Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_4.2213.160ON53153127890.0
Smik_4.2053.160ON53153121570.0
YDL030W (PRP9)3.160ON53053120790.0
Suva_4.2193.160ON53153120400.0
NDAI0G028903.160ON53654112941e-174
NCAS0C035403.160ON51853612841e-172
TDEL0D046203.160ON51653712651e-170
ZYRO0B04950g3.160ON50653412161e-162
Kpol_479.263.160ON51753911961e-159
KAFR0C010503.160ON50653611081e-146
TPHA0A009103.160ON52753710991e-144
SAKL0C08800g3.160ON60154510981e-143
Kwal_56.227993.160ON53153710251e-133
Ecym_35493.160ON53253710001e-129
KLTH0C08888g3.160ON5065349901e-128
AEL085W3.160ON5275469681e-125
CAGL0K01573g3.160ON5165449561e-123
KNAG0K011203.160ON5275459141e-117
KLLA0F24662g3.160ON5305387277e-89
TBLA0B016003.160ON4863462462e-21
SAKL0B00704g8.11ON16938810.099
Kwal_14.10648.11ON16238800.13
Suva_10.1588.11ON16958800.15
Ecym_15318.11ON17138770.37
TBLA0G001702.15ON65926790.45
NDAI0C065808.11ON169122760.47
KLTH0G19096g8.11ON15938740.71
CAGL0K12804g8.11ON17238750.74
Smik_12.1348.11ON16658740.80
ABR234C8.11ON17538740.95
NDAI0A081103.389ON423194751.4
Skud_12.1398.11ON16458721.7
TDEL0D047203.150ON25356731.9
YLR074C (BUD20)8.11ON16658712.0
TDEL0C003408.11ON16153712.2
Kpol_1023.825.564ON451101732.4
KLTH0G12980g8.292ON63775732.7
TPHA0D002008.11ON16681703.2
KAFR0C035008.37ON383212714.1
SAKL0H16302g8.292ON63278714.2
KLLA0D05621g8.11ON16738685.4
Kwal_56.236718.292ON65777705.9
KLTH0F10186g2.359ON18664677.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_4.221
         (531 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...  1078   0.0  
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...   835   0.0  
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   805   0.0  
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   790   0.0  
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   503   e-174
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...   499   e-172
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   491   e-170
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   473   e-162
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   465   e-159
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   431   e-146
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   427   e-144
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   427   e-143
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...   399   e-133
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   389   e-129
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   385   e-128
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...   377   e-125
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   372   e-123
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   356   e-117
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...   284   7e-89
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    99   2e-21
SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly si...    36   0.099
Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C ...    35   0.13 
Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {O...    35   0.15 
Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON...    34   0.37 
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    35   0.45 
NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {...    34   0.47 
KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa] ...    33   0.71 
CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]...    33   0.74 
Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {O...    33   0.80 
ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON} Sy...    33   0.95 
NDAI0A08110 Chr1 complement(1859548..1860819) [1272 bp, 423 aa] ...    33   1.4  
Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {O...    32   1.7  
TDEL0D04720 Chr4 (866844..867605) [762 bp, 253 aa] {ON} Anc_3.15...    33   1.9  
YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}  ...    32   2.0  
TDEL0C00340 Chr3 (45150..45635) [486 bp, 161 aa] {ON} Anc_8.11 Y...    32   2.2  
Kpol_1023.82 s1023 (194025..195380) [1356 bp, 451 aa] {ON} (1940...    33   2.4  
KLTH0G12980g Chr7 (1112178..1114091) [1914 bp, 637 aa] {ON} high...    33   2.7  
TPHA0D00200 Chr4 (25129..25629) [501 bp, 166 aa] {ON} Anc_8.11 Y...    32   3.2  
KAFR0C03500 Chr3 complement(711163..712314) [1152 bp, 383 aa] {O...    32   4.1  
SAKL0H16302g Chr8 (1430654..1432552) [1899 bp, 632 aa] {ON} high...    32   4.2  
KLLA0D05621g Chr4 complement(486879..487382) [504 bp, 167 aa] {O...    31   5.4  
Kwal_56.23671 s56 (649753..651726) [1974 bp, 657 aa] {ON} YLR103...    32   5.9  
KLTH0F10186g Chr6 complement(878318..878878) [561 bp, 186 aa] {O...    30   7.6  

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score = 1078 bits (2789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/531 (98%), Positives = 522/531 (98%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60
           MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY
Sbjct: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60

Query: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120
           KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE
Sbjct: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120

Query: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM
Sbjct: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240
           ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL
Sbjct: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240

Query: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300
           ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS
Sbjct: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300

Query: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360
           GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK
Sbjct: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360

Query: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480
           YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ
Sbjct: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480

Query: 481 HRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
           HRSGSSTAVALTKKSPSQPKLPTG         GNVMSKKVYDELKKQGLV
Sbjct: 481 HRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGLV 531

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/531 (76%), Positives = 460/531 (86%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60
           M+ LETRRSLLED+EIIENAI  RI+RNPELYYHYIQES KVFPDVKLPK SLIAENK++
Sbjct: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60

Query: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120
           K+KKVKRNRKQVILQQHEI LFLRDY EKQK+FN  N+    +EDDK++  F++ L++LE
Sbjct: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120

Query: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           + LK+E++NFQLDIN  R+KYALFSSS D SKRTNILSERARDLDLNKIFTRDEQYGEYM
Sbjct: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240
           EL+QFH LWLNV +RSDCSLLQFF+++ELFVDDKK+LLTPPMDRKNDRYM FL++L KYL
Sbjct: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240

Query: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300
           ETFFFKSY LFDKE++E+SI  DFE SYCKG +RSEAKGI+CPFC KWFKT PVFENHL+
Sbjct: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300

Query: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360
           GK HKKNE KRK+TVYSEYKLHRYLKYLKDEF HT+SF+ERKL FTANER+AEMD+LT+K
Sbjct: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360

Query: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD T+ +GD Q  + ++ D LQEK  FGKSFDMPLGPDGLPMP+WLYKLHGLDRE
Sbjct: 361 YEAPAYDPTDKDGDQQKGSDQRDDQLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420

Query: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480
           Y CEICAN+VYNGRRTFERHFNE  HLYHLRCLGIEPS AFKGITKI E QKLW+++Q Q
Sbjct: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480

Query: 481 HRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
            +S +S A +LTK   S+ KLPT          GNVMSKKV+DELKKQGLV
Sbjct: 481 PQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV 531

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/531 (74%), Positives = 451/531 (84%), Gaps = 1/531 (0%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60
           MN+LETRRSLLE++EIIENAIA RIQRNPELYYHYIQES KVFPD KLP+ SLIAENKIY
Sbjct: 1   MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIY 60

Query: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120
           K KKVKR RKQ+ILQQHEI++FLRDY EKQ+ FN+ N  E  +EDDK++  FE+ LQ+LE
Sbjct: 61  KFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120

Query: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           + LKNED+NF+LDIN  + KYALFSSS+DPS+RTNILS+RARDLDLN+IFTRDEQYGEYM
Sbjct: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180

Query: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240
           EL+QFH LWLNVI+R DCSLLQF +ILELF+DD+K+LLTPPMDRKNDRYM FL++LSKY+
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYV 240

Query: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300
           ETFFFKSY L D   VEN I+SDFE+SYC+G +RSEAKGIYCPFCS+WFKT  VFE+HL 
Sbjct: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300

Query: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360
           GK HKKNE+KR+N VYSEYKLHRYLKYL DEF  TRSF+ERKLAFTANERMAEMD LT+K
Sbjct: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360

Query: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD TE EG  Q D  ++   LQE+   GKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480
           Y CEIC+N+VYNGRRTFERHFNEE H+YHLRCLGIEPS  FKGITKI E Q+LWK++Q Q
Sbjct: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480

Query: 481 HRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
            +  S  AV   K +PSQ K+PT          GNVMSKKVYDELKKQGLV
Sbjct: 481 SQLTSIAAVP-PKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV 530

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/531 (75%), Positives = 454/531 (85%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60
           M+ LET+RSLLEDLEIIENAI  RIQRNPELYY YI E+ K+FPD+K P+PSL++ENKIY
Sbjct: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60

Query: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120
           KLKK KRNRKQVILQQHEIDLFLRDY EKQ+  NE N  + V+ED+K++  FEQ LQELE
Sbjct: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFEQKLQELE 120

Query: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           E LKNE +N+QLDINL R +YALFSSSA+PSKRTNILSERARD+DLN++FTRDEQYGEYM
Sbjct: 121 EELKNEQENYQLDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180

Query: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240
           EL+QFH LWLNVI+R DCSLLQFF+ +ELFVDDKK+LL PPMDRKNDRYM FLM+LS+Y+
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240

Query: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300
           E+FF+KSY LF+KE+VE  I+SDF+NSYC+G+++SE+KGIYCP C KWFKT  VFENH+ 
Sbjct: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300

Query: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360
           GKNHKKNEAKRK  VYSEYKLHRYL+ LKDE FHT+SF+ERKLAFTANERM EMDSLT+K
Sbjct: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360

Query: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420
           YEAPAYD TE E DG+    +K D LQEK  FGKSFDMPLGPDGLPMPYWLYKLHGLDRE
Sbjct: 361 YEAPAYDATEREDDGKGGGEQKDDKLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480
           YPCEICANR+YNGRRTFERHFNEE HLYHLRCLGIEPS  FKGITKIAE Q+LWK+ Q+Q
Sbjct: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480

Query: 481 HRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
            +  SS A    +K  SQ KLP G         GNVMSKKVYDELKKQGLV
Sbjct: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  503 bits (1294), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 262/541 (48%), Positives = 351/541 (64%), Gaps = 23/541 (4%)

Query: 4   LETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVK---LPKPSLIAENKIY 60
           LE RRSLLEDLEIIENAI+ R QRNPELYY  +++  ++FP  +   LP  S++  NKIY
Sbjct: 6   LEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSELFPSKQVEELPTHSIMTNNKIY 65

Query: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFN----ESN--NLEGVEEDDKEVDRFEQ 114
           K KK+KRNRKQ+ LQQHEI LF++D+  KQK       E+N    +  EE    V+ F+ 
Sbjct: 66  KTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLTREANFKAKKNKEEILLPVEEFKD 125

Query: 115 NLQELEERLKNEDDNF-QLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRD 173
            L E+ E   NE+ N  +L+IN   +KY++FS+S + S  + ILS RA DLD+N IF+ +
Sbjct: 126 ILSEINEADGNENGNRRELEINDKINKYSMFSNSLNKSHPSTILSSRASDLDINSIFSLE 185

Query: 174 EQYGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFL 233
           EQYGEY+ L+ ++  WLNV+++ D + LQF N+L++F DDK++++ PPMDRKN+ YM +L
Sbjct: 186 EQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNMLKIFQDDKRYIVQPPMDRKNEPYMKYL 245

Query: 234 MRLSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFP 293
            R   YLE+FF + Y L D       ++ +F  S  K L  +E KG +C  C KWFKT  
Sbjct: 246 QRYCSYLESFFERKYPLIDSRYTSRELKKEFNKSIIKPL-ENEKKGFFCKTCCKWFKTLT 304

Query: 294 VFENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAE 353
           VFE+HL+G+ H K+  KR   +Y+EYK HRY   LK+E   T  F+ERK+AFT  ER+ E
Sbjct: 305 VFESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITE 364

Query: 354 MDSLTEKYEAPAYDHTEGEGD-GQCDAGRKGDLLQEKQP--FGKSFDMPLGPDGLPMPYW 410
           M  L E  +APAYD  E EGD    +   K +L  +        S +MPLGPDGLPMP+W
Sbjct: 365 MKRLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGASAMLSGSINMPLGPDGLPMPFW 424

Query: 411 LYKLHGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEV 470
           LYKL GLD  YPCEIC+N+++ GRRTF++HF E  H+YHLRCLGIEP+PAFKG+TKI E 
Sbjct: 425 LYKLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGIEPTPAFKGVTKIEEA 484

Query: 471 QKLWKDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGL 530
           Q+LW +++N    G    +           +P           GN+M++KVYDELKKQGL
Sbjct: 485 QRLWNNMKNDTIMGDKKFIE---------TIPDKMAIEVEDKEGNIMTQKVYDELKKQGL 535

Query: 531 V 531
            
Sbjct: 536 A 536

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score =  499 bits (1284), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 268/536 (50%), Positives = 351/536 (65%), Gaps = 30/536 (5%)

Query: 3   VLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQE-SCKVFPDVKLPKPSLIAENKIYK 61
           +LE +R+LLEDLE+IE+AIA R QRNPELYY  I + S      +  P  S  + NKIYK
Sbjct: 4   LLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYK 63

Query: 62  LKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELEE 121
            KK+KR+RKQ +LQQ EI++FL+D+ E+++   +    E V++D+  ++ F+  +Q++  
Sbjct: 64  RKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK-ETVKDDNITLETFKTMIQDINA 122

Query: 122 RLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYME 181
           +  + +    L IN   ++YA+FS+S   SK  NILS+R   LD+NK F+R+EQYG+YM+
Sbjct: 123 KKSSSE---VLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMD 179

Query: 182 LDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYLE 241
            + F+  WLNV++  D +LLQF N+L +F+D++K+L  PPMDRKN+RYM FL  L  Y+E
Sbjct: 180 FENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVE 239

Query: 242 TFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLSG 301
           +FFF+ Y L +K  + + IES F   Y K       KG YC  C+KWFKT  VF NH+ G
Sbjct: 240 SFFFRKYALINKSAITSQIESQF-TEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPG 298

Query: 302 KNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEKY 361
           KNH KNE +RKN + SEYKLHR+   L++EF  T  FIE K+A TA+ERM EM  LTE Y
Sbjct: 299 KNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENY 358

Query: 362 EAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGK-------SFDMPLGPDGLPMPYWLYKL 414
           E PAY   E EGD         DL  ++Q  GK       SFDMPLGPDGLPMP+WLYKL
Sbjct: 359 EKPAYSSDEKEGDEN-----NADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKL 413

Query: 415 HGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLW 474
            GLD EYPCEIC+N+++ GRR FE+HF    H YHLRCLGIEPS  FKGITKI E QKLW
Sbjct: 414 QGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLW 473

Query: 475 KDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGL 530
            DI +Q  S      ++  +   +  +            GNVMSKK+YDELKKQGL
Sbjct: 474 VDINSQKNSSKPMVSSIELQVEVEDSV------------GNVMSKKLYDELKKQGL 517

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  491 bits (1265), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 259/537 (48%), Positives = 343/537 (63%), Gaps = 27/537 (5%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIA--ENK 58
           MN LE+RRS LEDLE+IE +IA R +RNP LYY Y+Q+   +  D+ L      A   N+
Sbjct: 1   MNTLESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRA-LIDDIPLSSSITNAYNANR 59

Query: 59  IYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQK---AFNESNNLEGVEEDDKEVDRFEQN 115
           IYK K+ KRNRKQ +LQQHEIDLFL++   K +   +     N   + +++   + F+QN
Sbjct: 60  IYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLKGPVNTHSLRDEEATFEIFKQN 119

Query: 116 LQELEERLKN-EDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDE 174
           L+E++++ K+   D+   D+N   SK+A+FS+    SK   ILS  A++L LN +F+R+E
Sbjct: 120 LEEIKDKYKDLGSDSLFSDVNEEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVFSREE 179

Query: 175 QYGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLM 234
           QYGEY++LD+FH  WLNVIR ++C+LLQF++ILE F+DD++++L PPMDRKN RY +FL+
Sbjct: 180 QYGEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDDRQYILAPPMDRKNGRYAEFLV 239

Query: 235 RLSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPV 294
            +S YLE FF K+ VL +   +E  I+S+F  S    L  +  KG YC  C KWFK   V
Sbjct: 240 EISNYLEKFFQKANVLLNHTKLERRIQSEFSRSLATPL-HTGGKGFYCIACCKWFKVPTV 298

Query: 295 FENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEM 354
           F++HL+GK+HK N +KR   + +EYKLHRYL  L +EF  TR F ERK+AFTA ERM EM
Sbjct: 299 FDSHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQEM 358

Query: 355 DSLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKL 414
             L   Y AP Y   E E   Q D       L +    G SFD+PLG DGLP+PYWLYKL
Sbjct: 359 ARLNHDYHAPDYGPDEKE---QEDPDSNKAELDKNSALGGSFDLPLGADGLPIPYWLYKL 415

Query: 415 HGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLW 474
            GLD EY CEIC N+ Y GRR FE+HF E  H +HL+CLGIEPS  FKGIT I E Q LW
Sbjct: 416 QGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGIEPSITFKGITGIQEAQDLW 475

Query: 475 KDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
           +   +++R  +   + L                      GNV+++KVY ELKKQGLV
Sbjct: 476 RQTSSRNRPQTQKKIDL----------------EVEDQEGNVLTQKVYQELKKQGLV 516

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  473 bits (1216), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 255/534 (47%), Positives = 343/534 (64%), Gaps = 31/534 (5%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60
           M  LETRR LLE LEIIE+AI+ R  RNPELYY  I +   +   ++LP  + +A N+IY
Sbjct: 1   MTTLETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVLIDGGIELPSTTAMAVNRIY 60

Query: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEE-DDKEV--DRFEQNLQ 117
           K K+ KR+RKQ++ QQHEI+LFL    +KQK  +  N    VE+  D+E+  D+F + + 
Sbjct: 61  KSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVDVEDYRDEEINFDKFREAVD 120

Query: 118 ELEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYG 177
           ++  + ++++    LDIN     + +FS++   S    ILSE ARDLDLN+IFTRDEQYG
Sbjct: 121 QINSKYEDQE-GLALDINENIVNHEMFSATFSKS---TILSESARDLDLNQIFTRDEQYG 176

Query: 178 EYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLS 237
           + ++L++FH  WLNVI+R+DCS LQFF++L+ F+D  ++LL+PPMDRKN+RY  FL+ L 
Sbjct: 177 DLLDLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLSPPMDRKNERYGQFLIELF 236

Query: 238 KYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFEN 297
           +Y+E FF K YVL +  ++   +ESDFE  Y +  +     G+YC  C KWFKT  VF++
Sbjct: 237 QYVEQFFAKVYVLVNSTILSQRMESDFE-EYLRMPIYKSNHGLYCVACGKWFKTPTVFQS 295

Query: 298 HLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSL 357
           HL+GK+H+ N  KR   + +EYKLHRYLK L+ +   TR F+ERK+AFT  ERM EM  L
Sbjct: 296 HLTGKHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRL 355

Query: 358 TEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGL 417
              YE P Y   E E + + D+    D   EK+  G   ++PLG DGLP+P WLYKL GL
Sbjct: 356 ARIYEGPDYAPDEKEIEEKEDS---VDTPSEKKMNG-GIELPLGLDGLPIPLWLYKLQGL 411

Query: 418 DREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDI 477
           D  Y CEIC N+ Y GRR FERHF E  HL+HL+CLGIE S AF+ IT I E Q LWK I
Sbjct: 412 DVTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGIEASDAFRSITSIEEAQNLWKRI 471

Query: 478 QNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
                SG++T               +          GNVM+++VY+ELKKQGLV
Sbjct: 472 -----SGNNTT--------------SSRDIEVEDEEGNVMTQQVYEELKKQGLV 506

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  465 bits (1196), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 248/539 (46%), Positives = 347/539 (64%), Gaps = 30/539 (5%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLI--AENK 58
           M+ +E  RSLLED+E+IE+AI+ R QRNPE+YY+Y Q+   +    +  K  +   + N+
Sbjct: 1   MSYIENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLNDINGGGEETKTVVSNRSSNR 60

Query: 59  IYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQE 118
           IYK +K KR+RKQVILQQ+E + F++D   K     E N  +  E +  ++DR+ + +  
Sbjct: 61  IYKSRKHKRDRKQVILQQYETNEFIKDIRSKLNEIREINVTK--ESNGIKLDRYVELMGS 118

Query: 119 LEERLKNE-DDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYG 177
           ++ + ++   DN QL IN T  +Y++F+SS   +K  NILS++ + L++N  FTRDEQYG
Sbjct: 119 IDTKYEDSVSDNQQLPINKTIFQYSMFTSSNSKNKPNNILSDKCKYLEINDYFTRDEQYG 178

Query: 178 EYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLS 237
           EY+EL++F+  WLNVI+ ++CS+LQ+ +I+E F+D  +++L PPMDRKN+RY+ FL  + 
Sbjct: 179 EYLELERFYNNWLNVIKSANCSILQYMSIIEKFLDSAQYILQPPMDRKNERYLKFLEIIE 238

Query: 238 KYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFEN 297
            YL +F  K+YVL D E     ++ D+E    K L++ + KG +C  C KWFKT  VFEN
Sbjct: 239 TYLTSFIKKTYVLIDWEEEAEVLKYDYEIECTKSLMK-QGKGNFCRLCGKWFKTESVFEN 297

Query: 298 HLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSL 357
           HL GKNH KN  K  +  + E+K+HR L +L  EF  T+ F+ERKLAFT++ER+ E+D +
Sbjct: 298 HLPGKNHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDRM 357

Query: 358 TEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGL 417
           TE YE PAY   E E +G+ +         +      SFDMPLGPDGLPMPYWLYKL GL
Sbjct: 358 TEVYERPAYSVGEPE-EGKPNENSSKTSSNKNDIINGSFDMPLGPDGLPMPYWLYKLQGL 416

Query: 418 DREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLW--- 474
           D  Y CEICAN +Y GRRTFE+HF+E  H YHLRCLGIEPS AFKGI  I E   LW   
Sbjct: 417 DMTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKEATDLWGTM 476

Query: 475 --KDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
             KD  ++H   ++  + +  K                   GNV+SK++Y+ELKKQGL+
Sbjct: 477 NVKDKSSKHAESNNYEIEVEDKE------------------GNVLSKEIYEELKKQGLL 517

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  431 bits (1108), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 244/536 (45%), Positives = 336/536 (62%), Gaps = 35/536 (6%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLI--AENK 58
           M  LE +R L EDLE+IE+AIA R+QRNPELYY+Y+ E    F    L  PS I    N+
Sbjct: 1   MANLEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYL-EKLSSFEKHSLEVPSSIDIKNNR 59

Query: 59  IYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQE 118
           +YK KK KR++KQ++ QQHEI LF+ DY  KQK  N     +   +   ++  F  ++ E
Sbjct: 60  VYKSKKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLMKRKDTTQISSDIGDFITSITE 119

Query: 119 LEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGE 178
            +  +K+   + ++D       Y++FS+S   + + +ILS+RA DLD+N+ FTRDEQ+GE
Sbjct: 120 NKSHVKSSLKD-KIDY------YSMFSAS---TTQKSILSKRAADLDINQTFTRDEQFGE 169

Query: 179 YMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSK 238
            M+L++FH +WL+V++    SLL FF ++E F+D K +L +P MDRKN RY +F+  +S 
Sbjct: 170 CMDLERFHNVWLSVVKDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIKTISG 229

Query: 239 YLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENH 298
           Y+E+FFFK + L DKE V   ++ DF       L  +   G +C  C+K FKT  VF+NH
Sbjct: 230 YVESFFFKKFCLIDKEYVNARLQQDFILYLDNPL--NNQNGFFCVACNKSFKTKSVFDNH 287

Query: 299 LSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLT 358
           L GK HK+N  KR+N++ SEYKL+R+L  L+ EF +T+ F ERK++FTANER  E++ L 
Sbjct: 288 LPGKQHKRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLN 347

Query: 359 EKYEAPAYDHTEGEGDGQCD---AGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLH 415
            +Y AP Y   E E   +     A + G+    +      F+MPLGPDG+PMP+WLYKL 
Sbjct: 348 NEYNAPVYGSEEQEEGDEEHDEYASKNGN----RSILDGLFNMPLGPDGVPMPFWLYKLQ 403

Query: 416 GLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWK 475
           GLD  Y CEIC+NR + GRR FERHFNE+ H YHLRCLGI PSP F GIT I E Q LW 
Sbjct: 404 GLDVSYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGITPSPTFVGITAITEAQTLWD 463

Query: 476 DIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
            IQ+  +          KK+PS                GNV+++KVYD+LK+QGL+
Sbjct: 464 HIQSTQK----------KKAPSG---KIDMDIEVEDADGNVLTRKVYDDLKRQGLL 506

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  427 bits (1099), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 245/537 (45%), Positives = 342/537 (63%), Gaps = 16/537 (2%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCK--VFPDVKLPKPSLIAENK 58
           M+ +E RRSLLEDLE+IE++I  R QRNPELYY Y QE  K  V PD+ LP  ++   NK
Sbjct: 1   MSNIEERRSLLEDLEVIESSITKRFQRNPELYYKY-QEGLKKVVDPDIDLPSKTVRNTNK 59

Query: 59  IYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVD--RFEQNL 116
           IYK +K KR RKQ++LQQ+EI+ FL DY  K+K   +   L+  E  DK  D  +FE+ L
Sbjct: 60  IYKTRKHKRKRKQILLQQYEINEFLDDYRRKEKQLMKQK-LDISEFRDKGADFVKFEELL 118

Query: 117 QELEERLKNEDDNFQLDINL--TRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDE 174
           + +     N+++    ++ L   + KYA+FSSS + +   NILS+R++ LDLN  F+++E
Sbjct: 119 ESINNEYNNQNEETPTNLKLLDKKDKYAMFSSSININSPNNILSKRSQLLDLNNYFSKEE 178

Query: 175 QYGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLM 234
           QYGE + L+QF+  WLNV++ +DCS+L++  +L +F+D  +F+L  PMDRKN RY+DF+ 
Sbjct: 179 QYGEILNLEQFYSSWLNVVKTADCSILKYILMLNVFLDKDEFILNSPMDRKNLRYVDFIR 238

Query: 235 RLSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPV 294
            LSKY E++  K Y+L +    +  ++  FE    K +V+ E KG  C  C KWFK   V
Sbjct: 239 ILSKYFESYLEKRYILNNWINFKTELKKSFEKYSIKPIVK-EKKGYLCISCGKWFKNSNV 297

Query: 295 FENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEM 354
           ++ HL GK H+K+ + RK  +Y+EYKLHR + YLK EF  +++++ERKLAFT  ER  E+
Sbjct: 298 YDGHLKGKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNEL 357

Query: 355 DSLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKL 414
             LT+KYE PAY+  E E   + +      +    +   KSF+MPLGPDG+P+P WLYKL
Sbjct: 358 KLLTKKYEEPAYNKDEPENTDKYEED-DNSMSNAAEDRNKSFNMPLGPDGMPIPLWLYKL 416

Query: 415 HGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLW 474
            GLD +Y CEIC N+ Y GR+ +E HF+E  H  HL  LGI+ S AFKGIT IAE + LW
Sbjct: 417 QGLDIKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSKAFKGITSIAEAKSLW 476

Query: 475 KDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
             +   + S +S +      + +  KL            GNVMSKK+YDELKKQ LV
Sbjct: 477 SSMHASNGSAASFS------NQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV 527

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  427 bits (1098), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 228/545 (41%), Positives = 332/545 (60%), Gaps = 31/545 (5%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPD---VKLPKP-SLIAE 56
           M +LE +RS+LE LE+IENAI+ RI+RNPELYY Y +E   V  +   +  P P S I+ 
Sbjct: 74  MEILEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRLVDKENHGLLPPVPASDISA 133

Query: 57  NKIYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNL 116
           N+I+ +KK +R+RKQ++LQQHEID FL +Y        E   L G++ D  + +    + 
Sbjct: 134 NRIHSVKKSRRSRKQIVLQQHEIDRFLEEYQ------REVARLHGIKLDKDDSESAAPDF 187

Query: 117 QELEERLKNEDDNFQ------LDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIF 170
           ++LE+ +K+    +         +++   ++++FSSS    K  +ILS R RDLD+N++F
Sbjct: 188 EQLEKAVKDAKSRYADESRTLAGVDVESVEHSMFSSSTSTHK--DILSTRGRDLDMNRLF 245

Query: 171 TRDEQYGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYM 230
            RDE YGE++ L+ FH+ WLN+++    + LQF N++E+FV D  +L+ P ++R + +Y 
Sbjct: 246 ARDEHYGEFLLLEPFHHEWLNIVKDGSVTALQFMNVVEMFVSDA-YLVAPAVNRGSKKYQ 304

Query: 231 DFLMRLSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFK 290
           DF+  L  Y+  FF K+Y L +   +   + + F + Y +  V  E KG++C  C +WFK
Sbjct: 305 DFVGSLLGYMSEFFRKTYPLVNHSTLGRRLAALF-DEYLRAPVADETKGLFCIPCGRWFK 363

Query: 291 TFPVFENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANER 350
              V+++HLSGK H KN AK    + +EYKLH+Y   L     +TR+F+ER  A TA+ER
Sbjct: 364 LETVYKSHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADER 423

Query: 351 MAEMDSLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQP----FGKSFDMPLGPDGLP 406
             E++ L ++YEAPAY   E E     DA R+    Q+++P     G  F++PLGPDG P
Sbjct: 424 AQELERLAKEYEAPAYSQHETE-----DAAREKQ--QKREPETDEGGNPFNLPLGPDGYP 476

Query: 407 MPYWLYKLHGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITK 466
           +PYWLYKL GLD EY CEIC+N  Y GRR FE+HF+E  H++ LRCLGIEPS  FKGITK
Sbjct: 477 IPYWLYKLQGLDIEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGIEPSATFKGITK 536

Query: 467 IAEVQKLWKDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELK 526
           I E + LW  IQ    +G       +  + +                GNVMS+K+Y ELK
Sbjct: 537 IQEAKDLWARIQTSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELK 596

Query: 527 KQGLV 531
           +QGL+
Sbjct: 597 RQGLL 601

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score =  399 bits (1025), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 221/537 (41%), Positives = 320/537 (59%), Gaps = 36/537 (6%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAEN--K 58
           M   E+ RS LE+LE+IE AIA R++RNPE++Y  + E   +  D K+   + I +N  K
Sbjct: 25  MVTYESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNK 84

Query: 59  IYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAF-NESNNLEGVEEDDKEVDRFEQNLQ 117
           IY ++K KR RKQ++ Q+HEI LFL +Y +K ++  N   +L   +  D  VD F ++++
Sbjct: 85  IYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVEFDLRRYQVTDGSVDGFLEHIE 144

Query: 118 ELEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYG 177
            +   + +       DI+ +   Y +FS+S   + R +ILS++AR LD+N  FTR+EQYG
Sbjct: 145 TINSEVPD-------DIDDSMENYTMFSNST--AARRDILSKKARALDINAKFTREEQYG 195

Query: 178 EYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLS 237
           E+++L+ FH  WL+V++    SLLQF   +E F   K+FLLTP ++R + RY DF+  L 
Sbjct: 196 EFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKALL 254

Query: 238 KYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEA---KGIYCPFCSKWFKTFPV 294
            YL+ +  ++Y L D     + I ++ + +YC      E     G++C  C K FK   V
Sbjct: 255 CYLQDYLMRAYPLQDW----DKIHAEIQATYCDYKSHPEEAGDSGLFCIPCDKTFKAETV 310

Query: 295 FENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEM 354
           +  HL+GK H  N  K+   +  EYKLH    YL  E   TR F+ERKLAFT  ER  EM
Sbjct: 311 YLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEM 370

Query: 355 DSLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKL 414
           + LT  YE+P Y   E E   + D  +K    QE      SFD+PLGPDG P+PYWLYKL
Sbjct: 371 ERLTTVYESPVYGEQEQEDIAEAD--QKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKL 428

Query: 415 HGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLW 474
            GLD EYPCE+C N +Y GRR F++HF E+ H++ L+ LG++PSP+FKG+T I +V++LW
Sbjct: 429 QGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLW 488

Query: 475 KDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
             +++  ++ ++            PK             GNVMSKKVY+ELKKQGL+
Sbjct: 489 AHLRSSSKASNAAG----------PKF----EEEIEDEEGNVMSKKVYEELKKQGLI 531

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  389 bits (1000), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 214/537 (39%), Positives = 313/537 (58%), Gaps = 11/537 (2%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPK--PSL-IAEN 57
           M++LE +R++LE+LE+IE+AI+ RI RNPE++Y YI E   V  D K+    P++ I  N
Sbjct: 1   MSLLEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSIVNSDEKVLSNIPNVDITAN 60

Query: 58  KIYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFN--ESNNLEGVEEDDKEVDRFEQN 115
           ++Y +KK KR+RKQ++LQQHEI  FL  Y +  K  N  +++N++  ++ ++  + F   
Sbjct: 61  RVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYKNDNVDEFKDHNQNFELFRDQ 120

Query: 116 LQELEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQ 175
           +Q ++E+   E ++   D +L   KY     S    ++ +ILS   + +D+NK F+ +E 
Sbjct: 121 IQRIKEKYAEESNSEAFDASLEARKYQYTMFSNSNHQKKDILSLEGQSIDINKKFSWEEH 180

Query: 176 YGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMR 235
           YGEY+ LDQ+H  +LN+++ ++ SLLQF   L+ F D    L  PP+DR +  Y  FL R
Sbjct: 181 YGEYLHLDQYHQEYLNIVKNANVSLLQFIGFLQTFCDHGH-LKNPPVDRNSKIYHGFLER 239

Query: 236 LSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVF 295
           L KY+ +FF  ++ L +    +  I++ F   Y    +   ++G  C  C KWFK   V+
Sbjct: 240 LLKYVNSFFESAFPLINHVQFQKRIKNSFV-EYTSTPIEDSSRGCLCVACGKWFKAITVY 298

Query: 296 ENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMD 355
            +HL G+ H  N   R+ ++  EY L      L  E   T+SF+ERK AFT  ER+ E+ 
Sbjct: 299 TSHLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERIQELA 358

Query: 356 SLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKS-FDMPLGPDGLPMPYWLYKL 414
            L + Y A AY   E E D Q D        +E  P   +  ++PLGPDG P+PYWLYKL
Sbjct: 359 KLRDAYNANAYGDHERE-DSQEDLSVSSS--KETPPDDNNPLNLPLGPDGYPIPYWLYKL 415

Query: 415 HGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLW 474
            GLD EY CEIC N +Y GRR FERHF+E+ H Y LRCLGIEP+  FKGI+KI++ Q LW
Sbjct: 416 QGLDIEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGIEPTSTFKGISKISDAQILW 475

Query: 475 KDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
             ++N     S++A      S                  GNVMS +VY++LKKQGL+
Sbjct: 476 SRLKNNSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQGLL 532

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  385 bits (990), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/534 (40%), Positives = 323/534 (60%), Gaps = 31/534 (5%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPK--PSLIAENK 58
           M   E  R+ LE+LE+IENA+  R++RNPE++Y  I E   V    +      S  + NK
Sbjct: 1   MKTYEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEHSGRFDHIPSSQKSANK 60

Query: 59  IYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESN-NLEGVEEDDKEVDRFEQNLQ 117
           +Y +KK +R+RKQ++ Q+HEI  FL  Y +  ++      ++     D+  V++  ++++
Sbjct: 61  VYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVEFDMSEYRVDNGSVNKLLEHIE 120

Query: 118 ELEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYG 177
            ++E +  +DD F         +YA+FSSS  PS + NI+S +A++LD+N  FTRDEQYG
Sbjct: 121 RIKE-IHPKDDEFG-------DQYAMFSSST-PSNK-NIISRKAQNLDINSYFTRDEQYG 170

Query: 178 EYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLS 237
           EY++L+ FH  WL+V++  D +LLQF + +E F D +++LL P ++R + RY +F+  L 
Sbjct: 171 EYLDLEPFHQKWLSVVKNGDVTLLQFLSEVEKFTD-QRYLLQPAVNRNSSRYREFVASLH 229

Query: 238 KYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFEN 297
            YL  +  ++Y L   +++    +  +  +  K +   E+ G++C  C K FKT  V+  
Sbjct: 230 HYLSDYAARAYPLLSWDLIHAKAQELYHTNVAKPIPSGES-GVFCIPCDKRFKTDTVYNA 288

Query: 298 HLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSL 357
           HL GK H  N  K  + +  E+ LH + +YL  E   TR F+ERKLAFT  ER  E++ L
Sbjct: 289 HLPGKRHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELERL 348

Query: 358 TEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGL 417
           T+ Y++P Y   E E D Q D  ++ +  +E      S ++PLGPDG P+PYWLYKL GL
Sbjct: 349 TDIYDSPVYGRQEQE-DAQEDENKETED-KEDSVLDSSMNLPLGPDGFPIPYWLYKLQGL 406

Query: 418 DREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDI 477
           D EYPCE+C N VYNGRR F++HF E+ H++ LR LGIEPS +FKG+TKI + ++LW  +
Sbjct: 407 DIEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASFKGVTKIDDAKQLWSHL 466

Query: 478 QNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
               RS SS  V+      S+ KL            GNVMSKKVYDELKKQGL+
Sbjct: 467 ----RSTSSGRVS------SEGKLEV----EVEDEDGNVMSKKVYDELKKQGLL 506

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score =  377 bits (968), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 219/546 (40%), Positives = 317/546 (58%), Gaps = 34/546 (6%)

Query: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKL---PKPSLIAEN 57
           M+ LE +R++LE+LE+IE AI+ RI+RNPE+YY Y++E   V PD K+        I  N
Sbjct: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60

Query: 58  KIYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFN--ESNNLEGVEEDDKEVDRFEQN 115
           +IY  KK +R+RKQ+ILQQHEI  FL+ Y ++ K  N  +S+++E + + +   + FE +
Sbjct: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120

Query: 116 LQELEERLKNEDDNFQLDINLTRSK--YALFSSSADPSKRTNILSERARDLDLNKIFTRD 173
           ++EL+ER     D+     +L R +  Y++FS+S+   +   ILS   + +D+NK+F  +
Sbjct: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMWE 178

Query: 174 EQYGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFL 233
           E YGEY+ L++ H  WLNV++    +LLQF   LE F     +L  PP+DR + RY  F+
Sbjct: 179 EHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRNSKRYQVFI 237

Query: 234 MRLSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFP 293
            +L  YLE  F  +Y L +  ++EN I   FE SY    V    +G+ C  C K FK   
Sbjct: 238 QKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVGT 296

Query: 294 VFENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAE 353
           VF  HL GK H ++   +  T+ +E+ LH  + YL     +TR+ +ERK AFT+ ER  E
Sbjct: 297 VFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNRE 356

Query: 354 MDSLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYK 413
           M ++ + Y+APAY   E E   +    ++     +  P     ++PLGP G P+PYWLYK
Sbjct: 357 MATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNP----LNLPLGPMGYPIPYWLYK 412

Query: 414 LHGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKL 473
           L GLD EY CEICAN VY GRR     F   A  Y LRCLGIEPSPAFK I  IAE Q+L
Sbjct: 413 LQGLDIEYACEICANHVYKGRRISNAIF-RTAPCYGLRCLGIEPSPAFKDIYNIAEAQQL 471

Query: 474 WKDIQNQ--------HRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDEL 525
           ++ +Q+          R+G+ ++ A T+K                   GNVM+ +VY++L
Sbjct: 472 FQSLQSSTGPAGLATRRAGAISSSANTRK----------LEVEVEDEDGNVMTHQVYEDL 521

Query: 526 KKQGLV 531
           KKQGL+
Sbjct: 522 KKQGLL 527

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  372 bits (956), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 214/544 (39%), Positives = 321/544 (59%), Gaps = 46/544 (8%)

Query: 4   LETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAE---NKIY 60
           L+T RSLLED+E+IE+AI+ R QRNPELYY Y      +  D+  PK  L  +   NKIY
Sbjct: 3   LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEGIRDDI--PKLGLDDDRMVNKIY 60

Query: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNL---EGVEEDDKEVDRFE---- 113
           K +K KR  KQ   QQ+EI+ FL D  +K K   +  N    +G++  D E  +FE    
Sbjct: 61  KARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRNQLKSDGLKYKDSEC-KFELLKK 119

Query: 114 ------QNLQELEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLN 167
                    ++ ++ +   + +  LDI+ T ++Y +   +        ++SER   LD+N
Sbjct: 120 LLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNMNLGNG------KLVSERCSLLDIN 173

Query: 168 KIFTRDEQYGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKND 227
            IF +DEQ G  ++ +  +  WLN+++    +  +F + LE F+DDKK+LL P MDRK  
Sbjct: 174 TIFQKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRKTK 233

Query: 228 RYMDFLMRLSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSK 287
            Y +F++    ++ET +FK  +L ++E ++  +  DFEN   K ++ +E+   YC +C K
Sbjct: 234 GYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTKAII-TESGIYYCLYCDK 292

Query: 288 WFKTFPVFENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTA 347
            F +  ++++H +GK H K+ +   ++  +E+KLH Y+  +++EF +T+ +++RK+AFT 
Sbjct: 293 MFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFTN 352

Query: 348 NERMAEMDSLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPM 407
            ER+ EM+ LT++Y  P YD TE EGD + D  +     + K+  G   DMPLGPDGLP+
Sbjct: 353 KERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKTKDELKEMLGLGEDMPLGPDGLPI 412

Query: 408 PYWLYKLHGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKI 467
           PYWLYKL GLD    CEIC N+VY G + F++HF+   H YHL+CLGIEPS AF+GITKI
Sbjct: 413 PYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGIEPSSAFQGITKI 472

Query: 468 AEVQKLWKDIQNQHRSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKK 527
            E Q LWK +Q       +T   L ++   +               GNVMSK +Y+ELKK
Sbjct: 473 KEAQALWKQMQR------NTTQELAEEVEDK--------------EGNVMSKDIYEELKK 512

Query: 528 QGLV 531
           QGLV
Sbjct: 513 QGLV 516

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  356 bits (914), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/545 (37%), Positives = 307/545 (56%), Gaps = 37/545 (6%)

Query: 4   LETRRSLLEDLEIIENAIAIRIQRNPELYYHYI----QESCKVFPDVKLPKPSLIAENKI 59
           L+ R SL+  LEI+E+AIA R QRNP LYY+ +    + + +  P V  P    + +NK+
Sbjct: 3   LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQAEPKV-CPPQDHVTKNKV 61

Query: 60  YKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQEL 119
           Y+++K  R  KQV  QQHEI LFL+D  +     + +      E   K +D F+  +  L
Sbjct: 62  YRVEKSARKVKQVATQQHEIKLFLQDRTDILNKLSRAQESGPGESQYKNLDEFKTAINGL 121

Query: 120 EERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEY 179
            E    +    Q +    + +YA+FSSS +    TNILS RA +LD+N IF R+EQYG Y
Sbjct: 122 TESNIPKRSGLQSE----KDQYAMFSSSIEKPP-TNILSARALELDINAIFNREEQYGTY 176

Query: 180 MELDQFHYLWLNVIRRSDCSLLQFFNILE---LFVDDK-KFLLTPPMDRKNDRYMDFLMR 235
           ++L+ +H +WL +++    ++LQ+   LE   L  DDK  +L +PP+DR N +Y+ FL R
Sbjct: 177 IQLENYHPMWLELMKEPSVTVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRFLER 236

Query: 236 LSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVF 295
           L  YL+T+  K + L D+ +VE+ +   F+N Y    V ++    +CP C K ++   +F
Sbjct: 237 LGLYLKTYIAKKFPLIDQHLVEDYLLDHFKNRYVNKPVSTDQNTQFCPVCDKRYEGMQLF 296

Query: 296 ENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMD 355
            +HL  K H +   KR   + +E+++  YL  L  EF  +++F+ERKLAFT  ER  E+ 
Sbjct: 297 NDHLLNKFHAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQEELQ 356

Query: 356 SLTEKYEAPAYDHTEGEGD--GQCDAGRKGDLLQEKQPFGKS----FDMPLGPDGLPMPY 409
            LT +YEAP Y+      D   + D  + G    E +   +      +MPLGPDG+P+P 
Sbjct: 357 RLTTEYEAPNYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMPIPL 416

Query: 410 WLYKLHGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAE 469
           WLYKL GLD +Y CEIC N  + GRR +++HF+E  H Y L+CLGI  S AF GI  I E
Sbjct: 417 WLYKLQGLDVKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGITRSKAFDGIALIEE 476

Query: 470 VQKLWKDIQNQH---RSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELK 526
            Q+LW  I  +    R+GS  ++ L  +   +               GNVMS+ VY +LK
Sbjct: 477 AQELWAKISGKSTSARAGSDDSLKLEIEVEDE--------------DGNVMSQTVYQDLK 522

Query: 527 KQGLV 531
           +QGL+
Sbjct: 523 RQGLL 527

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score =  284 bits (727), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 190/538 (35%), Positives = 291/538 (54%), Gaps = 26/538 (4%)

Query: 4   LETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSL-IAENKIYKL 62
            E RR +LE+LE+IE+AI+ R++RNPE++Y +  E+           P L ++ N+IY+ 
Sbjct: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRF-NEALHNLGVEAWAVPKLDVSANRIYRS 67

Query: 63  KKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNE----SNNLEGVEEDDKEVDRFEQNLQE 118
           KK KR+RKQ+  Q++EI LFL  Y    K+  +      +LE   + +   ++FE    E
Sbjct: 68  KKSKRSRKQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTE 127

Query: 119 LEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGE 178
           + E   N     ++     +S Y +FS     SK  NI+S   + +DL++ F RDE +G 
Sbjct: 128 VLEGQVNSRSLVEV-----KSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGT 180

Query: 179 YMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSK 238
           Y++L +    WLN+I+R+D ++L F  +LE F +   +LL P +DR    Y   +  L K
Sbjct: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLK 239

Query: 239 YLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRS---EAKGIYCPFCSKWFKTFPVF 295
           Y + ++ K+Y L DKE++  +I + F+     G+  S   E+  +Y    ++WF +   F
Sbjct: 240 YYKAYYSKAYPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEF 299

Query: 296 ENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMD 355
             H+  +      ++ +  +  EY  H + K+L     +T SF ERKLAFT  E   E++
Sbjct: 300 NTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELE 359

Query: 356 SLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLH 415
            L E+YE+P Y   E E         +    +E       +++PLGPDG P+P WL K+ 
Sbjct: 360 KLQEQYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQ 419

Query: 416 GLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWK 475
           GLD +Y CEIC N++Y+GRR FE+HF  + H   L+ LGI PS AFK +T I EV +LWK
Sbjct: 420 GLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWK 479

Query: 476 DIQNQH--RSGSSTAVALTKKSPSQPKLPTGXXXXXXXXXGNVMSKKVYDELKKQGLV 531
            +Q +   +SG   +   T K P                 GNVMS +VY+ELKKQGL+
Sbjct: 480 ALQAKSTLKSGEPFSKISTVKEPEM-------VLETEDNEGNVMSVQVYEELKKQGLL 530

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/346 (26%), Positives = 142/346 (41%), Gaps = 63/346 (18%)

Query: 163 DLDLNKIFTRD--EQYGEYMELDQFHYLWLNVIRR-----SDCSLLQFFNILELFVDDKK 215
            +D+N ++ RD  E+YG  + LD+F+ LW+  + +     S  +L++F+  +      K+
Sbjct: 111 SIDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQV-----TKQ 164

Query: 216 FLLTPPMDRKNDRYMD-------FLMRLSKYLETFFFKSYVLFDKEMVENSIESDFENSY 268
           FL        +DR++D        +  + +YL  F         +E V+     D   + 
Sbjct: 165 FL--------HDRWIDETAFPPSLIAGMLEYLTGF---------QERVDIVKPQDSSAAI 207

Query: 269 CKGLVRSEAKG------------------IYCPFCS-KWFKTFPVFENHLSGKNHKKNEA 309
            + L R  A                    + C  C  K F T  VF +HL+   H K EA
Sbjct: 208 TRRLRRHIALSSSSCSSSSSSASSPSPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREA 267

Query: 310 KRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEKYEAPAYDHT 369
            R   +     +   L+ L  E     + +ER+L  T  ER AE  +      A      
Sbjct: 268 SRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTA-----V 322

Query: 370 EGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDREYPCEICANR 429
           +G G G   A               +    +  DG  +P WLY+L GL   + CE+C  R
Sbjct: 323 QGRGGGDTTATPSATPSATPAATTPASASTVEVDGRHVPRWLYRLQGLSSIFTCELCDGR 382

Query: 430 VYNGRRTFERHFNEEAHLYHLRCLGI--EPSPAFKGITKIAEVQKL 473
            ++GR  +ERHF    H   L CLG+  E    F+G+ K+  V +L
Sbjct: 383 EFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLDAVLEL 428

>SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly
           similar to gnl|GLV|KLLA0D05621g Kluyveromyces lactis
           KLLA0D05621g and similar to YLR074C uniprot|Q08004
           Saccharomyces cerevisiae YLR074C BUD20 Protein involved
           in bud-site selection diploid mutants display a random
           budding pattern instead of the wild-type bipolar pattern
          Length = 169

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE 318
           YC  C+K+F+T    + HL GK HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETAMALKTHLKGKVHKRRVKELKGVPYTQ 87

>Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C
           (BUD20) -  [contig 244] FULL
          Length = 162

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE 318
           YC  C+K+F+T    + HL GK HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETRIALKTHLKGKVHKRRVKELKGVPYTQ 87

>Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {ON}
           YLR074C (REAL)
          Length = 169

 Score = 35.4 bits (80), Expect = 0.15,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE--------YKLHRYLKYLKD 330
           YC  C+K+ +T    + HL GK HK+   + K   Y++        Y L+++L  +KD
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFLDRVKD 107

>Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON}
           similar to Ashbya gossypii ABR234C
          Length = 171

 Score = 34.3 bits (77), Expect = 0.37,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE 318
           YC  C+K+F+T    + HL GK HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETAVALKTHLKGKIHKRRVKELKGVPYTQ 87

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
           Anc_2.15 YNL227C
          Length = 659

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 282 CPFCSKWFKTFPVFENHLSGKNHKKN 307
           C  C+K FK+    ENHLS + HKKN
Sbjct: 355 CDICNKIFKSLKQLENHLSTRMHKKN 380

>NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {ON}
           Anc_8.11 YLR074C
          Length = 169

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 16/122 (13%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE--------YKLHRYLKYLKDEF 332
           YC  C+K+F+T    + HL  K HK+   + K   Y++        Y L+++L  +++  
Sbjct: 50  YCIHCAKYFETAIALKTHLKTKVHKRRVKELKGVPYTQEVADAAAGYNLNKFLNRVQE-- 107

Query: 333 FHTRSFIERK-----LAFTANERMAEMDSLTEKYE-APAYDHTEGEGDGQCDAGRKGDLL 386
            +++S +E+      L    +E +A + +       A   D T      Q ++ ++G++L
Sbjct: 108 INSKSGVEKTENETLLKEHLDETLANVKTTEPTLPWAQNTDETSSSNGTQAESLQEGEVL 167

Query: 387 QE 388
            E
Sbjct: 168 ME 169

>KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa]
           {ON} highly similar to uniprot|Q08004 Saccharomyces
           cerevisiae YLR074C BUD20 Protein involved in bud-site
           selection diploid mutants display a random budding
           pattern instead of the wild-type bipolar pattern
          Length = 159

 Score = 33.1 bits (74), Expect = 0.71,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE 318
           YC  C+K+F+T    + HL GK HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETGVALKTHLKGKVHKRRVKELKGVPYTQ 87

>CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]
           {ON} similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074c
          Length = 172

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE 318
           YC  C+K+F+T    + HL GK H++   + K+  Y++
Sbjct: 50  YCIHCAKYFETGIALKTHLKGKIHRRRVKELKSIPYTQ 87

>Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {ON}
           YLR074C (REAL)
          Length = 166

 Score = 33.1 bits (74), Expect = 0.80,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE--------YKLHRYLKYLKD 330
           YC  C+K+ +T    + HL GK HK+   + K+  Y++        Y L+++L  +++
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKSVPYTQEVSDAAAGYNLNKFLNRVQE 107

>ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR074C
           (BUD20)
          Length = 175

 Score = 33.1 bits (74), Expect = 0.95,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE 318
           YC  C+K+F+T    + HL GK HK+   + +   Y++
Sbjct: 65  YCIHCAKYFETPAALKTHLKGKVHKRRVKELRGVPYTQ 102

>NDAI0A08110 Chr1 complement(1859548..1860819) [1272 bp, 423 aa]
           {ON} Anc_3.389 YBR128C
          Length = 423

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 87/194 (44%), Gaps = 31/194 (15%)

Query: 81  LFLRDYHEKQKAFNE---SNNLE-GVEEDDKEVDRFEQNLQELEERLKNEDDNFQLDINL 136
           L LRD  +K + F E   +N ++  +E+ +K +D     + EL+  LKN           
Sbjct: 76  LILRDKLKKLQHFKEQKRNNRIKFRIEQMNKRLDDKRTKIAELQVELKNS---------- 125

Query: 137 TRSKYALFSS-SADPSKRTNILSERARDLDLNKIFTRDEQYGEYMELDQFHYL--WLNVI 193
               Y++ S+ + D      +L ER    +L +  T+ E+  E   + Q + L  W  + 
Sbjct: 126 ----YSMASTINIDTHIDAALLHERD---ELKRELTQLEKLVETKRISQINQLTDWFMIK 178

Query: 194 RRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYLETF--FFKSYVLF 251
           +RSD  L+ +    E  +  K F   P M       +D + ++S Y+        S + F
Sbjct: 179 KRSDTHLVPYSISFEPIISMKSFHKIPRM-----VAIDSIAKMSHYIGILSKLINSKLPF 233

Query: 252 DKEMVENSIESDFE 265
           D+ + ++S+ +D++
Sbjct: 234 DESIFQSSLLTDYQ 247

>Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {ON}
           YLR074C (REAL)
          Length = 164

 Score = 32.3 bits (72), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE--------YKLHRYLKYLKD 330
           YC  C+K+ +T    + HL GK HK+   + K   Y++        Y L+++L  +++
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFLDRVQE 107

>TDEL0D04720 Chr4 (866844..867605) [762 bp, 253 aa] {ON} Anc_3.150
           YDL043C
          Length = 253

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 280 IYCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSEYKLHRY-LKYLKDEFFH 334
           + C  C+    ++   E HLSGK H  N  +R NT  +      Y  K  +D  FH
Sbjct: 68  LVCKLCNTMHVSWSSVERHLSGKKHGLNVLRRGNTTSNGNGGSEYSAKNDRDREFH 123

>YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}
           BUD20Protein involved in bud-site selection; diploid
           mutants display a random budding pattern instead of the
           wild-type bipolar pattern
          Length = 166

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE--------YKLHRYLKYLKD 330
           YC  C+K+ +T    + HL GK HK+   + +   Y++        Y L+++L  +++
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNKFLNRVQE 107

>TDEL0C00340 Chr3 (45150..45635) [486 bp, 161 aa] {ON} Anc_8.11
           YLR074C
          Length = 161

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE--------YKLHRYL 325
           YC  C+K+ +T    + HL  K HK+  ++ K   Y++        Y L+++L
Sbjct: 50  YCIHCAKYLETAIALKTHLKSKRHKRRVSELKGVPYTQETSDAAAGYNLNKFL 102

>Kpol_1023.82 s1023 (194025..195380) [1356 bp, 451 aa] {ON}
           (194025..195380) [1356 nt, 452 aa]
          Length = 451

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 12/101 (11%)

Query: 324 YLKYLKDEF-FHTRSFIERKLAFTANERMAEMDSLTEKYEAPAYDHTEGEGDGQCDAG-- 380
           + +Y+K E  F T+    RK+    NER  E+D L E+ E  A D  + E DG  +A   
Sbjct: 183 WYEYVKFELNFITKLINRRKVMGLINEREQELDMLKEQEEKNADDENDAESDGDEEASGY 242

Query: 381 -----RKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHG 416
                  GD +++K       DM +  D    P     LHG
Sbjct: 243 LKRGPSTGDSMKDKLNELPEADMNMLGDKDTNP----ALHG 279

>KLTH0G12980g Chr7 (1112178..1114091) [1914 bp, 637 aa] {ON} highly
           similar to uniprot|Q08032 Saccharomyces cerevisiae
           YLR103C CDC45 DNA replication initiation factor
          Length = 637

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 13/75 (17%)

Query: 187 YLWLNVIRRS--DCSLLQFFNILELFVDDKKFLLTP----------PMDRKNDRYMDFLM 234
           YLWL V+  +  D S  Q +N L+  + D+   L+P           ++ + D Y+ FL+
Sbjct: 262 YLWLTVLGATSLDTSYPQIYNRLQPILQDEVRRLSPNESYKTPDTISLEIQPDYYL-FLL 320

Query: 235 RLSKYLETFFFKSYV 249
           R S   ++FF+ +YV
Sbjct: 321 RHSSLYDSFFYSNYV 335

>TPHA0D00200 Chr4 (25129..25629) [501 bp, 166 aa] {ON} Anc_8.11
           YLR074C
          Length = 166

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIE 340
           YC  C+K+ +T    + HL  K HK+   + K   Y++   +       ++F +    I+
Sbjct: 50  YCIHCAKYMETAIALKTHLKTKVHKRRVKELKEVPYTQEVANAAAGVDLNKFLNRVEQIK 109

Query: 341 RKLAFTANERMAEM-DSLTEK 360
            K+    N+    + D LTEK
Sbjct: 110 TKVGIEKNDNEVLLKDHLTEK 130

>KAFR0C03500 Chr3 complement(711163..712314) [1152 bp, 383 aa] {ON}
           Anc_8.37 YFL030W
          Length = 383

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 82/212 (38%), Gaps = 56/212 (26%)

Query: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           E LK  D  + LD  L+ S+ AL      P     ++S+RA D+ L++   + +  G Y 
Sbjct: 179 ETLKFHD--WGLDFALSASQKAL---GMAPGLSVCMISDRALDVALDE---KTKPTGFYA 230

Query: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240
            +      W  V++ S+  +  +F              TPP+          +  L+  L
Sbjct: 231 SIKN----WYPVLKNSELGVATYFA-------------TPPVQ--------LIAALNVAL 265

Query: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300
           +      Y                     KGLV  +A+       SKWFKT  V E HL 
Sbjct: 266 KEILSYKY---------------------KGLVGIDARVAKHADVSKWFKTKMVQELHLK 304

Query: 301 -GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDE 331
              + +KN A   + +Y++      + YLK+E
Sbjct: 305 LLPSSEKNAANGLSAIYADDP-ASLISYLKNE 335

>SAKL0H16302g Chr8 (1430654..1432552) [1899 bp, 632 aa] {ON} highly
           similar to uniprot|Q08032 Saccharomyces cerevisiae
           YLR103C CDC45 DNA replication initiation factor
          Length = 632

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 13/78 (16%)

Query: 184 QFHYLWLNVIRRS--DCSLLQFFNILELFVDDKKFLLTP----------PMDRKNDRYMD 231
           +  +LWL ++  S  D S  Q +N L   + D+   L+P           +D + D Y+ 
Sbjct: 256 KLQFLWLTILGASSLDTSFPQVYNKLRPLLQDEVKRLSPNDSTKTPDTLALDIQPDYYL- 314

Query: 232 FLMRLSKYLETFFFKSYV 249
           FL+R S   ++F++ +YV
Sbjct: 315 FLLRHSSLYDSFYYSNYV 332

>KLLA0D05621g Chr4 complement(486879..487382) [504 bp, 167 aa] {ON}
           similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074C BUD20 Protein involved in bud-site selection
           diploid mutants display a random budding pattern instead
           of the wild-type bipolar pattern
          Length = 167

 Score = 30.8 bits (68), Expect = 5.4,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 281 YCPFCSKWFKTFPVFENHLSGKNHKKNEAKRKNTVYSE 318
           YC  C+K+F+T    + HL  K HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETAYALKTHLKTKIHKRRVKELKGVPYTQ 87

>Kwal_56.23671 s56 (649753..651726) [1974 bp, 657 aa] {ON} YLR103C
           (CDC45) - Chromosomal DNA replication initiation protein
           [contig 175] FULL
          Length = 657

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 13/77 (16%)

Query: 185 FHYLWLNVIRRS--DCSLLQFFNILELFVDDKKFLLTP----------PMDRKNDRYMDF 232
             YLWL ++  +  D S  Q +N L+  + D+   L+P           ++ + D Y+ F
Sbjct: 280 ISYLWLAILGATSLDASYPQIYNRLQPLLQDEVKRLSPNESLKTPDTLSLEIQPDYYL-F 338

Query: 233 LMRLSKYLETFFFKSYV 249
           L+R S   ++FF+ +YV
Sbjct: 339 LLRHSSLYDSFFYSNYV 355

>KLTH0F10186g Chr6 complement(878318..878878) [561 bp, 186 aa] {ON}
           similar to uniprot|Q12368 Saccharomyces cerevisiae
           YDL098C SNU23 23 kD U4/U6.U5 snRNP associated protein
           Putative RNA binding zinc finger protein
          Length = 186

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 7/64 (10%)

Query: 245 FKSYVLFDKEMVENSIESDFE---NSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLSG 301
           + ++ L   E  +NS E        SY KG    +  G YC  C   FK    F NHL+ 
Sbjct: 44  YSNHALLVAEATQNSNERVLAPTITSYKKG----KQFGFYCELCDLTFKDTLQFVNHLNH 99

Query: 302 KNHK 305
           K H+
Sbjct: 100 KTHQ 103

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,692,009
Number of extensions: 3027947
Number of successful extensions: 15248
Number of sequences better than 10.0: 266
Number of HSP's gapped: 15961
Number of HSP's successfully gapped: 269
Length of query: 531
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 417
Effective length of database: 40,409,475
Effective search space: 16850751075
Effective search space used: 16850751075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)