668
           Y APE ++    YT                  D+WSCGCI+ +MI GKP +      ++L
Sbjct: 188 YRAPEIMLTFQQYTTA---------------MDIWSCGCILAEMITGKPLFPGRDYHHQL 232

Query: 669 LAIMNPDVKIPFPEHTSN---------------DEKIP-----------KSAIELMKACL 702
             I+   V  P  E   N                +K+P             AI+L+   L
Sbjct: 233 WLILEA-VGTPSYEDFENINSKRAKEYIANLPLRQKLPWQVVLQTQEVNPDAIDLLDRML 291

Query: 703 YRNPDKRWTVDKVLNSTFL 721
             NPDKR +  + L+  +L
Sbjct: 292 TFNPDKRISAVEALSHPYL 310

>TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6.371
           YCR091W
          Length = 889

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 138/314 (43%), Gaps = 50/314 (15%)

Query: 424 EPART----ATSSSNRNM-ITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVS- 476
           EP R+    A S SN+   I V+   +EKI LLG+G   +VY V+  + +++YALK  S 
Sbjct: 461 EPKRSNRLRAKSFSNKFQDIVVSPQAFEKIRLLGQGDVGKVYLVREKASSRLYALKIFSK 520

Query: 477 FDAFDDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQR 535
            +      I     E            ++ L      +  LYL ME C   +  + L  R
Sbjct: 521 AEMIKRKKIKRVLVE-QEILATSEHPFIVNLYHSFQSEDYLYLCMEYCMGGEFFRALQTR 579

Query: 536 GNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIA----- 589
               +  +  RFYA E++  ++ +H  G ++ DLKP N +L K G + + DF ++     
Sbjct: 580 KTKCISEDDARFYAAEVVAALEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSIQTTS 639

Query: 590 -----------NAVPEHTV---NIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWK 635
                      +AV +  +        + +GT  Y+APE +           R +G+   
Sbjct: 640 SKEPVVKKLAQSAVVDTKICSDGFRTNSFVGTEEYIAPEVI-----------RGNGHTAA 688

Query: 636 VGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAI 695
           V    D W+ G ++Y+M++G  P+      +    I+  DV  P      N+ +I ++  
Sbjct: 689 V----DWWTLGILIYEMLFGFTPFKGDNTNDTFCNILKDDVTFP------NNNEISRNCK 738

Query: 696 ELMKACLYRNPDKR 709
           +L+K  L +N  KR
Sbjct: 739 DLIKKLLTKNELKR 752

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 97/211 (45%), Gaps = 30/211 (14%)

Query: 517 LYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFV 575
           LYL++E  D  +L   L  RG   L       Y K+++Q +   H   I H DLKP N +
Sbjct: 174 LYLVLEYVDGGELFDYLVSRG--KLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLL 231

Query: 576 LVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNK 633
           L K   I+KI DFG+A        +    T  G+P+Y +PE ++  +Y            
Sbjct: 232 LDKKNKIIKIADFGMAAL---EVSDKLLSTSCGSPHYASPEIVMGKSYH----------- 277

Query: 634 WKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKS 693
              G P+D+WSCG I++ ++ G  P+     +  LL + +    +P          +   
Sbjct: 278 ---GSPTDVWSCGIILFALLTGHLPFNHDNIKKLLLKVQSGVYHMP--------SDLSPD 326

Query: 694 AIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
           A +L+   L  +PDKR T  ++LN + +  +
Sbjct: 327 AKDLISKILVVDPDKRLTTTEILNHSLITKY 357

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 111/223 (49%), Gaps = 37/223 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            ++ LLD+   D   Y+      E G  DL  ++  + NM+ +F   +   K+++  IK +
Sbjct: 1190 ILSLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMT-EFE-AKLIFKQIVSGIKHL 1247

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++  KG +KIIDFG A  V     +++    +GT +Y APE L  
Sbjct: 1248 HDQGIVHRDIKDENVIVDSKGCVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPEVLSG 1303

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
              Y               G+P D+W+ G ++Y +++ + P+ +         I+  ++K 
Sbjct: 1304 EPYE--------------GKPQDIWAIGILLYTIVFKENPFYNID------EILEGELKF 1343

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
                + SND  I +  IEL+K  L R+  KR  ++++ N  +L
Sbjct: 1344 ----NNSND--ISEDCIELIKKILIRSVPKRPLIEEIFNDKWL 1380

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 126/283 (44%), Gaps = 37/283 (13%)

Query: 445  YEKIELLGRGGSSRVYKVKGSG-NKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXXR 503
            Y  +  +G+G S  VY     G N   A+K+++ +    + +     EI           
Sbjct: 1027 YRNLVKIGQGASGGVYTAYEVGTNASVAVKQMNLEKQPKTEL--IINEIIVMKESKHK-N 1083

Query: 504  VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
            ++  +D  +  G L+++ME  +   L+ ++       L    +    +E L  +K +H  
Sbjct: 1084 IVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTH---CILTEGQIGAVCRETLNGLKFLHSK 1140

Query: 563  GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
            G++H D+K  N +L ++G +K+ DFG    + E  V++ R T +GTP +MAPE +    Y
Sbjct: 1141 GVIHRDIKSDNILLSMQGDIKLTDFGFCAQINE--VHLKRTTMVGTPYWMAPEVVSRKEY 1198

Query: 622  TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM---NPDVKI 678
                           G   D+WS G ++ +MI G+PPY +      L  I     P++K 
Sbjct: 1199 ---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKE 1243

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
            P        EK+       + ACL  +P+ R T  ++L +  +
Sbjct: 1244 P--------EKLSSILHNFLDACLKVDPEVRATATELLETELI 1278

>TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON}
            Anc_6.371 YCR091W
          Length = 1248

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 133/310 (42%), Gaps = 53/310 (17%)

Query: 427  RTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVSFDAFDDSSI 485
            RT + S+    ITV  + +EKI LLG+G   +VY VK  S +++YALK      F+ S +
Sbjct: 834  RTKSFSNKFKDITVGPTSFEKIRLLGQGDVGKVYLVKEKSTSRLYALK-----IFNKSQM 888

Query: 486  ---DGFKGEIXXXXXXXXXXR--VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMS 539
                  K  +             ++ L      +  LYL +E C   +  + L  R +  
Sbjct: 889  IKRKKIKRVLAEQEILASSNHPFIVTLYHSFQSEDYLYLCIEYCMGGEFFRALQTRRSKC 948

Query: 540  LDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKG---ILKIIDFGIANAVPEHT 596
            +  +  RFYA E+   ++ +H  G ++ DLKP N +L K    +L   D  I + V ++ 
Sbjct: 949  ISEDAARFYASEVTAALEYLHLMGYIYRDLKPENILLHKSGHIMLSDFDLSIQSKVAKNP 1008

Query: 597  V-----------------NIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRP 639
            V                      + +GT  Y+APE +           R +G+   V   
Sbjct: 1009 VVKKFNQSSLVDTKICSEGFRTNSFVGTEEYIAPEVI-----------RGNGHTAAV--- 1054

Query: 640  SDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMK 699
             D W+ G ++Y+M++G  P+           I+  +V  P      N+  I ++  +++K
Sbjct: 1055 -DWWTLGILIYEMLFGFTPFKGDSTNETFSNILKNEVSFP------NNNDITRNCKDVIK 1107

Query: 700  ACLYRNPDKR 709
              L +N +KR
Sbjct: 1108 KLLTKNENKR 1117

>CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028c
          Length = 542

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 92/324 (28%), Positives = 140/324 (43%), Gaps = 69/324 (21%)

Query: 435 RNMITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKVYALKRV---------------SFD 478
           R  I+   S ++ I +LG+G   +V  VK    +K+YA+K++               S D
Sbjct: 135 RTGISREISDFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEILIAPTDANTESMD 194

Query: 479 AFD--DSSIDGFKGEIXXXXXXXXXXRVI--QL-------LDYEMGD-GLLYLIME-CGD 525
                D  +D    ++          R I  QL       L Y   D   LYL+++    
Sbjct: 195 KLAELDKPVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPG 254

Query: 526 HDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILKII 584
            +L   L + G +  D   V FYA E+   +K +H  G+V+ DLKP N +L + G L + 
Sbjct: 255 GELFFHLKEHGTLEEDT--VAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLT 312

Query: 585 DFGI----ANAVPEHTVNIYRETQ--------IGTPNYMAPEALVAMNYTQNNDNRHDGN 632
           DFG+    A+   +  +    E +        IGTP Y APE L+   YT N        
Sbjct: 313 DFGLSKSSASNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTAN-------- 364

Query: 633 KWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLA--IMNPDVKIPFPEHTSNDEKI 690
                   D +S GC++Y M+ GKPPY      ++++A  I N       P + S+  K 
Sbjct: 365 -------CDWYSLGCLLYDMLTGKPPYTG--ANHKVIANKIKNDKQGPKIPYYLSDGMK- 414

Query: 691 PKSAIELMKACLYRNPDKRWTVDK 714
                +++ A L  +P KRW VDK
Sbjct: 415 -----DVLGALLKSDPKKRWDVDK 433

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 107/265 (40%), Gaps = 71/265 (26%)

Query: 504 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNM----------------------SL 540
           +++L+D E      YLIME C   DL+ ++ +R  +                       L
Sbjct: 106 IVKLIDCERTTTDFYLIMEYCALGDLTFLIKKRHELIKNHPLLEKIFEKYPSPNENYNGL 165

Query: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKG--------------------- 579
              F+  Y +++   +K +    +VH D+KP N +L+                       
Sbjct: 166 HRAFILNYLQQLASALKFLRSKNLVHRDIKPQNLLLLTPLINYNDSKAFKKLGFIGIYEL 225

Query: 580 -ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGR 638
            ILKI DFG A  +P  ++    ET  G+P YMAPE L               N  K   
Sbjct: 226 PILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL---------------NYQKYNA 267

Query: 639 PSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEH--TSNDEKIPKSAIE 696
            +D+WS G ++Y+M YG PP+ +         I   + KI FP +    ND KI      
Sbjct: 268 KADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYIQIQNDMKI------ 321

Query: 697 LMKACLYRNPDKRWTVDKVLNSTFL 721
           L+   L  +P +R   D+  N+  +
Sbjct: 322 LISKLLTFDPQRRIEFDEFFNNNLV 346

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 127/281 (45%), Gaps = 35/281 (12%)

Query: 444 QYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           QY   +++GRG    VYK +    ++V A+K + +++  D  ++    EI          
Sbjct: 24  QYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEIVYES--DEELNDIMAEISLLKNLNHD- 80

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            +++   +      LY+++E C +  L ++++ R +  L  N  + Y  + L  +K +H 
Sbjct: 81  NIVKYHGFIRKSYELYILLEYCANGSLRRLIS-RSSTGLSENESKSYVTQTLLGLKYLHG 139

Query: 562 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
            G++H D+K AN +L     +K+ DFG++  V    +     T  GT N+MAPE L    
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-----TLAGTLNWMAPEIL---- 190

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
                     GN+      SD+WS G  V +M+   PPY +    N   A+ N D   P 
Sbjct: 191 ----------GNR-GASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEN-DTYYP- 237

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           P   S   K      + +  C  +N  KR T D++L   ++
Sbjct: 238 PSSFSESLK------DFLSKCFVKNMYKRPTADQLLKHAWI 272

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 118/239 (49%), Gaps = 33/239 (13%)

Query: 437 MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXX 495
           M + +  +++++E LG G  + VYK       +Y ALK V  D+ + +     + EI   
Sbjct: 1   MTSTSHIRFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLM 59

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNM----SLDFNFVRFYAKE 551
                   +++L D    +  L L+ E  D+DL + ++ R +      L+ + V+++  +
Sbjct: 60  KELKHE-NIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQ 118

Query: 552 MLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTP 608
           +LQ +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T 
Sbjct: 119 LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTL 174

Query: 609 NYMAPEALV-AMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQN 666
            Y AP+ L+ +  Y  +                D+WSCGCI+ +MI GK     F G N
Sbjct: 175 WYRAPDVLMGSRTYCTS---------------IDIWSCGCILAEMIMGK---ALFPGTN 215

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 110/224 (49%), Gaps = 37/224 (16%)

Query: 504  VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            +++LLD+   D   Y+      E G  DL  ++  + +M    +  +   K+++  IK +
Sbjct: 909  ILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFKKDMVE--HEAKLVFKQVVASIKHL 966

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++   G +K+IDFG A  +     +++    +GT +Y APE L  
Sbjct: 967  HDQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGPFDVF----VGTMDYAAPEVL-- 1020

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        G+ +K G+P D+W+ G ++Y +IY + PY +         I+  +++ 
Sbjct: 1021 -----------GGSSYK-GKPQDIWALGVLLYTIIYKENPYYNID------EILEGELRF 1062

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
               EH S +       I L+K  L R  DKR T+D++    +L+
Sbjct: 1063 DKSEHVSEE------CISLIKRILTREVDKRPTIDEIYEDKWLK 1100

>KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {ON}
           Anc_3.177 YAR019C
          Length = 936

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 148/335 (44%), Gaps = 34/335 (10%)

Query: 423 VEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFD 481
           ++     T +   N  + N   Y+  +++G+G    VYK +     +V A+K + ++  +
Sbjct: 7   IQDQVNVTPAQQTNERSTNSVSYQLKQVIGKGSYGIVYKAINRRTEQVVAIKELYYN--N 64

Query: 482 DSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSL 540
           D+ +     EI           +I+   +      LY+I+E   H  L  ++ QR    L
Sbjct: 65  DTELQDIMVEIDLLKNLDHV-NIIKYHGFIQKLSNLYIILEFASHGSLKNLMMQRPEKHL 123

Query: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNI 599
           +    R Y K+ +  +  +H+ G++H D+K AN +L     +K+ DFG++ +V    +  
Sbjct: 124 NEKETRIYIKQTINGLVYLHEQGVIHRDIKAANLLLDASNTIKLADFGVSTSVANSAM-- 181

Query: 600 YRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY 659
              T  G+ N+MAPE +               NK      SD+WS G  + +++ G PP+
Sbjct: 182 ---TLAGSLNWMAPEIIT--------------NK-GASTLSDIWSLGATIIELLTGNPPF 223

Query: 660 GSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNST 719
                 N   AI N DV +P PE+ S + +       ++  C  +N  KR +   +L   
Sbjct: 224 HKLMDINIYYAIEN-DVFLP-PENLSTNCQ------NILNLCFQKNMFKRPSAVSLLKHP 275

Query: 720 FLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLN 754
           +L+    S  + E+L   + ++   +     D+LN
Sbjct: 276 WLKDITQSTQLPENLDFKSAKFLQFREDFEKDDLN 310

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 127/281 (45%), Gaps = 35/281 (12%)

Query: 444 QYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           QY   +++GRG    VYK +    ++V A+K + ++  +D  ++    EI          
Sbjct: 24  QYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEIVYE--NDEELNDIMAEISLLKNLNHH- 80

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            +++   +      LY+++E C +  L ++++ R +  L  N  + Y  + L  +K +H 
Sbjct: 81  NIVKYHGFIRKSYELYILLEYCANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 562 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
            G++H D+K AN +L     +K+ DFG++  V    +     T  GT N+MAPE L    
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-----TLAGTLNWMAPEIL---- 190

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
                     GN+      SD+WS G  V +M+   PPY +    N   A+ N D   P 
Sbjct: 191 ----------GNR-GASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEN-DTYYP- 237

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           P   S   K      + +  C  +N  KR T D++L   ++
Sbjct: 238 PSSFSESLK------DFLSKCFVKNMYKRPTADQLLKHVWI 272

>KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3.177
           YAR019C
          Length = 980

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 136/289 (47%), Gaps = 42/289 (14%)

Query: 441 NDSQYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXX 499
           N ++Y+  +++G+G    VYK V  S  +V A+K +++ +  D  ++    EI       
Sbjct: 27  NSTKYQLNQVIGKGSYGIVYKAVNKSTKQVVAIKEINYTS--DEELN----EIMIEIDLL 80

Query: 500 XXXRVIQLLDY-----EMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEML 553
                I ++ Y     +M +  LY+I+E   H  L  +L+ R    LD    + Y ++ L
Sbjct: 81  KNLHHINIVKYHGFIQKMSN--LYIILEYAAHGSLKGLLSSRIGHLLDEAETKIYVRQTL 138

Query: 554 QCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 612
             +  +H+ G++H D+K AN +L     +K+ DFG++       VN   +T  G+ N+MA
Sbjct: 139 DGLAYLHEQGVIHRDIKAANLLLDSTNTVKLADFGVSTK-----VNNTAKTLAGSLNWMA 193

Query: 613 PEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM 672
           PE +               NK      SD+WS G  + +++ GKPP+ +    N   A+ 
Sbjct: 194 PEIVT--------------NK-GASTLSDIWSLGATIVELMTGKPPFHNLLDINIYYAME 238

Query: 673 NPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           N D +  +P  +     +P+ A + +  C  +N  KR T   +L  ++L
Sbjct: 239 N-DNECYYPPAS-----LPEGAKQFLALCFQKNMFKRPTAKSLLKHSWL 281

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 129/282 (45%), Gaps = 28/282 (9%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGN-KVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           S Y   E +GRG    VYK     N  + A+K V+ +  ++  ID    EI         
Sbjct: 13  SIYSIQECVGRGNFGDVYKAFDKTNGAIVAVKVVNLEHTEED-IDLLAQEIFFLAELRSP 71

Query: 502 XRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             +   +   + D  ++++ME CG    S ++       L  N V F  +E+L+ +K +H
Sbjct: 72  Y-ITNYITTMIEDVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLH 130

Query: 561 DAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
           D   +H D+K AN +L  +G +K+ DFG++  +      + R T +GTP +MAPE +   
Sbjct: 131 DQKKIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATMKRGTFVGTPYWMAPEVV--- 184

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 679
           N   N  N            +D+WS G  VY+++ G PP         ++++  P  K P
Sbjct: 185 NKESNGYNEK----------ADIWSLGITVYELLKGLPPLSKCDPMKVMVSL--PRRKPP 232

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
                 +D      A   + ACL ++P+ R + + +L + F+
Sbjct: 233 KLHGQYSD-----VAKGFVAACLVKDPNLRPSAEMLLTNEFV 269

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 127/281 (45%), Gaps = 35/281 (12%)

Query: 444 QYEKIELLGRGGSSRVYK-VKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           QY   +++GRG    VYK +    ++V A+K V ++  +D  ++    EI          
Sbjct: 24  QYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYE--NDEELNDIMAEISLLKNLNHN- 80

Query: 503 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHD 561
            +++   +      LY+++E C +  L ++++ R +  L  N  + Y  + L  +K +H 
Sbjct: 81  NIVKYHGFIRKSYELYILLEYCANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 562 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 620
            G++H D+K AN +L     +K+ DFG++  V    +     T  GT N+MAPE L    
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-----TLAGTLNWMAPEIL---- 190

Query: 621 YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 680
                     GN+      SD+WS G  V +M+   PPY +    N   A+ N D   P 
Sbjct: 191 ----------GNR-GASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEN-DTYYP- 237

Query: 681 PEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFL 721
           P   S   K      + +  C  +N  KR T D++L   ++
Sbjct: 238 PSSFSEPLK------DFLSKCFVKNMYKRPTADQLLKHVWI 272

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 109/224 (48%), Gaps = 37/224 (16%)

Query: 504  VIQLLDYEMGDGLLYLIMEC----GDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
            ++ LLD+   D   Y+        G  DL  ++  + +M+     + F  K++   IK +
Sbjct: 1021 ILMLLDFFEDDDYYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLIF--KQIASGIKNL 1078

Query: 560  HDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
            HD GIVH D+K  N ++   G +KI+DFG A  V     +++    +GT +Y APE L  
Sbjct: 1079 HDNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGPFDVF----VGTIDYAAPEVLGG 1134

Query: 619  MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
              Y               G+P D+W+ G ++Y +IY + P+ +         I++ D+++
Sbjct: 1135 EPYE--------------GKPQDIWAIGVLLYTIIYKENPFYNID------EILDADLRV 1174

Query: 679  PFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
                  ++ E+I    I L++  L R+  KR ++D++ N  +L+
Sbjct: 1175 ------NSSERISDDCIALIRKILNRSVSKRPSIDEICNHKWLE 1212

>TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.371
           YCR091W
          Length = 730

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 129/296 (43%), Gaps = 48/296 (16%)

Query: 438 ITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKVYALKRVS-FDAFDDSSIDGFKGEIXXX 495
           I V    +EK+ LLG+G   +VY V+    NK++ALK +S  +      +     E    
Sbjct: 327 IKVGPKSFEKVRLLGQGDIGKVYLVREKKTNKLFALKILSKSEMIKRKKVRRILTE-QEI 385

Query: 496 XXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQ 554
                   ++ L         LY+ ME C   +  + L  R N  +  N  RFYA E++ 
Sbjct: 386 LATSDHPFIVTLYHTFQTKTYLYICMEYCMGGEFFRALQTRENKCISENAARFYASEVVA 445

Query: 555 CIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIA--------NAVPEHTVNIYRETQ- 604
            ++ +H  G ++ DLKP N +L K G + + DF ++          +   T N Y +T+ 
Sbjct: 446 ALEYLHLLGFIYRDLKPENILLHKSGHIMLADFDLSIQSQSDSEPVIDSLTNNAYIDTKK 505

Query: 605 ----------IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIY 654
                     +GT  Y+APE +           R +G+   V    D W+ G +VY+M+Y
Sbjct: 506 ISEGFRTNSFVGTEEYIAPEVI-----------RGNGHTTAV----DWWTLGILVYEMLY 550

Query: 655 GKPPYGSFQGQNRLLAIMN-PDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKR 709
           G   Y  F+G+N      N    ++ F  H      I K+  +L+K  L +N  KR
Sbjct: 551 G---YSPFKGRNTNETFSNIIKEQVSFQGH-----DISKTGKDLIKKLLIKNEIKR 598

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 110/226 (48%), Gaps = 32/226 (14%)

Query: 504 VIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           VI+L      +  LY ++E   + D   ++ + G  SL+    R+Y  +ML  I  +H  
Sbjct: 243 VIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFG--SLNEECCRYYGAQMLDAIDFIHKN 300

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAV---PEHTVNIYRETQ--IGTPNYMAPEAL 616
           G+VH D+KP N +L + + +K+ DFG A  +    +   N+ ++++  +GT  Y++PE L
Sbjct: 301 GVVHRDIKPENILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSFVGTAEYVSPELL 360

Query: 617 VAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDV 676
                   NDN        V    D+W+ GCI+YQMI GKPP   F+  N  L      +
Sbjct: 361 --------NDN-------CVNYKCDIWAFGCILYQMIAGKPP---FKATNEYLTFQK-VM 401

Query: 677 KIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
           K+ +    +     P    +L+K  L ++P+ R    +V +  F +
Sbjct: 402 KVQY----AFTAGFPLVIRDLVKQLLVKSPEARLNASQVKSHHFFK 443

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 111/225 (49%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D       LY+++E  +  +L  +L +RG +  +   VRF+ ++++  I   H  
Sbjct: 91  VLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP-ENEAVRFF-RQIIIGISYCHAL 148

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +K+ DFG+A      + +   ET  G+P+Y APE +  + Y
Sbjct: 149 GIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLPY 205

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNR--LLAIMNPDVKIP 679
                          G  SD+WSCG I+Y ++ G+ P+    G  R  LL + + + ++P
Sbjct: 206 H--------------GFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMP 251

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 + ++I   A +L+   L  +P  R    ++L    L+ +
Sbjct: 252 ------DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKY 290

>Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047W
           (REAL)
          Length = 897

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 85/354 (24%), Positives = 146/354 (41%), Gaps = 52/354 (14%)

Query: 412 PKPPVTKKVEIVEP-----ARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVK-GS 465
           P+ P  K  +  EP      RT + S+    I V    +EKI LLG+G   +V+ V+   
Sbjct: 462 PQEPPPKISDFQEPRRSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKK 521

Query: 466 GNKVYALKRVSFDAF-DDSSIDGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-C 523
            N+VYALK +S +     + I     E            ++ L      +  LYL ME C
Sbjct: 522 TNRVYALKVLSKEEMIKRNKIKRVLTE-QEILATSNHPFIVTLYHSFQSEDYLYLCMEYC 580

Query: 524 GDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVK-GILK 582
              +  + L  R    +  +  RFYA E+   ++ +H  G ++ DLKP N +L + G + 
Sbjct: 581 MGGEFFRALQTRETKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIM 640

Query: 583 IIDFGIANAVPEHTVNIYRETQ-------------------IGTPNYMAPEALVAMNYTQ 623
           + DF ++    +  + + + +                    +GT  Y+APE +       
Sbjct: 641 LSDFDLSIQAKDSKIPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVI------- 693

Query: 624 NNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEH 683
               R +G+   V    D W+ G ++Y+M++G  P+           I+  +V  P    
Sbjct: 694 ----RGNGHTAAV----DWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFP---- 741

Query: 684 TSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRN 737
             N+ +I ++  +L+K  L +N  KR             PF   + +   L+RN
Sbjct: 742 --NNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFF--KKVQWSLLRN 791

>Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W
           (KSS1) - MAP protein kinase homolog involved in
           pheromone signal transduction [contig 242] FULL
          Length = 365

 Score = 84.7 bits (208), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 79/321 (24%), Positives = 141/321 (43%), Gaps = 63/321 (19%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRV---SFDAFDDSSIDGFKGEIXXXXX 497
           S Y+ +EL+G G    V     K SG KV A+K++   S + F   ++     E+     
Sbjct: 11  SCYQLVELVGEGAYGTVCSAVHKPSGTKV-AIKKIQPFSKEMFVTRTLR----ELKLLKL 65

Query: 498 XXXXXRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEM 552
                 +I +LD      +     +YL+ E  + DL ++++  G  SL  + ++++  ++
Sbjct: 66  FHSHENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISS-GGASLSDDHIQYFTYQI 124

Query: 553 LQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT-----VNIYRETQIG 606
           L+ +K +H A ++H D+KP+N +L     LK+ DFG+A  +   T     +  +    + 
Sbjct: 125 LRALKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLVGFMTEYVA 184

Query: 607 TPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQN 666
           T  Y APE ++               ++ V    D+WSCGCI+ +MI GKP +      +
Sbjct: 185 TRWYRAPEIMLTF------------QQYTVAM--DIWSCGCILAEMITGKPLFPGRDYHH 230

Query: 667 RLLAIM----NPDV----------------------KIPFPEHTSNDEKIPKSAIELMKA 700
           +L  I+     P                        K+P+ +     + I   A++L+  
Sbjct: 231 QLWLILEALGTPSYEDFENINSKRAKEYIANLPLRQKLPW-QVVLQKQDINPQAVDLLDK 289

Query: 701 CLYRNPDKRWTVDKVLNSTFL 721
            L  NPDKR +  + L   +L
Sbjct: 290 MLTFNPDKRISAAEALAHPYL 310

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 131/302 (43%), Gaps = 37/302 (12%)

Query: 443 SQYEKIELLGRGGSSRVYKVKGSGNKVY-ALKRVSFDAFDDSSIDGFKGEIXXXXXXXXX 501
           S+Y  +  +G+G S  VY       + Y A+K+++ +      +     EI         
Sbjct: 648 SKYTDLIKIGQGASGGVYTAHDPTREGYVAIKQMNLEKQPKKEL--IINEIIVMKESKHE 705

Query: 502 XRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVH 560
             ++  +D  +  G L++IME  +   L+ ++       L    V    +E L  ++ +H
Sbjct: 706 -NIVNFIDSYLLKGDLWVIMEYMEGGSLTDVVTH---CLLTEAQVGAVCRETLSGLQFLH 761

Query: 561 DAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 619
             G++H D+K  N +L ++G +K+ DFG    + E  +N+ R T +GTP +MAPE +   
Sbjct: 762 SKGVIHRDIKSDNILLSMRGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVVSRK 819

Query: 620 NYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIM---NPDV 676
            Y               G   D+WS G ++ +MI G+PPY +      L  I     P +
Sbjct: 820 EY---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSL 864

Query: 677 KIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIR 736
           K P        E +  +    +  CL  NPD+R +   +L   F+     S   +  L++
Sbjct: 865 KEP--------EALSDALNNFLGWCLKVNPDERASAKDLLLDPFITEIADSNESLAPLVK 916

Query: 737 NA 738
            A
Sbjct: 917 LA 918

>ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weakly
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047W Putative protein kinase that when overexpressed
           interferes with pheromone-induced growth arrest
           localizes to the cytoplasm potential Cdc28p substrate
           and some similarities with YCR091W uniprot|P25341
           Saccharomyces cerevisiae YCR091W KIN82 Putative
           serine/threonine protein kinase, most similar to cyclic
           nucleotide-dependent protein kinase subfamily and the
           protein kinase C subfamily
          Length = 860

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 152/350 (43%), Gaps = 55/350 (15%)

Query: 391 IINENEDVNVKNQEVFYHRPAPK---PPVTKKVEIVEPARTA----TSSSNR-NMITVND 442
           +++EN D N    +      +P    P V+   E  EP R++     S SN+ + I V  
Sbjct: 402 LVSENGDGNNATVQASIGSSSPSKASPQVSSDYE--EPKRSSRLRTKSFSNKFHDIKVGP 459

Query: 443 SQYEKIELLGRGGSSRVYKVKGS-GNKVYALKRVS-FDAFDDSSIDGFKGEIXXXXXXXX 500
             +EK+ +LG+G   +V+ V+    NK+YALK  S  +      I     E         
Sbjct: 460 GSFEKVRILGQGDVGKVFLVREKVSNKLYALKIFSKAEMIKRKKIKRILAE-QEILASSN 518

Query: 501 XXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVV 559
              ++ L      +  LYL ME C   +  + L  R +  +  +  RFYA E++  ++ +
Sbjct: 519 HPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRRSKCISEDDARFYASEVIAALEYL 578

Query: 560 HDAGIVHSDLKPANFVLVK-GILKIIDFG-----------IANAVPEHTV-------NIY 600
           H  G ++ DLKP N +L K G + + DF            +A    + T+       + +
Sbjct: 579 HLMGFIYRDLKPENILLHKSGHIMLSDFDLSIQAKDAKDPVAKGTAQSTIVDTKICSDGF 638

Query: 601 RETQ-IGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPY 659
           R    +GT  Y+APE +           R +G+   V    D W+ G ++Y+M++G  P+
Sbjct: 639 RTNSFVGTEEYIAPEVI-----------RGNGHTAAV----DWWTLGILIYEMLFGCTPF 683

Query: 660 GSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKR 709
            S         I+  +V  P     SND  I +S  +L+K  L +N  KR
Sbjct: 684 KSSNTNETFCNILKNEVNFP----NSND--IGRSCKDLIKKLLIKNELKR 727

>SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 368

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/327 (25%), Positives = 137/327 (41%), Gaps = 66/327 (20%)

Query: 443 SQYEKIELLGRGGSSRVYKV--KGSGNKVYALKRV---SFDAFDDSSIDGFKGEIXXXXX 497
           + Y+ ++L+G G    V     K SG KV A+K++   S   F   ++     E+     
Sbjct: 11  AHYQLVDLIGEGAYGTVCSAVHKPSGTKV-AIKKIQPFSKPLFVTRTLR----ELKLLKF 65

Query: 498 XXXXXRVIQLLDYEMGDGL-----LYLIMECGDHDLSQIL---NQRGNMSLDFNFVRFYA 549
                 +I +LD      L     +YL+ E  + DL +I+   N      L  + ++++ 
Sbjct: 66  FHDHENIISVLDIVRPTSLAKFDAVYLVQELMETDLHRIIANSNGHSGTPLSDDHIQYFV 125

Query: 550 KEMLQCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP------EHTVNIYRE 602
            +ML+ +K +H A ++H DLKP+N +L     LK+ DFG+A  +       E+ V    E
Sbjct: 126 YQMLRALKAMHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSSNSRENLVGFMTE 185

Query: 603 TQIGTPNYMAPEALVAMN-YTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGS 661
             + T  Y APE ++    YT                  D+WSCGCI+ +MI GKP +  
Sbjct: 186 -YVATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMITGKPLFPG 229

Query: 662 FQGQNRLLAIM------------------------NPDVKIPFPEHTSNDEKIPKSAIEL 697
               ++L  I+                        N  ++   P      + +   AI+L
Sbjct: 230 RDYHHQLWLILEVLGTPSYQDFEQIKSKRAKEYIANLPLRPRVPWKIVLGQHVNPDAIDL 289

Query: 698 MKACLYRNPDKRWTVDKVLNSTFLQPF 724
           +   L  NPDKR    + L   +L+ +
Sbjct: 290 LDKMLTFNPDKRIGASEALKHPYLKVY 316

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 109/225 (48%), Gaps = 29/225 (12%)

Query: 504 VIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           V++L D    +  LY+++E  +  +L  +L  RG +  +   VRF+ ++++  I   H  
Sbjct: 99  VLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLP-ENEAVRFF-RQIIIGISYCHAL 156

Query: 563 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
           GIVH DLKP N +L  K  +KI DFG+A      + +   ET  G+P+Y APE +  + Y
Sbjct: 157 GIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETSCGSPHYAAPEIVSGLPY 213

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQG--QNRLLAIMNPDVKIP 679
                          G  SD+WSCG I++ ++ G+ P+    G  +N LL + +   ++P
Sbjct: 214 H--------------GFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMP 259

Query: 680 FPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQPF 724
                 +  +I   A +L+   L  +P  R     +L    LQ +
Sbjct: 260 ------DTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKY 298

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/338 (24%), Positives = 145/338 (42%), Gaps = 46/338 (13%)

Query: 445 YEKIELLGRG--GSSRVYKVKGSGNKVYALKRVSFDAFDDSSIDGFKGEIXXXXXXXXXX 502
           Y+ ++ LG G  G  ++     +G KV ALK ++      S + G               
Sbjct: 46  YQIVKTLGEGSFGKVKLAYHMTTGQKV-ALKIINKKVLAKSDMQGRIEREISYLRLLRHP 104

Query: 503 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
            +I+L D       + ++ME   ++L   + QR  MS D    R + ++++  ++  H  
Sbjct: 105 HIIKLYDVIKSKDEIIMVMEYAGNELFDYIVQRDKMSEDE--ARRFFQQIISAVEYCHRH 162

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 621
            IVH DLKP N +L + + +KI DFG++N + +     + +T  G+PNY APE +    Y
Sbjct: 163 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 219

Query: 622 TQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFP 681
                          G   D+WSCG I+Y M+  + P+             +  + + F 
Sbjct: 220 A--------------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFK 253

Query: 682 EHTSNDEKIPK----SAIELMKACLYRNPDKRWTVDKVLNSTF----LQPFMISESI--- 730
              +    IPK     A  L+K  L  NP  R ++ +++   +    L  ++I + +   
Sbjct: 254 NINNGVYTIPKFLSQGASTLIKKMLIVNPLNRISIQEIMQDEWFKAGLPEYLIPQDLKQP 313

Query: 731 MEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYK 768
            E +         E P   +D ++D + TVL +   Y+
Sbjct: 314 TEGITSQPQEPNGEPPSQQNDEIDDELVTVLSRTMGYE 351

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 113/227 (49%), Gaps = 33/227 (14%)

Query: 504 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNMSLDFNFVRFYAKEMLQCIKVVHDA 562
           +I+L      +  LY ++E   + D   ++ + G+++ D +   +Y+ ++L  I  +H  
Sbjct: 224 IIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKYGSLNQDCSV--YYSAQILDAIDYLHQK 281

Query: 563 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPE----HTVNIYRETQ--IGTPNYMAPEA 615
           G++H D+KP N +L K + +K+ DFG A  V +     T N+   ++  +GT  Y++PE 
Sbjct: 282 GVIHRDIKPENILLDKDMKVKLTDFGTAKLVEKDETTQTYNLLERSKSFVGTAEYVSPEL 341

Query: 616 LVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPD 675
           L        NDN  D   +K     D+W+ GCI++QMI GKPP   F+  N  L      
Sbjct: 342 L--------NDNYVD---YKC----DIWAFGCILFQMIAGKPP---FKATNEYLTFQK-V 382

Query: 676 VKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTFLQ 722
           +K+ +    +     P    +L+K  L +NP++R    +V    F +
Sbjct: 383 MKVQY----AFTAGFPLIIRDLIKQILVKNPEQRLDTLQVKKHHFFK 425

>Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W
           (REAL)
          Length = 900

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/359 (24%), Positives = 147/359 (40%), Gaps = 78/359 (21%)

Query: 427 RTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKV--YALKRVSFDAFDDSS 484
           R  T+S N N++T +   Y   + +G+G  + VY+   + +K    A+K VS     +  
Sbjct: 13  RDQTTSVNHNLMT-SAGNYTAEKEIGKGSFATVYRGHLTSDKSQHIAIKEVSRAKLKNKK 71

Query: 485 I-DGFKGEIXXXXXXXXXXRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRGNM---- 538
           + +  + EI           ++ L+D E      YLIME C   DL+ +L +R  +    
Sbjct: 72  LLENLEIEIAILKKIKHP-HIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENH 130

Query: 539 ------------------SLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKG- 579
                              L   FV  Y +++   +K +    +VH D+KP N +L    
Sbjct: 131 PLLKTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPL 190

Query: 580 ---------------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 618
                                ILKI DFG A  +P  ++    ET  G+P YMAPE L  
Sbjct: 191 IGYHDSKTFHELGFVGIYNLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL-- 245

Query: 619 MNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 678
                        N  K    +D+WS G +V++M  G PP+ +         I   +  I
Sbjct: 246 -------------NYQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVI 292

Query: 679 PFPEHTSNDEKIPKSAIELMKACLYRNPDKR-----WTVDKVLNSTFLQPFMISESIME 732
            FP + + + ++     EL+ + L  +P KR     +  +KV+N   L P+ + + + E
Sbjct: 293 TFPSYCNIEPELK----ELICSLLTFDPAKRIGFEEFFANKVVNED-LSPYELEDDLPE 346

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,260,140
Number of extensions: 3491285
Number of successful extensions: 19025
Number of sequences better than 10.0: 2032
Number of HSP's gapped: 16703
Number of HSP's successfully gapped: 2190
Length of query: 769
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 652
Effective length of database: 40,065,477
Effective search space: 26122691004
Effective search space used: 26122691004
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)