Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.81.10ON1441447371e-101
Suva_3.1571.10ON1441446591e-89
Smik_3.191.10ON1441446218e-84
YCL056C (PEX34)1.10ON1441446088e-82
KLLA0C00594g1.10ON194123952e-04
TDEL0C069301.10ON184142880.002
KAFR0D001901.10ON185161860.003
SAKL0C00572g1.10ON338120830.011
KNAG0C002701.10ON174167700.49
KAFR0C014103.97ON43961662.3
KLLA0F12232g1.392ON63957652.5
ZYRO0F18370g1.10ON220120643.4
SAKL0H16192g8.296ON39470643.6
TBLA0H003302.413ON86034644.6
CAGL0H02695g1.212ON54950626.9
NOTE: 8 genes in the same pillar as Skud_3.8 were not hit in these BLAST results
LIST: Kpol_2002.13 NCAS0B09060 TBLA0A04970 KLTH0F00572g Kwal_33.13023 Ecym_1012 TPHA0E03960 NDAI0A00190

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.8
         (144 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...   288   e-101
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...   258   1e-89
Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...   243   8e-84
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...   238   8e-82
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    41   2e-04
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    39   0.002
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    38   0.003
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    37   0.011
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    32   0.49 
KAFR0C01410 Chr3 (288872..290191) [1320 bp, 439 aa] {ON} Anc_3.9...    30   2.3  
KLLA0F12232g Chr6 (1129199..1129312,1129532..1131337) [1920 bp, ...    30   2.5  
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    29   3.4  
SAKL0H16192g Chr8 complement(1412029..1413213) [1185 bp, 394 aa]...    29   3.6  
TBLA0H00330 Chr8 complement(61443..64025) [2583 bp, 860 aa] {ON}...    29   4.6  
CAGL0H02695g Chr8 complement(244561..246210) [1650 bp, 549 aa] {...    28   6.9  

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  288 bits (737), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%)

Query: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60
           MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS
Sbjct: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60

Query: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120
           VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM
Sbjct: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120

Query: 121 VLIYPGTRLFRRLSNIMTLCRIII 144
           VLIYPGTRLFRRLSNIMTLCRIII
Sbjct: 121 VLIYPGTRLFRRLSNIMTLCRIII 144

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  258 bits (659), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 136/144 (94%)

Query: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60
           MVPK++  EIGG+D WT +WN  SSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSW+S
Sbjct: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60

Query: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120
           VVRC+WKLIKLC+VKFKI+ERLNGQGNGLIKEKL+NF KMYNDQI+QI ANLLQDLSYLM
Sbjct: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120

Query: 121 VLIYPGTRLFRRLSNIMTLCRIII 144
           VLIYPGTRLF+RLSN++TLCRIII
Sbjct: 121 VLIYPGTRLFKRLSNVITLCRIII 144

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  243 bits (621), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (91%)

Query: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60
           MV +K +AE+ GK++W N+WN  SSLLDFFAVLENLGVVDDKLY+SG+LRKVWLCYSW+S
Sbjct: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60

Query: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120
           V++C+WKLI LCKVKFKID+RLNG GNGL+KEKL+NF+K Y DQIRQI A LLQDLSYLM
Sbjct: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120

Query: 121 VLIYPGTRLFRRLSNIMTLCRIII 144
           VLIYPGTRLF+RLSNI+TLCRIII
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIII 144

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score =  238 bits (608), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 112/144 (77%), Positives = 132/144 (91%)

Query: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60
           MV KK+TAEI  KDIW NIW+  SSLLDFFAVLENLGVV+DKLY+SG+LRKVWLCYS +S
Sbjct: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60

Query: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120
           V++C+WKLIKLCKVKFKID+RL+G+GNGL+K+KL+NF+K YN+ IR I A LLQDLSYLM
Sbjct: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120

Query: 121 VLIYPGTRLFRRLSNIMTLCRIII 144
           VLIYPGTRLF+RLSNI+TLCRII+
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIIV 144

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 13/123 (10%)

Query: 13  KDIWTNIWNSASSLLDFFAVLENLGVVDD------KLYLSGILRKVWLCYSWVSVVRCIW 66
           +D+  +   S SS  D   +L + G++ D      KL    I  KVWL    +S+ R + 
Sbjct: 34  EDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLLLSIRRSLT 93

Query: 67  KLIKLCKVKFKI-DERLNGQGN------GLIKEKLVNFRKMYNDQIRQIIANLLQDLSYL 119
           +L  L ++K K+  E +N           L+KEK++      + +IR +  +LLQDL Y+
Sbjct: 94  RLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRSLCMDLLQDLLYM 153

Query: 120 MVL 122
           +++
Sbjct: 154 IIV 156

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 69/142 (48%), Gaps = 22/142 (15%)

Query: 22  SASSLLDFFAVLENLGVVDDKLYL------SGILRKVWLCYSWVSVVRCIWKLIKLCKVK 75
           S  S  D     ++LG++ +  +L       G   K+W     +SV +C+ ++ ++ + +
Sbjct: 32  SVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKCLRQIFQIVRNR 91

Query: 76  FKIDERL-----NGQG--NGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLMVLIYP--- 125
            ++   +     NG+G  N ++KEK++   +  N  +R+ + +LLQ+  YLM+++     
Sbjct: 92  IRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLMIVVIDVFK 151

Query: 126 ------GTRLFRRLSNIMTLCR 141
                   ++   LSN +T+ R
Sbjct: 152 LNIPKRARQILEPLSNFVTIMR 173

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 71/161 (44%), Gaps = 30/161 (18%)

Query: 13  KDIWTNIWNSASSLLDFFAVLENLGVVDD------KLYLSGILRKVWLCYSWVSVVRCIW 66
           +DI  +      ++ D    L+NLGV+ +      KL    +  K+WL    +S+ RC  
Sbjct: 20  EDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCFK 79

Query: 67  KLIKLCKVKFKIDERL------------NGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQ 114
            L  + + + K    L            NG  NG++K+KL+   +  N  IR ++   LQ
Sbjct: 80  NLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEFLQ 139

Query: 115 DLSYLMVLIYP------------GTRLFRRLSNIMTLCRII 143
            L YL+++I              G R    LSN++T+ RII
Sbjct: 140 VLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRII 180

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 58/120 (48%), Gaps = 8/120 (6%)

Query: 10  IGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVSVVRCIWKLI 69
           IGG +  TN+++    LL  F ++     V   L   G+  K+WL    +S+ + + +L 
Sbjct: 181 IGGLESLTNVFDDVY-LLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQLF 239

Query: 70  KLCKVKFKIDERLNGQGNG-------LIKEKLVNFRKMYNDQIRQIIANLLQDLSYLMVL 122
           +L + +  + +      +        +I +K        + QI+ ++ ++LQ+L+YL+V+
Sbjct: 240 RLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDVLQNLAYLLVV 299

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 31.6 bits (70), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 80/167 (47%), Gaps = 28/167 (16%)

Query: 5   KSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYL------SGILRKVWLCYSW 58
           K+ A +  +D+      S  S+ D   +L++LG++  + +L        +  KVW     
Sbjct: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61

Query: 59  VSVVRCIWKLIKLCKVKFK----IDERLNGQG------NGLIKEKL-VNFRKMYNDQIRQ 107
           +S+ + + +L++L + +FK    I++ L  +       N ++  KL  N RK +   I  
Sbjct: 62  LSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHF-MIID 120

Query: 108 IIANLLQDLSYLMVL------IYPGTRLFRR----LSNIMTLCRIII 144
              +L Q L YL ++      I P  + F++    +SN++T+ R+++
Sbjct: 121 TFLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167

>KAFR0C01410 Chr3 (288872..290191) [1320 bp, 439 aa] {ON} Anc_3.97
           YOL097C
          Length = 439

 Score = 30.0 bits (66), Expect = 2.3,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 32/61 (52%)

Query: 54  LCYSWVSVVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLL 113
           + Y +++  +   + +K C  K+K  E L+G+   L  E L  F K + D+ +Q+   LL
Sbjct: 348 VAYQYLAFFKDDDEFLKECYDKYKSGELLSGEMKKLCIEVLQEFVKAFQDRRKQVDEELL 407

Query: 114 Q 114
           +
Sbjct: 408 E 408

>KLLA0F12232g Chr6 (1129199..1129312,1129532..1131337) [1920 bp, 639
           aa] {ON} similar to uniprot|P53541 Saccharomyces
           cerevisiae YNL012W
          Length = 639

 Score = 29.6 bits (65), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 52  VWLCYSWVSVVRC-IWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQ 107
           +W C S+V+ +    W L+KL   +F +D         L+ E + NF    +D IRQ
Sbjct: 69  LWECTSYVAGISGGSWTLLKLVLAEFNVDTLTKFDIERLMLEGIPNFDVKNHDMIRQ 125

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 55/120 (45%), Gaps = 20/120 (16%)

Query: 21  NSASSLLDFFAVLENLGVVDDKLYLSGIL------RKVWLCYSWVSVVRCIWKLIKLCKV 74
            S   L D   +L+ LG++ +   L   L       K+W     +S  +   +L+K+ K 
Sbjct: 66  ESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLLSARKSFSRLLKIMKA 125

Query: 75  KFKIDER---LNGQGN-GLIKEKLVNFRKMYNDQ-------IRQIIANLLQDLSYLMVLI 123
           K K+ E    L  +G+  L+K+ L   R  + D        I+ ++  LLQ L+YL +++
Sbjct: 126 KSKLKEEMKELRTEGDEDLVKQVL---RNKFTDALKKCSIIIKDVVLELLQTLAYLAIVV 182

>SAKL0H16192g Chr8 complement(1412029..1413213) [1185 bp, 394 aa]
           {ON} similar to uniprot|Q7LI70 Saccharomyces cerevisiae
           YLR107W REX3 RNA exonuclease required for maturation of
           the RNA component of RNase MRP functions redundantly
           with Rnh70p and Rex2p in processing of U5 snRNA and
           RNase P RNA member of RNase D family of exonucleases
          Length = 394

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 4/70 (5%)

Query: 11  GGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVSVVRCIWKLIK 70
           GG+   T +   A    D    L+ + + +D L  +G + K++      SV  C++    
Sbjct: 93  GGQGTTTVLSKKA----DVIKKLKEMLLAEDLLVQNGYITKLYAMSPEESVSSCLYISCH 148

Query: 71  LCKVKFKIDE 80
            C  KFK DE
Sbjct: 149 RCSTKFKKDE 158

>TBLA0H00330 Chr8 complement(61443..64025) [2583 bp, 860 aa] {ON}
           Anc_2.413 YMR125W
          Length = 860

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%)

Query: 8   AEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDD 41
            EI  +D  T +WN +  +L FFA+L  L +VDD
Sbjct: 134 EEIPSED--TGVWNKSKLILRFFALLSPLLIVDD 165

>CAGL0H02695g Chr8 complement(244561..246210) [1650 bp, 549 aa] {ON}
           some similarities with uniprot|P47011 Saccharomyces
           cerevisiae YJL137c GLG2 self-glucosylating initiator of
           glycogen synthesis
          Length = 549

 Score = 28.5 bits (62), Expect = 6.9,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 76  FKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLMVLIYP 125
           F++ + ++  G G +K  +V  + +YND +  I  NLL  L   +VL+ P
Sbjct: 26  FQLRKLIDAGGCGCVKTCIVVTKLLYNDILSDISKNLLNCLYDDIVLVDP 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.143    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,335,338
Number of extensions: 613812
Number of successful extensions: 2169
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2163
Number of HSP's successfully gapped: 25
Length of query: 144
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 45
Effective length of database: 42,129,465
Effective search space: 1895825925
Effective search space used: 1895825925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)