Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.71.9ON71271238210.0
Suva_3.1561.9ON71271234790.0
YCL057W (PRD1)1.9ON71271234200.0
Smik_3.181.9ON71271234160.0
Kpol_2002.121.9ON73970924400.0
NCAS0B090701.9ON73068124110.0
TPHA0E039701.9ON74770524090.0
KNAG0C002601.9ON74467923980.0
KAFR0D001801.9ON72370523780.0
ZYRO0F18392g1.9ON72568923650.0
TBLA0A075601.9ON74168123460.0
SAKL0C00550g1.9ON73269023450.0
NDAI0A001801.9ON74068923240.0
KLLA0C00572g1.9ON71271022780.0
CAGL0B00418g1.9ON74371621860.0
Ecym_1011na 1ON71668020230.0
AGR406C1.9ON68369017740.0
AGR405Cna 1ON71768317350.0
ABR185WsingletonON4574149561e-121
NDAI0E020102.432ON7786495158e-55
TBLA0I007102.432ON7736745141e-54
ZYRO0G20130g2.432ON7866675122e-54
SAKL0E03938g2.432ON7676685113e-54
NCAS0A042802.432ON7736504867e-51
Smik_11.1022.432ON7726454858e-51
Suva_11.912.432ON7756614831e-50
Skud_11.932.432ON7726384822e-50
KAFR0D029502.432ON7776584822e-50
Ecym_60992.432ON7735604813e-50
Kpol_297.82.432ON7876634717e-49
CAGL0D02112g2.432ON7616614653e-48
YKL134C (OCT1)2.432ON7726514644e-48
TDEL0A020802.432ON7876464645e-48
KLTH0D04730g2.432ON7726474636e-48
KNAG0A062002.432ON7895664629e-48
AFR198W2.432ON7766354565e-47
Kwal_26.76162.432ON7705654442e-45
TPHA0G023902.432ON7956354353e-44
KLLA0B12397g2.432ON7796714123e-41
Kwal_23.43705.59ON69280860.100
KLTH0B08580g5.59ON63480840.16
TDEL0D025505.446ON276161706.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.7
         (712 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)   1476   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...  1344   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...  1321   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)  1320   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   944   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   933   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   932   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   928   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   920   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   915   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   908   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   907   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        899   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   882   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   846   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   783   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   687   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   672   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   372   e-121
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   202   8e-55
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   202   1e-54
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   201   2e-54
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   201   3e-54
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   191   7e-51
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   191   8e-51
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   190   1e-50
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   190   2e-50
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   190   2e-50
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   189   3e-50
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   186   7e-49
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   183   3e-48
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   183   4e-48
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   183   5e-48
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   182   6e-48
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   182   9e-48
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   180   5e-47
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   175   2e-45
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   172   3e-44
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   163   3e-41
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    38   0.100
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    37   0.16 
TDEL0D02550 Chr4 (490475..491305) [831 bp, 276 aa] {ON} Anc_5.44...    32   6.6  

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1476 bits (3821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/712 (100%), Positives = 712/712 (100%)

Query: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60
           MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK
Sbjct: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60

Query: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120
           SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL
Sbjct: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180
           DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180

Query: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240
           IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV
Sbjct: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300
           TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300

Query: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360
           NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360

Query: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420
           YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK
Sbjct: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480
           QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600
           TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE
Sbjct: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600

Query: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712
           FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS
Sbjct: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score = 1344 bits (3479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/712 (89%), Positives = 680/712 (95%)

Query: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60
           MRLLLCKNWF SPVI+PLLYTR LS+MT  ASFP APQ PP+WSFTP DI G+T EII+K
Sbjct: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60

Query: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120
           SNKFY+ MSQVESP+VTNF+EPFMKFENELGPIIN+LTFLQHVSSDKEIRDASVDSSMKL
Sbjct: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180
           DELNIDLSLRHD+FLQFARVWQDAQ +ADS+++ETF+YIEKSYKD+IHSGLELDE +RLK
Sbjct: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180

Query: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240
           +KEIKKKIS+NSINFSKNLGEQKE+ITFTKEQLEGVPDSILAQFET +S K   +TLYKV
Sbjct: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300
           TFKYPDIFPVMKLASS+QTRKQAFLADQNKV ENEAILLDTLKLRDE+ASLLGY+TYA+Y
Sbjct: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300

Query: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360
           NLYDKMAKDS TVMDFLNDLK KLIPLG+KELQ+LQDMK KDV++  +DEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360

Query: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420
           YYDNK+LLENFNVDLEKISE+FPLETTITGMLQIYETLFNLKFIETK PQ KSVWHEDVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480
           QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFM+ND+ RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600
           TWNKNEL+ LSSHYKTGE+IPE LIDSLIKTKHVNGALFTLRQLHFGLFDMKVH+CKDL+
Sbjct: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600

Query: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC TWNQLRQ+ISLM NGGTLSKGY SFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712
           FAKDPLNTKNG+QYRDIVLARGGL DIND+LKEFLGREPSKDAFLKELGLQ+
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score = 1321 bits (3420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/712 (89%), Positives = 678/712 (95%)

Query: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60
           MRLLLCKNWF SPVISPLLYTR L +M N  SFPIAPQAPP WSFTP+DI GKT EII+ 
Sbjct: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60

Query: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120
           SN FY+ MS+VESPSV+NF+EPFMKFENELGPIIN+LTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180
           DELNIDLSLRHDIFLQFARVWQD Q KADS+++ETFKY+EKSYKD+IHSGLELDE NRLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180

Query: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240
           IKEIKKKIS+NSINFSKNLGEQKEYITFTKEQLEGVPDSIL QFET KS+K   +TLYKV
Sbjct: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300
           TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGY+TYA+Y
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300

Query: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360
           NLYDKMA+DS TVM+FLNDLK KLIPLG+KELQVLQDMK +DV++  +  DPNYYIWDHR
Sbjct: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360

Query: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420
           YYDNK+LLENFNVDLEKISEYFPLE TITGML+IYETLFNLKFIETK+ QNKSVWH+DVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480
           Q+AVWNMDDPKSP F+GWIYFDLHPRDGKYGHAANFGLSSSFMI+D+ RSYPVTALVCNF
Sbjct: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600
           TWNKNEL++LSSHYKTGE+IPESLI+SLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDL+
Sbjct: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC TWNQLRQ+ISL+ NGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712
           FAKDPLN KNG+QYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ+
Sbjct: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1320 bits (3416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/712 (89%), Positives = 683/712 (95%)

Query: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60
           MRLLLCKNWFTSP+ISPLLYTR L +M+NA SFPIAPQAPP W+FTP DI GKT EIIDK
Sbjct: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60

Query: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120
           SN FYE MS VE+P+VTNF+EPFMKFENELGPIIN+LTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180
           DELNIDLSLRHDI+LQFARVWQDAQ K+DS+++ETFKYIEKSYKD+IHSGLELDE+NRLK
Sbjct: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180

Query: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240
           IK+IKKKIS+NSINFSKNLGEQKEYITFTKEQLEGVPDS+LAQFET KS+K   +TLYKV
Sbjct: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300
           TFKYPDIFPVMKLASSAQTRK+AFLADQNKVPENEAILLDTL+LRD+LASLLGY+TYA+Y
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300

Query: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360
           NLYDKMAKDS TVMDFLNDLK KLIPLGKKEL++LQ+MK KDV++  +DEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360

Query: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420
           YYDNK+LLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIE K+ Q+KSVWH+DVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480
           QLAVWNMDDPKSP+F+GWIYFDLHPRDGKYGHAANFGLSSSFM NDS RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600
           TWNKNEL+ LSSHY+TGE+IPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDL+
Sbjct: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC TWNQLRQ+ISL+ NGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712
           FAKDPLNTKNG+QYRDIVLARGGL DI D+LK+FLGREPSKDAFLKELGLQ+
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/709 (62%), Positives = 566/709 (79%), Gaps = 10/709 (1%)

Query: 9   WFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELM 68
           +F  P I+  +     S MTN+ S  IAPQ  PTW++TP  I      +I  SN+ ++ +
Sbjct: 35  FFAVPAIAFTILK--YSTMTNS-SLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNL 91

Query: 69  SQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLS 128
           + + SP+V NFI P+M  EN++ P+IN+LTFLQHVS+DK+IRD+S+ ++  +    I+ S
Sbjct: 92  AAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEAS 151

Query: 129 LRHDIFLQFARVWQDAQ------PKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIK 182
           LR D+F+QF ++W D +       K+DS   E++++IEK +KDFI SGL L +  R  +K
Sbjct: 152 LRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVK 211

Query: 183 EIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTF 242
           +I+KKI+ NS+NFSKNLGEQKE+I FTKE+L+GV D+++ QFE  K EK GE+  +KVTF
Sbjct: 212 DIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEK-FKVTF 270

Query: 243 KYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNL 302
           KYPDI PV+K A +  TRK AF ADQNKVPENEA+ +DTLKLR++L+++L Y+ YA+YNL
Sbjct: 271 KYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNL 330

Query: 303 YDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYY 362
             KMAK+  TV +FL+DLK KL PLG KE+++L+ +K KD++      D +YYIWDHRYY
Sbjct: 331 EMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRYY 390

Query: 363 DNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQL 422
           DNK+L +NFNVDLEKISEY+P+E++I GML+IYET+  LKF+E  +P  ++VWHEDVKQL
Sbjct: 391 DNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQL 450

Query: 423 AVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSK 482
           +VW MD+P +P FIGWIYFDLHPRDGKYGHAANFG+SSS++  + KRSYPVTALVCNFSK
Sbjct: 451 SVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSK 510

Query: 483 STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTW 542
            T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWTW
Sbjct: 511 PTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTW 570

Query: 543 NKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENL 602
           NKNEL+SLS HYKTGE+IPESLI+SL+ TKHVNGALF LRQLHF  FDM+VHT +D+  L
Sbjct: 571 NKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKL 630

Query: 603 SICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFA 662
           ++   WN LR++I L+ NG  +SKGYDSFGHIMS +YSAGYYGY+WAEVFATDMY+TKFA
Sbjct: 631 NLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFA 690

Query: 663 KDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711
            DPLN+K+GV+YRDI+L+RGG+Y++NDNL+EFLGREP+  AFLKE+GL 
Sbjct: 691 ADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN 739

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  933 bits (2411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/681 (64%), Positives = 549/681 (80%), Gaps = 4/681 (0%)

Query: 35  IAPQA-PPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPI 93
           +AP    PTW ++P  I  KT E+ID +   Y+ ++ +E PSV + ++P+M +EN+ G I
Sbjct: 51  VAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLI 110

Query: 94  INRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK 153
           +N+LTFLQHVS+DK IRDASV+++  L + +I+ S+R D+F QF ++W   +   D   K
Sbjct: 111 VNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSK 170

Query: 154 --ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTKE 211
             ET+K+IEK +KD++ +GL L E  R ++K+IKKKI+ NS+N+SKNLGEQKEY++FTKE
Sbjct: 171 DFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKE 230

Query: 212 QLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKV 271
           QL+GV +S++ QFE     K  E+  YKVTFKYPDIFPV+K A   +TRK A+++DQNKV
Sbjct: 231 QLKGVSESVMEQFEKFVDPKTNEEK-YKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKV 289

Query: 272 PENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKE 331
           P+NEA+ ++TLKLR++LA LLGY+TYA+YNL  KMAK+  TV DF+N+LK KL PLG+KE
Sbjct: 290 PQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKE 349

Query: 332 LQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITGM 391
           ++ L+ +K KD E      D +YYIWDHRYYDNK L +N+NVDLE+ISEY+PLE+TI GM
Sbjct: 350 IETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGM 409

Query: 392 LQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYG 451
           L IYETL  LKF++   P+ K VWHEDVKQLAVW MDD K+P FIGWIYFDLHPRDGKY 
Sbjct: 410 LGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYS 469

Query: 452 HAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLV 511
           HAANFG+SSS++  D  RS+PVTALVCNFSKST  KPSLLKHNEI TFFHELGHGIHDLV
Sbjct: 470 HAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLV 529

Query: 512 GQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKT 571
           G+NK +RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL+SLS HY+TGE+I E L+DSLI T
Sbjct: 530 GKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIAT 589

Query: 572 KHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSF 631
           KHVNGALF LRQLHFGLFDM VHT K++E+L++   WN+LR++I L+ NG  L+KGYDSF
Sbjct: 590 KHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSF 649

Query: 632 GHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNL 691
           GHIMSDSYSAGYYGY+WAEVFA DMY+TKFA DPLN++ GVQYRDIVLA GGLY+I D L
Sbjct: 650 GHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKL 709

Query: 692 KEFLGREPSKDAFLKELGLQS 712
           KEFLGREP+ DAFLKELGL +
Sbjct: 710 KEFLGREPTNDAFLKELGLHN 730

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/705 (64%), Positives = 552/705 (78%), Gaps = 15/705 (2%)

Query: 19  LYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTN 78
            YT     M N A+F IAPQ  P W F+P  I     +IID SN FY  M  +E+PS+ N
Sbjct: 46  FYTASQVKM-NEAAF-IAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIEN 103

Query: 79  FIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFA 138
           F+ P + FENE    IN+LTFLQHVS DK IRDAS++++  +   +I++SLR+D+F QF 
Sbjct: 104 FVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFD 163

Query: 139 RVWQDAQ--PKADSLKK------ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISM 190
           +++ D +   K + LK       E FKY+EK +KD++ SGL L E  R +IKEIKK+I++
Sbjct: 164 KIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIAL 223

Query: 191 NSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPV 250
           NS+ FSKNLGEQ E++ FTKE+LEGV D ++ QFET   E+ GE   +KVTFKYPDIFPV
Sbjct: 224 NSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDEQTGEQK-FKVTFKYPDIFPV 282

Query: 251 MKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDS 310
           +K A +  TRK AF ADQNKVPENE + +DTLKLR +L  +LGY+TYA+YNL  KMAK+ 
Sbjct: 283 LKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQ 342

Query: 311 RTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLEN 370
            TVM+FL DLK KL PL +KE++VL+ +K  + +      D +YYIWDHRYYDNK+L + 
Sbjct: 343 ETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDK 402

Query: 371 FNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWH-EDVKQLAVWNMDD 429
           FNVDLEKISEY+P+E+TI GML+IYET+ NLKFIE  +   KS W  +DVKQLAVW MDD
Sbjct: 403 FNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDD 462

Query: 430 PKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPS 489
           P  P F+GWIYFDLHPR+GKYGHAANFG++ S++  DSKR YPVTALVCNFS +T DKP+
Sbjct: 463 PSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPA 522

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVS 549
           LLKHNEI TFFHELGHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+S
Sbjct: 523 LLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLS 582

Query: 550 LSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD---LENLSICH 606
           LS HYKTGE+IPESL++SLI TKHVNGALF LRQLHFGLFDMKVHT  D   ++N+ +  
Sbjct: 583 LSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQ 642

Query: 607 TWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            WN LR+EISL+ NG  ++KGYDSFGHIMSDSYSAGYYGY+WAEVFATDMY++KFAKDPL
Sbjct: 643 LWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPL 702

Query: 667 NTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711
           NTK+G++YRDI+LARGG+ + NDNLKEFLGREPSK+AFLKELGLQ
Sbjct: 703 NTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/679 (64%), Positives = 542/679 (79%), Gaps = 6/679 (0%)

Query: 39  APPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLT 98
           A P W F    IG + T II+ +NKFY+ + ++ +PS+ N ++P+M  EN +G ++N+L 
Sbjct: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126

Query: 99  FLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK----- 153
           FLQHVSSDKEIR+AS  ++  L    I+ SLRHD+FLQF ++W++ +P+ +         
Sbjct: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186

Query: 154 ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTKEQL 213
           E +K++EK +KDF+ +GL L E +R K+K+IK KI+ NS+ FSKNLGEQKE++ F+KEQL
Sbjct: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246

Query: 214 EGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPE 273
           +GV D+++ QFE  K E   E T YKVTFKYPDIFPV+K+A +A+TRK AF  DQNKVP+
Sbjct: 247 DGVSDTVMEQFEQVKDETTNE-TNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQ 305

Query: 274 NEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQ 333
           NE + + TLKLRDELA+LLGY+TYA+YNL  KMAK   TV  FLNDLK KL PLG+KE+ 
Sbjct: 306 NEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIG 365

Query: 334 VLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITGMLQ 393
           +L+ +K  + +      D  YYIWDHRYYD K+L +NFNVD E I+EY+P+++TI GML+
Sbjct: 366 ILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLK 425

Query: 394 IYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHA 453
           IYET+F LKF+E K+   K+VW+EDVKQ+AVW MD+ K+P F+GWIYFDLHPRDGKYGHA
Sbjct: 426 IYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485

Query: 454 ANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513
           ANFG++SS++  D  RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+
Sbjct: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545

Query: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKH 573
           N+ +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L SLS HYKTGE+IPE L+DSLI TKH
Sbjct: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605

Query: 574 VNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGH 633
           VNGALF LRQLHFGLFDM VHT KD+ +L +   W  LRQEISL+ NGG  +KGYDSFGH
Sbjct: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665

Query: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNLKE 693
           IMSDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGLY+I+DNLKE
Sbjct: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725

Query: 694 FLGREPSKDAFLKELGLQS 712
           FLGREPSKDAFLKELGLQ+
Sbjct: 726 FLGREPSKDAFLKELGLQA 744

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/705 (63%), Positives = 560/705 (79%), Gaps = 10/705 (1%)

Query: 13  PVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVE 72
           P  S L+Y R  S MT +A   IAPQA P+W++ P+ +      +ID SN+ Y+ +S ++
Sbjct: 23  PATSYLVYNRLYSNMTISAF--IAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80

Query: 73  SPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHD 132
            P+V N + P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140

Query: 133 IFLQFARVWQDAQPKADSLKKE----TFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKI 188
           +FLQF ++WQ+   K D   KE    T+K+IEK +KD++ SGL L E  R KIKEIK KI
Sbjct: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKI 200

Query: 189 SMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIF 248
             NS+ +SKNLGEQKE I FT+E+L+GV D++  QFE    E+ GE+  +KVTFKYPDIF
Sbjct: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEK-FKVTFKYPDIF 259

Query: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAK 308
           PV+K A + +TR++AFLADQNKVP+NE + ++TLKLR+ELA+ L Y+TYA+YNL +KMAK
Sbjct: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319

Query: 309 DSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLL 368
              TV+DFLNDLK +L PL  KE+ +L+D+K K+ +   ++ D +YYI+DHRYYDNK+L 
Sbjct: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379

Query: 369 ENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMD 428
           +NFNVDLE ISEY+PLE TI GML+IYE LF LKF E  E +NKSVWHEDVKQLAVW MD
Sbjct: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE--ETKNKSVWHEDVKQLAVWKMD 437

Query: 429 DPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFM-INDSKRSYPVTALVCNFSKSTKDK 487
           +P+ P F+GWIYFDLHPRDGKYGHAANFG+SSS++ I   KRSYPVTALVCNFSKST  +
Sbjct: 438 NPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATR 497

Query: 488 PSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNEL 547
           PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NEL
Sbjct: 498 PSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANEL 557

Query: 548 VSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHT 607
            SLS HY++ E+IP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VHT  ++E+L++   
Sbjct: 558 KSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKL 617

Query: 608 WNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLN 667
           WN+LR+EI L+  G  LSKGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL+
Sbjct: 618 WNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLD 677

Query: 668 TKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712
           ++ GVQYRDIVLA GGLY+I DNL++FLGREPSK+AFLKELGL +
Sbjct: 678 SEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGLDA 722

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/689 (62%), Positives = 548/689 (79%), Gaps = 6/689 (0%)

Query: 25  SAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFM 84
           S M++   F IAPQ+ P+W+FTP  +  +T  +I+ S +FY+ ++Q+ +P+V N ++P+M
Sbjct: 39  STMSSPNLF-IAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYM 97

Query: 85  KFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDA 144
             EN +G I ++LTF Q VS+DKEIRDASV ++  L    I+ SLRHD+FLQF ++W + 
Sbjct: 98  HHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNEL 157

Query: 145 QPKA---DSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGE 201
           + K+    S + E +KY+EK ++D+   GL+L E  R K+K++K KI+ NS+ FSKNLGE
Sbjct: 158 KDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGE 217

Query: 202 QKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRK 261
           QKE++ FTKE+L+GV +S++ QFE  K E G   T YKVTFKYPDIFPV+K A + +TRK
Sbjct: 218 QKEFVAFTKEELDGVSESVMDQFEQFKDENG--TTKYKVTFKYPDIFPVLKTAKNPKTRK 275

Query: 262 QAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLK 321
            AF  DQ+KVP+NE + ++TL+LR+ELA +LGY+TYA+YNL  KMAK+   V  FLN+LK
Sbjct: 276 LAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELK 335

Query: 322 GKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEY 381
            KL PLG KE + L+ +K K+ E      D +YY+WDHRYYDNK+L +N+NVDLEKISEY
Sbjct: 336 DKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEY 395

Query: 382 FPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYF 441
           +P+E+TI+GML IYETL  LKF+E  +P+ +SVWHEDVKQLAVW MD+P  P F+GWIYF
Sbjct: 396 YPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYF 455

Query: 442 DLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501
           DLHPRDGKYGHAANFG+S+S++  D  RSYPVTALVCNFSK +  KPSLLKHNEI TFFH
Sbjct: 456 DLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFH 515

Query: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIP 561
           ELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+ EL  LSSHY++GE+IP
Sbjct: 516 ELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIP 575

Query: 562 ESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNG 621
           + L+ SLI TKHV+GALF LRQLHFGLFDM VHT K++  L +   WN+LR+E+SL+ NG
Sbjct: 576 KDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENG 635

Query: 622 GTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLAR 681
            T +KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA DPL++K GVQYRDIVL R
Sbjct: 636 DTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGR 695

Query: 682 GGLYDINDNLKEFLGREPSKDAFLKELGL 710
           GGLY+ NDNL+EFLGREPS++AFLKELGL
Sbjct: 696 GGLYETNDNLREFLGREPSEEAFLKELGL 724

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/681 (63%), Positives = 549/681 (80%), Gaps = 7/681 (1%)

Query: 36  APQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPIIN 95
           APQA PTW++TP+ +     ++ID+SN FY+ ++ ++SP   NF+ P+M +EN++G +IN
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 96  RLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK-- 153
           +LTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ +FLQF ++W   +   D  +K  
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 154 ---ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTK 210
              E ++++ K ++DF+ +GL LDE+ R KIKEIKK I+ NS+ F+ NLGEQ E++ FTK
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 211 EQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270
           E+L+GV DS++ QFE    EK G++ +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299

Query: 271 VPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKK 330
           V EN  +  +TLKLR++LA +LGY+TYA+YNL  KMAK   +V  FL DL  +L PLG K
Sbjct: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSK 359

Query: 331 ELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITG 390
           E+++L+ +K K+ +      D +YY+WDHRYYDNK+L +N+NVDLEKISEY+PL++TI G
Sbjct: 360 EIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEG 419

Query: 391 MLQIYETLFNLKFIETKE-PQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGK 449
           ML IYETL NLKFIE K+  +NK+VWH++VKQLAVW MD+P++P F+GWIYFDLHPRDGK
Sbjct: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479

Query: 450 YGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509
           YGHAANFG+SSS++  +++RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539

Query: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLI 569
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+SLS HYKTGE+IP  L++SL+
Sbjct: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599

Query: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYD 629
            TKHVNGALF LRQLHFGLFDMKVHT KDLENL     WN+LR+E+SL+ NG   +KGYD
Sbjct: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659

Query: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDIND 689
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL TK GV+YRD VLARGGLY+I D
Sbjct: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719

Query: 690 NLKEFLGREPSKDAFLKELGL 710
           NL +FLGR+PS +AFLKELGL
Sbjct: 720 NLIQFLGRKPSNEAFLKELGL 740

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/690 (62%), Positives = 539/690 (78%), Gaps = 9/690 (1%)

Query: 24  LSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPF 83
           +SA  +A   P  PQA P+W ++P DI   T E I  ++  ++ ++ VE+P+V + ++PF
Sbjct: 48  MSATMSATLVP--PQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPF 105

Query: 84  MKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQD 143
           ++ EN   P+IN+LTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+F+QF +VWQ 
Sbjct: 106 LEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQA 165

Query: 144 AQPKADSLKKETF---KYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLG 200
            +  A   KKE F   K++EK +KD++ +GL L E  R ++KE++KKIS NS+ FSKNLG
Sbjct: 166 CKDDA-KFKKEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLG 224

Query: 201 EQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTR 260
           EQKE++ FT E+L+GV  S++ QFE      G E   +KV+FKYPDI PV+K A + +TR
Sbjct: 225 EQKEFVAFTTEELDGVSASVMDQFEKFTDTDGVEK--HKVSFKYPDILPVLKTAKNPETR 282

Query: 261 KQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDL 320
           K+AF  DQNKVP+NE + L+TL+LRDELA LLGY+TYA+YNL  KMAK   TV+ FL DL
Sbjct: 283 KRAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDL 342

Query: 321 KGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISE 380
           K KL PLG KE++ L+ +K KD +      D +YYIWD+RYYDNK+L EN+NVD EKISE
Sbjct: 343 KNKLKPLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISE 402

Query: 381 YFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIY 440
           YFPLE TI GML+IYET+  LKF+E  + + K VWHEDVKQLAVW +D  +SP F+GWIY
Sbjct: 403 YFPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIY 462

Query: 441 FDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFF 500
           FDLHPRDGKYGHAANFG++SS+ + D  RS+PVTALVCNFSK +  KP+LLKH+EI TFF
Sbjct: 463 FDLHPRDGKYGHAANFGIASSY-VRDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFF 521

Query: 501 HELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERI 560
           HELGHGIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL +LS HY+TGE+I
Sbjct: 522 HELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKI 581

Query: 561 PESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPN 620
           PE L+DSLI TKHVNGALF LRQL FGLFDM VHTCKDLE+L +   WN LRQE+SL+ N
Sbjct: 582 PEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVEN 641

Query: 621 GGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLA 680
           G  ++KG++SFGHIMS +YSAGYYGY+WAEVFA DMYHTKFA DPLN   GV+YRDIVL+
Sbjct: 642 GDQVTKGFNSFGHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLS 701

Query: 681 RGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           RGGLY+I+DNL+EFLGREP+ +AFLKELGL
Sbjct: 702 RGGLYEIDDNLREFLGREPNNEAFLKELGL 731

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/689 (63%), Positives = 549/689 (79%), Gaps = 6/689 (0%)

Query: 25  SAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFM 84
           + + N   F       P W++TP  I  +T   I+K+NK+Y  +S++ESPS+ N I P+M
Sbjct: 55  NTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYM 114

Query: 85  KFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDA 144
            +EN++G +IN+LTFLQHVS+DK+IRDAS++++  L++ +I  SLR +I+ QF +VW+  
Sbjct: 115 NYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETV 174

Query: 145 QPKADSLKK---ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGE 201
           Q   D LK    ET+K+IEK +KD + +GL+ +   +LK   IK KIS +++ FS NLGE
Sbjct: 175 QNDDDFLKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKY--IKGKISADALTFSSNLGE 232

Query: 202 QKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRK 261
           Q EY++FTKE+L+GV ++++ QFE     K  E   YKVTFKYPDIFPV+K A + +TRK
Sbjct: 233 QNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKK-YKVTFKYPDIFPVLKTAKNPKTRK 291

Query: 262 QAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLK 321
            AFL DQNKVPENE +L + LKLR ELA+ LGY+TYA+YNL  KMAK+  TV+ FLNDLK
Sbjct: 292 IAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLK 351

Query: 322 GKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEY 381
            KL PL +KE+++L+D+K K+ E      D +YYIWDHRYYDNK+L +NFNVD+EKISEY
Sbjct: 352 EKLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEY 411

Query: 382 FPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYF 441
           +PLE+TI GML+IYET+ NLKFIE  +P  K+VWH DVKQL+VWNMDD  +P F+GWIYF
Sbjct: 412 YPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYF 471

Query: 442 DLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501
           DL+PRDGKYGHAANFG++SS++  ++KRSYPVTALVCNFSK TK+KP+LLKH+EI TFFH
Sbjct: 472 DLYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFH 531

Query: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIP 561
           ELGHGIHDLVGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL+SLS HYKTGE+IP
Sbjct: 532 ELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIP 591

Query: 562 ESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNG 621
           E L+DSLI TKHVNGALF LRQLHFGLFDM VHT KD+ENL +   WN+ R+EI L+ NG
Sbjct: 592 EDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENG 651

Query: 622 GTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLAR 681
              +KGY+SFGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   G++YRD++LA+
Sbjct: 652 ENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAK 711

Query: 682 GGLYDINDNLKEFLGREPSKDAFLKELGL 710
           GGLY+INDNL EFLGREPS   FLKELGL
Sbjct: 712 GGLYEINDNLLEFLGREPSNKPFLKELGL 740

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/710 (61%), Positives = 538/710 (75%), Gaps = 21/710 (2%)

Query: 11  TSPVISPLL------YTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKF 64
           TS V+ P L      +    S MT      + PQA P+W++T  ++  +T E ID SN+ 
Sbjct: 14  TSLVVIPTLAFASFQFNAIRSIMTKTDF--VVPQAAPSWNYTTEELLKQTHEAIDSSNEL 71

Query: 65  YELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELN 124
            + +  + +PSV NF+ P++  EN + P+ N+LTFLQHVSSDKE+RD S   +  ++   
Sbjct: 72  LDSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFG 131

Query: 125 IDLSLRHDIFLQFARVWQ----DAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180
           I+ SLR  +F QF  VW     DAQ K D    E +K++EK +KDF+ SGL L E  R K
Sbjct: 132 IESSLRFKLFRQFDIVWNQLKDDAQFKKDHF--EIYKFVEKCHKDFLRSGLNLPEEQRDK 189

Query: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240
           +KEIKKKIS NS+ FSKNLGEQ E+ITFTKE+L GV ++++ QFET   E G   T YKV
Sbjct: 190 VKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETV-DEDGI--TKYKV 246

Query: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300
           TFKYPDIFPV+K A +A+TRK+AF+ DQNKVP+NEA+ L+TL+LR++LA LL Y++YADY
Sbjct: 247 TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADY 306

Query: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360
           NL  KMAK    V+ FLNDLK KL PLG+KEL  L+++K ++ +      D  YYIWD+R
Sbjct: 307 NLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRYYIWDNR 366

Query: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420
           YYDN++L +NF +D EKI+EYFPLE+TI GMLQIYET+  LKFIE     N   WH DVK
Sbjct: 367 YYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIE---EDNGDTWHPDVK 423

Query: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480
           +L+VW MDD   P F+GWIYFDLHPR+GKYGHAANFG+SSSF+ +D  RSYPVTALVCNF
Sbjct: 424 KLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNF 482

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SK TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWDFVEAPSQMLEFW
Sbjct: 483 SKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFW 542

Query: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600
           TWNK EL SLS HY+T E+IP+SL+DSL++TKH+NGALF LRQLHFGLFDMKVHT KD+ 
Sbjct: 543 TWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDIS 602

Query: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
            L++   WN LR+EI L+ NG   +KG++SFGHIMSDSYSAGYYGY+WA+VFA+DMY+TK
Sbjct: 603 KLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTK 662

Query: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           F +DPLN+  GVQYRDI+LARGGLY+I DNL EFLGR+P+  AFLKELGL
Sbjct: 663 FLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/716 (60%), Positives = 540/716 (75%), Gaps = 15/716 (2%)

Query: 2   RLLLCKNWFTSPV--ISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIID 59
           R +   N +TS +   S L  TR     TN  S    PQ PP+W F P DI  +T E I 
Sbjct: 37  RGIHLNNTYTSSIRNYSQLANTR----FTNMPSL-TPPQYPPSWEFKPEDILSQTKEFIA 91

Query: 60  KSNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMK 119
            +  FY+ +  +++P++ N I P++  ENE   +IN+LTFLQHVS DK IRDAS++++M 
Sbjct: 92  NTKLFYDDLVAIDNPTIENLIVPYINHENENELLINQLTFLQHVSEDKTIRDASMEATML 151

Query: 120 LDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK-ETFKYIEKSYKDFIHSGLELDEANR 178
           L +  I+   R D+F QF  +W   + K D  +  E ++++EK +KD++ +GL L     
Sbjct: 152 LQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFEDFEIWRFVEKCHKDYVRAGLNLPADKL 211

Query: 179 LKIKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLY 238
            K+KEIKKKI+ N + FSKNLGEQKEYI FT E+L+GVP+S++ QFE    E G +    
Sbjct: 212 EKVKEIKKKIADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFEKVNDEFGIQKL-- 269

Query: 239 KVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYA 298
           KVT+KYPDIFPV+K A + +TR +AF+ DQNKVPENE +  DTLKLR+ELA +LGY+TYA
Sbjct: 270 KVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYA 329

Query: 299 DYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERS-KKDEDPNYYIW 357
           +YNL  KMAK++ TV+ F+NDL  KL    KKEL +L+++K ++ E       D +YYIW
Sbjct: 330 NYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIW 389

Query: 358 DHRYYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHE 417
           DHRYYDNK+L ENFNVD EKI+EY+PLE+TI GML+IYETL  LKF+E KE  NK  WH+
Sbjct: 390 DHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKE--NKKTWHD 447

Query: 418 DVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALV 477
           DVKQLAVW +D P++P F+GWI+FDLHPRDGKYGHAANFGLSSS++  +  RSYP+TALV
Sbjct: 448 DVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALV 507

Query: 478 CNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQML 537
           CNFSKSTKDKPSLLKH+EI TFFHELGHGIHDLVG N+  RFNGPG+VPWDFVEAPSQML
Sbjct: 508 CNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQML 567

Query: 538 EFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--T 595
           EFWTWN  EL+SLS +YK   +I   L++SLIKTKHVNGALF LRQLHFGLFDMKVH  +
Sbjct: 568 EFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMS 627

Query: 596 CKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATD 655
            ++L+ L I   WN LR++I L+ NG   + GY+SFGHIMS SYSAGYYGY+WAEVFATD
Sbjct: 628 AEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMSGSYSAGYYGYMWAEVFATD 687

Query: 656 MYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711
           MY+TKF  DPLN + GV+YRDIVLARGGLY+I+DNL+EFLGR+P+KDAFL+ELGL 
Sbjct: 688 MYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/680 (56%), Positives = 508/680 (74%), Gaps = 11/680 (1%)

Query: 35  IAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPII 94
           ++P+  P+W F   +I     + ID+  KFY+ ++ +E+P + NF+   +  E+E    +
Sbjct: 44  LSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDGYM 103

Query: 95  NRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKAD-SLKK 153
           ++LTFLQHVS+DKE+RDAS++++  + E  I+ S R+D++ QF++VW+  Q K D +LKK
Sbjct: 104 SQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWE--QYKDDENLKK 161

Query: 154 ---ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTK 210
              E + Y+E   KD+IH+G+ L E +R KIKEIKKK++ NS+ FS NLGEQ +YI FTK
Sbjct: 162 NDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTK 221

Query: 211 EQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270
           ++L GV ++ L QFE    E G E   YK+TFKYPDI PV+  A + +TRK+A++ DQNK
Sbjct: 222 DELVGVSETTLGQFEKV-IEDGVEK--YKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNK 278

Query: 271 VPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKK 330
           VP+NE IL++TLKLR+ELA + G+ TYA Y L  KMAK   TV +FL DLK KL+P GKK
Sbjct: 279 VPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKK 338

Query: 331 ELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITG 390
           +L+ L+ +K ++ +      + ++  WD+RYYD+K+L ENF+VD E++++YFPL+ TI G
Sbjct: 339 DLENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDG 398

Query: 391 MLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKY 450
           ML IY+ LFNLKF+E      K+VWHEDVKQ AVW++D   +P F+GWIYFDLHPR+GKY
Sbjct: 399 MLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREGKY 457

Query: 451 GHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDL 510
           GHAANFGL S ++  +  R YPVT LVCNFSK +  +P+LLKH E+VTFFHELGHGIH L
Sbjct: 458 GHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHAL 517

Query: 511 VGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIK 570
           VG+++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HY+TGE+IP+ L+DSLIK
Sbjct: 518 VGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIK 577

Query: 571 TKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDS 630
           TKHVN  L  LRQLHF LFDM VHT K+L+ L I   WN LR+E++L+ NG  L+KGYDS
Sbjct: 578 TKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDS 637

Query: 631 FGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDN 690
           F HIMS  YSAGYYGY+W+EVFA DMYHT FA +PL+T  G +YRDI+LA+GGL DI D+
Sbjct: 638 FSHIMS-GYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDS 696

Query: 691 LKEFLGREPSKDAFLKELGL 710
           L+EFLGREP+  AFLKELGL
Sbjct: 697 LEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/690 (51%), Positives = 477/690 (69%), Gaps = 12/690 (1%)

Query: 27  MTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKF 86
           M + AS  + PQA P+W+F+  D+   + ++I+++   Y  + Q + P++ N+I P +  
Sbjct: 1   MKDLASL-VPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYH 59

Query: 87  ENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQP 146
           E E   + N+L FL++VS D EIR+AS +++  LD+  I L+ ++D++  F  VW  AQ 
Sbjct: 60  EEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVW--AQY 117

Query: 147 KADS-LKKETF---KYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQ 202
           K D   KKE F   +Y+EK    +  SG+++   NR ++ E+K KI+   + FS NLGE+
Sbjct: 118 KDDEKFKKENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEE 177

Query: 203 KEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQ 262
            EYI FTKE+LEGVPD++L QFE  K  +GG +  +KVTFKYPDI PV++LAS+ +TR++
Sbjct: 178 VEYIAFTKEELEGVPDTVLNQFE--KIIEGGVEK-FKVTFKYPDIGPVLRLASNPETRRR 234

Query: 263 AFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKG 322
           A +AD+N+V  NE +L +TL+LR ELA LLG+  +A YNL DKMAK+  TV+ FLNDL  
Sbjct: 235 ASMADENRVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVE 294

Query: 323 KLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYF 382
           KL+P+GK +L++L+  K +D +      D  +Y WD  YY NK L E +NV+ + +++YF
Sbjct: 295 KLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYF 354

Query: 383 PLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFD 442
           P+E+ I GML IY TLF LKF+E  +   KSVWHEDVKQ AVWN+DD  +P+F GW+YFD
Sbjct: 355 PVESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFD 414

Query: 443 LHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHE 502
           LHPRDGKYGHAANFG+ S++   D  +SYPVT LV NFSK T  +P+LLK  E+ TFFHE
Sbjct: 415 LHPRDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHE 474

Query: 503 LGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPE 562
           LGHGIHDLVG N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGE+IP+
Sbjct: 475 LGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPK 534

Query: 563 SLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGG 622
           SL+D+      +N  L  L QL  GLFDM VHT +D +   +   WN L +EI LM    
Sbjct: 535 SLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKN 593

Query: 623 TLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARG 682
             S GYDSFGHIM+   +  YYGYLW++VFA DMY TKF  +P N   GV+YRD +LA G
Sbjct: 594 YTSTGYDSFGHIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATG 652

Query: 683 GLYDINDNLKEFLGREPSKDAFLKELGLQS 712
           GLYD+ DNL++FLGR+P+  AFL+ LGL++
Sbjct: 653 GLYDMTDNLRKFLGRDPNNKAFLRGLGLKA 682

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/683 (48%), Positives = 463/683 (67%), Gaps = 11/683 (1%)

Query: 35  IAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYE-LMSQVESPSVTNFIEPFMKFENELGPI 93
           + PQ PP W++T T++      +  KS+  YE + SQ +  ++ N+I P +  + E   +
Sbjct: 13  VPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLL 72

Query: 94  INRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK 153
            N+L FL++VS D ++R+AS+ +   LD+   ++S ++D++  F  +W   Q K D   K
Sbjct: 73  WNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW--TQYKDDEEFK 130

Query: 154 ----ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFT 209
               E +KY+EK    +  +   L  A  +++ ++ +KIS++++ FS NLGE+ EYITFT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 210 KEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQN 269
           +E+LEGV   +L QFE  +  +GG   L KVTFKYPDI PV++ A++ +TR++A++ADQN
Sbjct: 191 EEELEGVSPLVLDQFE--RIIEGGVKKL-KVTFKYPDIGPVLRTATNPETRRKAYVADQN 247

Query: 270 KVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGK 329
           +V  NE +L +TL LR  +A L GY  YA+YNL DKMAK+  TV+ FL DL  +L+P+G+
Sbjct: 248 RVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGE 307

Query: 330 KELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTIT 389
           K+ ++L+  K +D +      D   Y WD+ YY+NK L E + +D E +++YFP+E+ I 
Sbjct: 308 KDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIE 367

Query: 390 GMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGK 449
           GML  Y+TLF LKF+E  +P  K+VWHEDVKQ AVWN+DD   P F GWIYFDL+PRDGK
Sbjct: 368 GMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGK 427

Query: 450 YGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509
           Y HAANFG++S+F   D  +SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH 
Sbjct: 428 YSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHH 487

Query: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLI 569
           LV  NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGE+IP SL+D+  
Sbjct: 488 LVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWF 547

Query: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYD 629
            +  +   L+ L QL  GLFDM VHT ++   L +   WN +R+EISL+ +    S GY+
Sbjct: 548 NSSGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYN 606

Query: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDIND 689
           +FGHIM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGLYD+ND
Sbjct: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666

Query: 690 NLKEFLGREPSKDAFLKELGLQS 712
           NL++FLGREP+  AFL+ LG  +
Sbjct: 667 NLRKFLGREPNNRAFLRGLGFNA 689

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  372 bits (956), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 196/414 (47%), Positives = 262/414 (63%), Gaps = 7/414 (1%)

Query: 298 ADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIW 357
           A Y L  K AK+   V  FLNDL+ KL P      + L+ +K ++ +      D   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 358 DHRYYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHE 417
           D  YY+ K L +NF+VD E+ ++YFPLE TI  ML  Y TLF   F+E  EP  ++VWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 418 DVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALV 477
           D KQ +VW MDD  +P+F GW+YFDLHPRDGK+GH A F    + M  +  R YPVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 478 CNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQML 537
           CNFS  +K+KP+LLKH E+  FFHELGHG H L+   +         VP DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQML 286

Query: 538 EFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHT-C 596
           E+W W K+ +  LS H +TGERIPESL+D ++K+K  N A+  L Q+   L DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKHV 344

Query: 597 KDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDM 656
              E L +   WN L +++ L+ N    ++ Y SF HI+ + Y+AGYYGY W++VFA DM
Sbjct: 345 GSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGYAAGYYGYQWSKVFAADM 402

Query: 657 YHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710
           Y ++F K  L+   G  Y D ++ARGGLY++ DNL EFL REP+ +A+L++ GL
Sbjct: 403 YFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  202 bits (515), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 164/649 (25%), Positives = 300/649 (46%), Gaps = 67/649 (10%)

Query: 77  TNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQ 136
            NF+    +  + L  +I+   F++    ++   +A+ D   KL E    L+   ++   
Sbjct: 123 VNFVIELDRLSDTLCRVIDLCEFIRSAHPEEGFIEAAQDCHEKLFEFMNVLNTDRELCEL 182

Query: 137 FARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFS 196
                QD Q  +  L +E  K      +DFI SG+ +D   + +   + + IS+    + 
Sbjct: 183 LNETLQDEQVLS-KLSEEEKKVGYILLQDFIKSGIYMDSGKKDQFITLSQDISVIGQEYI 241

Query: 197 KNLGE-QKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDI-------F 248
            N+ +  + +I   + +L+       A  E   + + G+D    +T KY  I       F
Sbjct: 242 NNINQLARNHIKVKRSELDN------AGIEFDVACQLGKD----ITGKYYKIPTYGHLPF 291

Query: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAK 308
            ++K  +  + RK+ ++A  +   +    L + +K+R  LA  +G   YA Y +  KMAK
Sbjct: 292 LILKACTDPEIRKKIWVAMHDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMAK 351

Query: 309 DSRTVMDFLNDLKGKLIPLGKKELQVLQDM-----------KVKDVERSKKDEDPNYYIW 357
           + + V +FL  L   L P   KEL+ + D+            V ++  + +  D  YY  
Sbjct: 352 NPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNEKGEKPSDDVDEILTAVRPWDREYYTA 411

Query: 358 DHRYYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHE 417
            HR      LL+++ +D+     Y+PL   I G+  I+E+++ ++F E         W  
Sbjct: 412 IHRNKQKHLLLDDYALDV-----YYPLGNVIQGLSDIFESIYGIRF-EPAVAGKGETWSS 465

Query: 418 DVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMI------------- 464
           DV++L V +    +    IG IY DL  R GK  +AA+F +  S  I             
Sbjct: 466 DVRRLNVVS----EKEGLIGIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQLG 521

Query: 465 ---NDSKRSYPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESR 518
              + +K   P+ +L+CNF+    ++ +   LL  NEI T FHE+GH IH ++G+ +   
Sbjct: 522 TNVDGTKFQLPIISLLCNFNTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRLQN 581

Query: 519 FNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGAL 578
            +G      DFVE PS ++E +  +   L  +  HYKTG+R+P +L++  ++        
Sbjct: 582 VSGT-RCSTDFVELPSVLMEHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLKDC 640

Query: 579 FTLRQLHFGLFDMKVH---TCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIM 635
            T  Q    + D +++     ++++++ +   +++L +E+ ++ +    S     FGH+ 
Sbjct: 641 ETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYHELEKELEVLVDDE--SNWCAKFGHLF 698

Query: 636 SDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGL 684
              Y A YY YL+    A+ ++   F KDP +   G ++++ VL  GGL
Sbjct: 699 --GYGATYYCYLFDRAIASKVWKKLFEKDPYSRSGGEKFKNDVLKWGGL 745

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  202 bits (514), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 172/674 (25%), Positives = 312/674 (46%), Gaps = 51/674 (7%)

Query: 57  IIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDS 116
           +++ SN   +L +      + N+I    +  + L  +I+   F++    +K    A+ + 
Sbjct: 101 LLNASNILQQLKNDDTFNGLANYIIRLDQLSDTLCRVIDLCEFIRSCHPEKSFVQAAQEC 160

Query: 117 SMKL----DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLE 172
              +    + LN D++L   +     R   D +     L  E  K  +   +DF  SG++
Sbjct: 161 HEHMYAFMNTLNTDIALCDRL-----RTVLDNKEVLKRLTDEEIKVGKLLLEDFEKSGIQ 215

Query: 173 LDEANRLKIKEIKKKISMNSINFSKNLG-EQKEYITFTKEQLEGVPDSILAQFETTKSEK 231
           +    R +   + + IS+   +F  N    +K+YI    ++ +   D    +++ +K   
Sbjct: 216 MSPEIRDRFISLSQDISLAGQDFLNNTSYTEKDYIKIKCDEFDKACDYPALKYKLSKDLS 275

Query: 232 GGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASL 291
           G     YK+       +  +      + RK+ ++A  +   +    L   +K R ELA L
Sbjct: 276 G---KYYKIPTYGKIPYTALLKCKDEELRKKLWVAFHSCSNKQIERLTKIIKHRIELAKL 332

Query: 292 LGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVK----DVERSK 347
           L  ++Y++Y L  KMAK  + V +FLN L   ++P   KEL+ + + K       +E S+
Sbjct: 333 LSKSSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTKELEPISNKKCLSEGFSLETSE 392

Query: 348 KDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETK 407
           +    N   WD  YY+           +  I EYF L   I G+  ++ +++ ++F E  
Sbjct: 393 QSILNNIKPWDRDYYNPIQATSEGAYQM-LIMEYFTLGNIIHGLSNLFNSIYGIRF-EPG 450

Query: 408 EPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMI--- 464
           + ++   W +DV++L V + D+      IG IY DL  R+GK    +++ +  S  I   
Sbjct: 451 KIEDGETWSKDVRKLNVISEDEG----LIGVIYCDLFEREGKSESPSHYTICCSREIYSE 506

Query: 465 ------------NDSKRSY--PVTALVCNFSKSTKD---KPSLLKHNEIVTFFHELGHGI 507
                       N + +++  P+ +LVCNF  +      +   L+H+EI T FHE+GH +
Sbjct: 507 EHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAM 566

Query: 508 HDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDS 567
           H ++G+ +    +G   V  DFVE PS ++EF+  N   L+ +S HY +GE I   +++ 
Sbjct: 567 HSMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNK 625

Query: 568 LIKTKHVNGALFTLRQLHFGLFDMKVHT--CKDLENLSICHTWNQLRQEISLMPNGGTLS 625
            ++      A  T  Q    L D ++H      L+N+ +   ++ L +E+S++P+  T S
Sbjct: 626 YLENTKQFKACETYSQGKMALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLPD--TES 683

Query: 626 KGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLY 685
                FGH+    Y A YY YL+    AT ++ + F  DP + K G  +++ +L  GG  
Sbjct: 684 NWCGRFGHLY--GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGGSK 741

Query: 686 DINDNLKEFLGREP 699
           D    + + LG EP
Sbjct: 742 DPWKCVADVLG-EP 754

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  201 bits (512), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 176/667 (26%), Positives = 306/667 (45%), Gaps = 63/667 (9%)

Query: 62  NKFYELMSQV---ESP-SVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSS 117
           N+ YEL+  +   E+P  + N+I    +  + L  +I+   F++    D    DA+ D  
Sbjct: 110 NQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSHPDSHFVDAAQDCH 169

Query: 118 MKLDE----LNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLEL 173
            ++ E    LN D++L + +     R   +       L  E  K  +   +DF  SG+ +
Sbjct: 170 EEMFEFMNVLNTDVNLCNKL-----RTVLNTPEVVCKLSSEEVKVGKILLEDFEKSGIYM 224

Query: 174 DEANRLKIKEIKKKISMNSINFSKNLG-EQKEYITFTKEQLE--GVPDSILAQFETTKSE 230
           +   R +   + ++IS+   +F  N    +  YIT   E +   G+   IL+Q   +K  
Sbjct: 225 NPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGINQLILSQL--SKDI 282

Query: 231 KGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTL-KLRDELA 289
           KG     YK+       + V++       RK+ + A  +  P+ + + LD L +LR  LA
Sbjct: 283 KGKH---YKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIVRLDQLVRLRAVLA 338

Query: 290 SLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDV-----E 344
            L+G  +YA+Y L  KMAK    V DF++ L     P  K+EL  + D+K K +     E
Sbjct: 339 FLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFISDLKRKHMDLPPSE 398

Query: 345 RSKKDEDPNYYIWDHRYYDNKHLLENFN---VDLEKISEYFPLETTITGMLQIYETLFNL 401
            S  D       WD  +Y   + ++      +D ++IS YF L   + G+  ++  ++ +
Sbjct: 399 TSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVMQGLSDLFHQIYGI 458

Query: 402 KFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSS 461
           + +E    Q    W  +V++L V + ++      IG +Y DL  RDGK  + ++F +  S
Sbjct: 459 R-LEPVIAQKGETWSPEVRRLNVVSDEEG----VIGVVYCDLFERDGKTSNPSHFTVCCS 513

Query: 462 FMI----ND------------SKRSYPVTALVCNFSKST---KDKPSLLKHNEIVTFFHE 502
             I    ND            +K   P+ +LVCNF+ S         LL  +EI T FHE
Sbjct: 514 RQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLCLLHISEIETLFHE 573

Query: 503 LGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPE 562
           +GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +  H  TGE +PE
Sbjct: 574 MGHAMHSMLGRTRLQNLSGT-RCATDFVELPSILMEHFARDTRVLRQIGKHCNTGEPVPE 632

Query: 563 SLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLENLSICHTWNQLRQEISLMP 619
           SL+ + ++         T  Q    + D ++H       ++ L +   +  L +E+ ++ 
Sbjct: 633 SLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVALYQNLERELRVLV 692

Query: 620 NGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVL 679
           +  +   G   FGH+    Y A YY YL+    A+ ++ + F +DP +   G ++++ VL
Sbjct: 693 DDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPFSRAGGQRFKEYVL 748

Query: 680 ARGGLYD 686
             GG  D
Sbjct: 749 KWGGAKD 755

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  201 bits (511), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 181/668 (27%), Positives = 307/668 (45%), Gaps = 62/668 (9%)

Query: 58  IDKSNKFYELMSQVESP-SVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDS 116
           + ++N+  E M    SP    N+I    +  + L  +I+   F++    D     A+ D 
Sbjct: 92  LTQANELVETMRHDRSPKGYANYIANLDRLSDILCRVIDLAEFIRASHPDPHFVQAAQDC 151

Query: 117 SMKLDE----LNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLE 172
             ++ E    LN D++L  DI      V  D    ++ L  E  K  +   +DF  SG+ 
Sbjct: 152 HEEMFEIMNVLNTDVAL-CDIL---KHVLTDPTILSE-LSPEEIKVGKILLEDFEKSGIH 206

Query: 173 LDEANRLKIKEIKKKISMNSINFSKNLG-EQKEYITFTKEQL--EGVPDSILAQFETTKS 229
           ++   R +   + ++IS+   +F  N    +  YI    E+L   G+   +L Q   +K 
Sbjct: 207 MNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGINKIVLNQL--SKD 264

Query: 230 EKGGEDTLYKV-TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDEL 288
            KG     YK+ TF Y   + +++       R + + A  +   +  A L   +KLR  L
Sbjct: 265 IKGRH---YKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIARLDQLIKLRSVL 320

Query: 289 ASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKK 348
           A+++G  ++A Y L  KMAK    V  F+  L     P   +EL+ + D+K K V  +K 
Sbjct: 321 ANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIADLKAKHVPGNKP 380

Query: 349 DEDPNYYI-----WDHRYYDNKHLLEN---FNVDLEKISEYFPLETTITGMLQIYETLFN 400
            E  +  +     WD  +Y + H L+    FN   E+IS YF L   I G+  +++ ++ 
Sbjct: 381 AESMHEILEMVKPWDRDFYGSVHALQQRRPFNN--EQISSYFSLGVVIQGLSNLFKQIYG 438

Query: 401 LKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSS 460
           + ++E   P+    W  +V+++ V +  +      IG +Y DL  R GK  + A+F +  
Sbjct: 439 I-YLEPVVPKTGETWSPEVRRINVVSEKEG----VIGVVYCDLFERQGKTANPAHFTVCC 493

Query: 461 SFMINDSKR----------------SYPVTALVCNFSKST---KDKPSLLKHNEIVTFFH 501
           S  I D +                   PV +LVCNFS +T   +    LL+ +EI T FH
Sbjct: 494 SRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLLQLSEIETLFH 553

Query: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIP 561
           E+GH +H ++G+ K    +G      DFVE PS ++E +  +   L  ++SHY TGE IP
Sbjct: 554 EMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMASHYSTGESIP 612

Query: 562 ESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLENLSICHTWNQLRQEISLM 618
           E L+ S               Q    + D ++H     K+++ L I   ++ L +++ ++
Sbjct: 613 EQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLYHNLERQLEVL 672

Query: 619 PNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIV 678
            +  +   G   FGH+    Y A YY YL+    A+ ++   FA DP   ++G ++++ V
Sbjct: 673 SDDKSNWCG--RFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSGEKFKNSV 728

Query: 679 LARGGLYD 686
           L  GG  D
Sbjct: 729 LKWGGSRD 736

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  191 bits (486), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 175/650 (26%), Positives = 298/650 (45%), Gaps = 69/650 (10%)

Query: 79  FIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDIF 134
           FI    +  + L  +I+   F++    D+    A+ D   ++ E    LN D+ L  DI 
Sbjct: 120 FIMNLDRLSDTLCRVIDLCEFIRSTHPDEAFVKAAQDCHEQMFEFMNVLNTDVVL-CDIL 178

Query: 135 LQFARVWQDAQPKADS-LKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSI 193
                V  D  P  +S L  E  K  +   +DF  SG+ +D   R +   + ++IS+   
Sbjct: 179 ---KHVLND--PNINSKLTPEEIKVGKLLLEDFEKSGIYMDPNIRKQFISLSQEISLTGQ 233

Query: 194 NFSKNLGEQKE---YITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPV 250
           +F  N+   K     I  ++    GV   +L Q     + K      YK+         +
Sbjct: 234 DFINNIDLIKSNHVKIKCSELNKSGVNSLLLKQLPKDITGK-----YYKIPTSGYIPISL 288

Query: 251 MKLASSAQTRKQAFLADQNKVPENEAILLDTL-KLRDELASLLGYNTYADYNLYDKMAKD 309
           ++    A  R + + A  +  P ++   L  L KLR  LA LL   ++A Y L  KMAK 
Sbjct: 289 IRSCPDATIRAKVW-ASLHSCPNDQIRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKT 347

Query: 310 SRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYY----IWDHRYYDNK 365
            + V DF+  L   + P   +EL+ + D+K K++     D           WD  YY   
Sbjct: 348 PQNVRDFIKTLMDYMRPKAAQELKFMADLKCKELNIPTSDSTTAILDLISPWDREYYTTI 407

Query: 366 H-------LLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHED 418
           H       L EN  +++     YF +   + G+  I++ ++ ++ +E   P+    W  +
Sbjct: 408 HSKAKDVNLYENHPINM-----YFTMGNIMKGLSHIFQRIYGIR-LEAVVPEEGETWSPE 461

Query: 419 VKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMI----ND-------- 466
           V++L V +    ++   IG +Y DL  R GK  + A+F +  S  I    ND        
Sbjct: 462 VRRLNVIS----ETEGLIGVVYCDLFERAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGT 517

Query: 467 ----SKRSYPVTALVCNFSK--STKDKP-SLLKHNEIVTFFHELGHGIHDLVGQNKESRF 519
               +    PV +LVCNFS   ++ DK   LL+ NEI T FHE+GH +H ++G+++    
Sbjct: 518 NPDGTAFQLPVISLVCNFSSTLTSNDKMICLLQLNEIETLFHEMGHAMHSMLGRSRLQNV 577

Query: 520 NGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALF 579
           +G      DFVE PS ++E +  +K  L  +  HY+T ER+ E +I++ +K         
Sbjct: 578 SGTRCAT-DFVELPSILMEHFARDKRVLHEIGFHYETNERVSEYVIEAHLKKMKFLQDCE 636

Query: 580 TLRQLHFGLFDMKVHT---CKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMS 636
           T  Q    + D ++++    KDL+++ +   +  L +++ ++ +  +   G   FGH+  
Sbjct: 637 TFSQGKMAMLDQELYSENIIKDLDHVDVVKIYQTLEEDLKVLVDNKSNWCG--KFGHLF- 693

Query: 637 DSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYD 686
             Y A YY YL+    A+ ++   FAKDP + + G ++++ VL  GGL D
Sbjct: 694 -GYGASYYSYLFDRAIASKVWDQLFAKDPFSREGGEKFKNCVLKWGGLRD 742

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  191 bits (485), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 177/645 (27%), Positives = 295/645 (45%), Gaps = 57/645 (8%)

Query: 78  NFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDI 133
           ++I    +  + L  +I+   F++    + E   A+ D   ++ E    LN D+SL +  
Sbjct: 118 SYIMNLDRLSDTLCRVIDLCEFIRSTHPEDEFVKAAQDCHEQMFEFMNVLNTDVSLCN-- 175

Query: 134 FLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSI 193
            L+      +  PK   L +E  K  +    DF  SG+ ++   R K  ++ ++IS+   
Sbjct: 176 MLKSVLNNPEIAPK---LSEEELKVGKILLDDFEKSGIYMNPGVREKFIQLSQEISLVGQ 232

Query: 194 NFSKNL---GEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV-TFKYPDIFP 249
            F  ++   G     I         V   +L Q    K  KG     YKV TF Y   F 
Sbjct: 233 EFINHIDYPGSNSVKIPCKDLDSSKVSTFLLKQL--NKDVKGQN---YKVPTFGYA-AFA 286

Query: 250 VMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKD 309
           ++K       RK+ + A  +   +    L   +KLR  LA+L+   +YA+Y L  KMAK+
Sbjct: 287 LLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHKGSYAEYQLEGKMAKN 346

Query: 310 SRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVER---SKKDEDPNYYI-WDHRYYDNK 365
            + V DF+  L    I     EL+ + D+K KD+++   +  DE       WD  YY  K
Sbjct: 347 PKDVQDFILTLMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEILKLVRPWDRDYYTGK 406

Query: 366 HL-LENFNV-DLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLA 423
           ++ L   NV   ++IS YF L   I G+  +++ ++ ++ +E         W  DV++L 
Sbjct: 407 YIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAIADEGETWSPDVRRLN 465

Query: 424 VWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMI----------------NDS 467
           V + ++      IG IY DL  R+GK  + A+F +  S  I                N S
Sbjct: 466 VISEEEG----IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPHETDFSTIQVGENPNGS 521

Query: 468 KRSYPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGS 524
               PV +LVCNFS    ++K     L+ +E+ T FHE+GH +H ++G+      +G   
Sbjct: 522 YFQLPVISLVCNFSPVPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRC 581

Query: 525 VPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQL 584
              DFVE PS ++E +  +   L  +  HY+TGE I + ++   +KT +      T  Q 
Sbjct: 582 AT-DFVELPSILMEHFAKDIRVLTRIGKHYETGETIQKGMLQCFMKTTNFLQNCETYSQA 640

Query: 585 HFGLFDMKVHTCK---DLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSA 641
              + D   H  K   D++N ++   +  L + + ++ +  +   G   FGH+    Y A
Sbjct: 641 KMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHLKVLVDDQSNWCG--RFGHLF--GYGA 696

Query: 642 GYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYD 686
            YY YL+    A+ +++T F  DP +  NG +++  +L  GGL D
Sbjct: 697 TYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFKKHLLKWGGLKD 741

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  190 bits (483), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 173/661 (26%), Positives = 299/661 (45%), Gaps = 61/661 (9%)

Query: 66  ELMSQVESPSVTN----FIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLD 121
           EL+ ++ + S  N    +I    +  + L  +I+   F++    D     A+ D   ++ 
Sbjct: 105 ELLERMRNDSTENGKLTYIMNLDRLSDTLCRVIDLCEFIRSTHPDDAFVKAAQDCHEQMF 164

Query: 122 E----LNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEAN 177
           E    LN D+SL         +   ++   +  L +E  K  +    DF  SG+ ++   
Sbjct: 165 EFMNVLNTDVSL-----CNMLKTVLNSPKISSKLSEEELKVGKILLDDFEKSGIYMNPDV 219

Query: 178 RLKIKEIKKKISMNS---INFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGE 234
           R K  ++ ++IS+     IN +   G     I+  +     V   +L Q    K  KG  
Sbjct: 220 REKFIQLSQEISLVGQEFINHTDYPGSNSVKISCRELDNSNVSAFLLKQL--NKDVKGQN 277

Query: 235 DTLYKV-TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLG 293
              YKV TF Y   + ++K     Q RK+ + A  +   +    L   +KLR  LA L+ 
Sbjct: 278 ---YKVPTFGYA-AYALLKSCEKEQVRKKIWTALHSCSDKQIKRLNHLIKLRANLADLMH 333

Query: 294 YNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVER---SKKDE 350
             +YA+Y L  KMAK+ + V DF+  L    I     EL+ + ++K KD+++   +K DE
Sbjct: 334 KGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTATELKFIAELKAKDLKKPLATKTDE 393

Query: 351 DPNYYI-WDHRYYDNKHLLENFN--VDLEKISEYFPLETTITGMLQIYETLFNLKFIETK 407
                  WD  YY  K+L  N +     ++IS YF L   I G+  +++ ++ +K +E  
Sbjct: 394 ILKLVRPWDRDYYTGKYLQLNPSNAPSAKEISSYFTLGNVIQGLSDLFQHIYGIK-LEPA 452

Query: 408 EPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDS 467
                  W  DV++L V + ++      IG IY DL  R GK  + A+F +  S  I  +
Sbjct: 453 IADEGETWSPDVRRLNVISEEEG----IIGIIYCDLFERSGKTSNPAHFTVCCSRQIYPN 508

Query: 468 KRSY----------------PVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIH 508
           +  +                PV +LVCNF+    ++K     L+ +E+ T FHE+GH +H
Sbjct: 509 ETDFSTIQLGENADGSFFQLPVISLVCNFAPIPIASKKSLCFLQLSEVETLFHEMGHAMH 568

Query: 509 DLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSL 568
            ++G+      +G      DFVE PS ++E +  +   L  +  HY+TGE +   ++ S 
Sbjct: 569 SMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTRIGKHYETGETVEPDMLQSF 627

Query: 569 IKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLENLSICHTWNQLRQEISLMPNGGTLS 625
           ++T +      T  Q    + D   H      +++N  +   +  L + + ++ +  +  
Sbjct: 628 MRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNIDNYDVVKNYQALERRLKVLVDDQSNW 687

Query: 626 KGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLY 685
            G   FGH+    Y A YY YL+    A+ +++  F  DP + KNG +++  +L  GGL 
Sbjct: 688 CG--RFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLK 743

Query: 686 D 686
           D
Sbjct: 744 D 744

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 169/638 (26%), Positives = 293/638 (45%), Gaps = 57/638 (8%)

Query: 85  KFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDIFLQFARV 140
           +  + L  +I+   F++    D +   A+ D   ++ E    LN D+SL         + 
Sbjct: 125 RLSDTLCRVIDLCEFIRSTHPDDKFVKAAQDCHEQMFEFMNVLNTDVSL-----CNILKS 179

Query: 141 WQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNS---INFSK 197
             ++   +  L  E  K  +    DF  SG+ ++   R K  E+ ++IS+     IN + 
Sbjct: 180 VLNSPEVSSKLSDEELKVGKILLDDFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTD 239

Query: 198 NLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV-TFKYPDIFPVMKLASS 256
             G     I         V   +L Q    K  KG     YK+ TF Y   + ++K    
Sbjct: 240 YPGSNSVKIPCKDLDNGNVSAFLLKQL--NKDVKGQN---YKIPTFGYA-AYALLKSCEK 293

Query: 257 AQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDF 316
            + RK+ + A  +   +    L   +KLR  LA+L+   +YA+Y L  KMAK+ + V DF
Sbjct: 294 EEVRKKLWTALHSCSDKQIKRLSHLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDF 353

Query: 317 LNDLKGKLIPLGKKELQVLQDMKVKDVER--SKKDEDPNYYI--WDHRYYDNKHLLENFN 372
           +  L    I     EL+ + ++K KD+++  + K +D    +  WD  YY  K+L  N +
Sbjct: 354 ILTLMNGTIDKTANELKFIAELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYLQLNPS 413

Query: 373 --VDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDP 430
              + ++IS YF L   I G+  +++ ++ ++ +E +       W  DV++L V + ++ 
Sbjct: 414 DAPNAKEISYYFTLGNVIEGLSDLFQHIYGIR-LEPEIADEGETWSPDVRRLNVISEEEG 472

Query: 431 KSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSY----------------PVT 474
                IG IY DL  R+GK  + A+F +  S  I  ++  +                PV 
Sbjct: 473 ----IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVI 528

Query: 475 ALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVE 531
           +LVCNF+    ++K     L+ +E+ T FHE+GH +H ++G+      +G      DFVE
Sbjct: 529 SLVCNFAPIPIASKKTLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVE 587

Query: 532 APSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDM 591
            PS ++E +  +   L  +S HY+TGE I   ++ S ++T +      T  Q    + D 
Sbjct: 588 LPSILMEHFAKDIRILTKISKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQ 647

Query: 592 KVH---TCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLW 648
             H      D++N  I   +  L + + ++ +  +   G   FGH+    Y A YY YL+
Sbjct: 648 SFHDEEIISDIDNFDIVKNYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLF 703

Query: 649 AEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYD 686
               A+ +++  F  DP + KNG +++  +L  GGL D
Sbjct: 704 DRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 741

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 171/658 (25%), Positives = 299/658 (45%), Gaps = 45/658 (6%)

Query: 60  KSNKFYELMSQVESP-SVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSM 118
           K+N+  ++M    +   +  +I    +  + L  +I+   F++ V  DKE   A+     
Sbjct: 103 KANELVKIMKNDNTKQGLLKYIVRLDQLSDTLCRVIDLCEFIRSVHPDKEFLSAAQQCHE 162

Query: 119 KLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANR 178
           ++ E    L+   ++  +   +  D +  +  L +E  K      +DF  SG+ ++   R
Sbjct: 163 EMFEFMNTLNTDVELCDKLKTLLHDNEILS-KLSEEEIKVGRILLEDFEKSGIYMNPRIR 221

Query: 179 LKIKEIKKKISMNSINFSKNLGEQK-EYITFTKEQLEGVPDSILAQFETTKSEKGGEDTL 237
            +  E+ ++IS+   +F  N  + K  YI     +LE      L +      +K      
Sbjct: 222 EQFIELSQEISLIGQDFINNANQPKTNYIKVNASKLESAG---LNRLLLNSLKKDAIREN 278

Query: 238 YKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTY 297
           YK+    P  + V+K   + + R   + A  +   E    L   +KLR  LA+L+G  ++
Sbjct: 279 YKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQILRLSHLVKLRAMLANLMGAESF 338

Query: 298 ADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYI- 356
           + Y L  K+AK  + V +F+  L   + P  +KEL+ + D+K +D  +    E       
Sbjct: 339 SQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIADLKREDQGKINCGEMDGVLST 398

Query: 357 ---WDHRYYDNKHLLENFNVD---LEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQ 410
              WD  YY + +       +    E +S YF L     G+  +   ++ +K +E   P 
Sbjct: 399 VRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFEGLSDLLTQIYGIK-LEPAIPV 457

Query: 411 NKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSS---------- 460
           +   W  DV+++ V + ++      IG IYFDL  R GK  + A+F +            
Sbjct: 458 SGETWFNDVRKINVISEEEG----IIGIIYFDLFERYGKTSNPAHFTVCCSREMYPEENA 513

Query: 461 -SFMINDSKR-----SYPVTALVCNFSKST--KDKP-SLLKHNEIVTFFHELGHGIHDLV 511
            S +   SK+       P+ +LVCNFS+ T   DK   LL  +EI T FHE+GH IH ++
Sbjct: 514 DSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICLLTLSEIETLFHEMGHAIHSML 573

Query: 512 GQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKT 571
           G+      +G      DFVE PS ++E +  +   L  +S HY+TGE+I E  +   +K 
Sbjct: 574 GRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKMSCHYETGEKIAEKKLQFHLKE 632

Query: 572 KHVNGALFTLRQLHFGLFDMKVHTCK---DLENLSICHTWNQLRQEISLMPNGGTLSKGY 628
                +  T  Q    + D ++H+ K   +L+NL++   +  L + + ++ +  +   G 
Sbjct: 633 GEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIYQNLERRLQVLVDDRSNWCG- 691

Query: 629 DSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYD 686
             FGH+    Y A YY YL+    A  +++  FA DP N  NG ++++ +L  GG  D
Sbjct: 692 -KFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFNKTNGEKFKESLLKWGGSKD 746

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  189 bits (481), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 153/560 (27%), Positives = 266/560 (47%), Gaps = 47/560 (8%)

Query: 164 KDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYI--TFTKEQLEGVPDSIL 221
           +DF  SG+ ++   R +  E+ + IS+    F  N     EY+  +F + + + +  S +
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITN----TEYVGTSFVEIETDVLEASGV 266

Query: 222 AQFETTKSEKGGEDTLYKV-TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLD 280
           +Q    +  K      YK+ T+ Y   + +++   S   RK+ + A     PE +   L 
Sbjct: 267 SQMVLQQLSKDLSGKFYKIPTYGYLP-YSIIRTCPSEYIRKKVWTA-MYSCPEKQIKRLK 324

Query: 281 TL-KLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMK 339
            L +LR +LA ++G   YA Y L  KMAK  + V +F+N L     PL  +EL+ L DMK
Sbjct: 325 KLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLADMK 384

Query: 340 VKDVERSKKDEDPNYYIWDHRYYDNKHLLEN----FNVDLEKISEYFPLETTITGMLQIY 395
             +  +   +   +   WD  Y+ +  LL        +  + ++ YF L   I G+  ++
Sbjct: 385 HDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGLSDLF 444

Query: 396 ETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAAN 455
           ++++ ++ +E    +    W  +V+++ V +    ++   IG IY DL  R GK  + A+
Sbjct: 445 QSIYGIR-LEPVVAKTGETWDPEVRKIQVIS----EANGVIGVIYCDLFERQGKTPNPAH 499

Query: 456 FGLSSSFMI----------------NDSKRSYPVTALVCNFSKSTKDKPS--LLKHNEIV 497
           F +  S  I                + SK   PV +LVCNFS +  D  S  LL+ +E+ 
Sbjct: 500 FTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQLSEVE 559

Query: 498 TFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTG 557
           T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +SSHY TG
Sbjct: 560 TLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSHYATG 618

Query: 558 ERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISL 617
           ER+P+ ++ +  +         T  Q+   + D ++H+  D  +  I   ++ L +E+ +
Sbjct: 619 ERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEKELQV 677

Query: 618 MPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDI 677
           + +  +   G   FGH+    Y A YY YL     A  +++  F  DP +   G ++++ 
Sbjct: 678 LVDDRSNWCG--RFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEKFKNS 733

Query: 678 VLARGGLYD----INDNLKE 693
           VL  GG  D    I D L E
Sbjct: 734 VLKWGGSRDPWRCIADALDE 753

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  186 bits (471), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 168/663 (25%), Positives = 304/663 (45%), Gaps = 51/663 (7%)

Query: 58  IDKSNKFYELMSQVESP-SVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDS 116
           ++KS K  + +    +P  +  +++      + L  +I+   F++    D +  +A+ D 
Sbjct: 111 LEKSQKIVDKLRSDRTPEGLRLYVQNLDLLSDTLCRVIDLCEFIRSSHPDYKFVEAAQDC 170

Query: 117 SMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEA 176
             ++ E    L+   ++      V ++ +  A  L +E  +      +DF  SG+ +   
Sbjct: 171 YEEMFEFMNMLNTDVNLCFTLKHVLENKEI-ASKLSEEELRVGRILLEDFEKSGIYMKPE 229

Query: 177 NRLKIKEIKKKISMNSINFSKNLGEQKEY-ITFTKEQLE--GVPDSILAQFETTKSEKGG 233
            R +   + + IS+    F  N    K+  +  +  QL+  G+   +L+Q E   + K  
Sbjct: 230 VREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPELLSQIEKDIAGKN- 288

Query: 234 EDTLYKV-TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLL 292
               YK+ T+ Y   F ++K   S + R++ ++A  N   E    L D +KLR  L+ LL
Sbjct: 289 ----YKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLVKLRAVLSQLL 343

Query: 293 GYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQD----MKVKDVERSKK 348
           G  +YA+Y L  KMAK+ + V++F+  L     P+  KEL  + +    +K      S  
Sbjct: 344 GKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAEKKLTIKSNGSNLSVC 403

Query: 349 DEDPNYYIWDHRYYDNKHLLENFNVDL---EKISEYFPLETTITGMLQIYETLFNLKFIE 405
           D       WD  YY      +    +L   E++ +YF L   + G+  +++ ++ +K +E
Sbjct: 404 DILKTVRPWDRDYYSAIEREQTSAKNLYGSEEVLKYFTLGNVMQGLSNLFQKIYGIK-LE 462

Query: 406 TKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMIN 465
              P+    W  +V+++ V + D+      IG IY DL  R GK  +AA+F +  S  I+
Sbjct: 463 LDVPKIGETWSPEVRKINVISEDEG----LIGIIYCDLFERSGKTSNAAHFTICCSRDIS 518

Query: 466 -------------DSKRS---YPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHG 506
                        DSK +    P+ +LVCNFSK   S  D    L   E+ T FHE+GH 
Sbjct: 519 PYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVCFLHLPEVETLFHEMGHA 578

Query: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLID 566
           +H ++G+ K    +G      DFVE PS ++E++  +   L ++  HY T E +   +++
Sbjct: 579 MHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLETIGKHYLTKETVKREMLE 637

Query: 567 SLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLENLSICHTWNQLRQEISLMPNGGT 623
             ++         T  Q    + D  +H       L++L +   +  L +++ ++ +  +
Sbjct: 638 PHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVVKLYQDLERQLGVLVDDKS 697

Query: 624 LSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGG 683
              G   FGH+    YSA YY YL+    A+ ++   F ++P +  +G +YR+ VL  GG
Sbjct: 698 NWCG--KFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNPFSRASGDKYRNSVLQWGG 753

Query: 684 LYD 686
             D
Sbjct: 754 SRD 756

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  183 bits (465), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 163/661 (24%), Positives = 299/661 (45%), Gaps = 53/661 (8%)

Query: 58  IDKSNKFYELM-SQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDS 116
           + K++K  E++ + V      ++I    +  + L  +I+   FL+    D+   +A+   
Sbjct: 87  LHKAHKLAEILRNSVSKEEKVHYIMNLDQLSDTLCRVIDLCEFLRSAHPDQSYVEAAQMC 146

Query: 117 SMKLDE----LNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLE 172
             ++ E    LN D+ L +    +   V +D +     L +E  K  E    DF  SG+ 
Sbjct: 147 HEEMFEFMNVLNTDVVLCN----KLKEVLEDPEI-LKVLSEEERKVGEILLDDFEKSGIY 201

Query: 173 LDEANRLKIKEIKKKISMNSINFSKNLG-EQKEYITFTKEQLEGVPDSILAQFETTKSEK 231
           +    R +  E+ ++IS+    F  N     KE+I   +++++    S ++   T +  +
Sbjct: 202 MKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIKVKRDEMD---KSGISPLLTARLNR 258

Query: 232 GGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTL-KLRDELAS 290
                 YK+         ++K       RK+ + A  N  P+ +   L+ L +LR  L++
Sbjct: 259 DLTGKYYKIPTYGQIPLQILKSCPDEDIRKEVWAALHN-CPKAQIQRLNQLVRLRVILSN 317

Query: 291 LLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDE 350
           LLG  +Y+DY L +KMA     V  F+  L     PL  +EL+ +   K+   +     +
Sbjct: 318 LLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAARELEFIARDKLNAPDSRHMSD 377

Query: 351 DPNYYI---WDHRYYDNKHLLEN--FNVDLEKISEYFPLETTITGMLQIYETLFNLKFIE 405
           +    I   WD  Y+ +K+  +N    +  E++  YF L   I G+ ++++ ++ +  ++
Sbjct: 378 NEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYYFSLGNVINGLSELFKRIYGIT-LQ 436

Query: 406 TKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMIN 465
               +N   W  DV++L V + ++      +G IY DL  R GK  + A+F +  S  + 
Sbjct: 437 PSRTENGETWSPDVRRLDVISEEEG----LVGVIYCDLFERVGKISNPAHFTVCCSRQVY 492

Query: 466 DSKRSY----------------PVTALVCNFSKST---KDKPSLLKHNEIVTFFHELGHG 506
             +  +                PV +LVCNFS       ++   L  NEI T FHE+GH 
Sbjct: 493 PDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHA 552

Query: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLID 566
           +H ++G+ +    +G      DFVE PS ++E +  +   L ++ SHY+T E  PE+L++
Sbjct: 553 MHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDIRVLRTIGSHYETSEPAPEALLN 611

Query: 567 SLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLENLSICHTWNQLRQEISLMPNGGT 623
             +          T  Q    + D K+H   +  D+E +     + +L   + ++ +  +
Sbjct: 612 DYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQVLADDES 671

Query: 624 LSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGG 683
              G   FGH+    Y A YY YL+    A+ ++ + F  DP N   G ++++ VL  GG
Sbjct: 672 NWCG--RFGHLF--GYGATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGG 727

Query: 684 L 684
           L
Sbjct: 728 L 728

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  183 bits (464), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 169/651 (25%), Positives = 294/651 (45%), Gaps = 58/651 (8%)

Query: 72  ESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDL 127
           ES  +T +I    +  + L  +I+   F++    D     A+ D   ++ E    LN D+
Sbjct: 113 ESGKLT-YIMNLDRLSDTLCRVIDLCEFIRSTHPDDAFVRAAQDCHEQMFEFMNVLNTDV 171

Query: 128 SLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKK 187
           SL         +   +    +  L  E  K  +    DF  SG+ ++   R K  ++ ++
Sbjct: 172 SL-----CNILKSVLNNPEVSSKLSAEELKVGKILLDDFEKSGIYMNPDVREKFIQLSQE 226

Query: 188 ISMNS---INFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV-TFK 243
           IS+     IN +   G         K   + + +S ++ F   +  K  +   YKV TF 
Sbjct: 227 ISLVGQEFINHTDYPGSNS-----VKIPCKDLDNSKVSTFLLKQLNKDVKGQNYKVPTFG 281

Query: 244 YPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLY 303
           Y   + ++K   +   RK+ + A  +   +    L   +KLR  LA+L+   +YA+Y L 
Sbjct: 282 YA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIKLRAILANLMHKTSYAEYQLE 340

Query: 304 DKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVER---SKKDEDPNYYI-WDH 359
            KMAK+ + V DF+  L    I     EL+ + ++K KD+++   +  DE       WD 
Sbjct: 341 GKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDLKKPLTTNTDEILKLVRPWDR 400

Query: 360 RYYDNKHLLEN--FNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHE 417
            YY  K+   N   + + ++IS YF L   I G+  +++ ++ ++ +E         W  
Sbjct: 401 DYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAITDEGETWSP 459

Query: 418 DVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSY------ 471
           DV++L V + ++      IG IY DL  R+GK  + A+F +  S  I  S+  +      
Sbjct: 460 DVRRLNVISEEEG----IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPSETDFSTIQVG 515

Query: 472 ----------PVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESR 518
                     PV +LVCNFS    ++K     L+ +E+ T FHE+GH +H ++G+     
Sbjct: 516 ENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQN 575

Query: 519 FNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGAL 578
            +G      DFVE PS ++E +  +   L  +  HY TGE I   ++   +K+ +     
Sbjct: 576 ISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGETIQADMLQRFMKSTNFLQNC 634

Query: 579 FTLRQLHFGLFDMKVHTCK---DLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIM 635
            T  Q    + D   H  K   D++N  +   +  L + + ++ +  +   G   FGH+ 
Sbjct: 635 ETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRLKVLVDDQSNWCG--RFGHLF 692

Query: 636 SDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYD 686
              Y A YY YL+    A+ +++  F  DP + KNG +++  +L  GGL D
Sbjct: 693 --GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 741

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  183 bits (464), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 159/646 (24%), Positives = 295/646 (45%), Gaps = 57/646 (8%)

Query: 75  SVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLR 130
            +T ++    +  + L  +I+   F++    D    +A+     ++ E    LN D+ L 
Sbjct: 128 GLTAYVMRLDQLSDTLCRVIDLCEFIRSSHPDSSFIEAAQACHEEMFEFMNILNTDVELC 187

Query: 131 HDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISM 190
             +     +V  D + K   L  E     +   +DF  SG+ ++   R +   + ++IS+
Sbjct: 188 DTL----RQVLTDPEIKG-KLSNEEITVGKILLEDFEKSGIYMNPEVRDQFIALSQEISL 242

Query: 191 NSINFSKNLGEQKEYI--TFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIF 248
               F  N     +Y+   + K + E V +S + +   ++  K      YK+       +
Sbjct: 243 VGQEFINN----TDYVRSNYIKIKCEEVDNSGINKLLISQLPKDVRGKYYKIPTHGYIAY 298

Query: 249 PVMKLASSAQTRKQAFLADQNKVPENEAILLDTL-KLRDELASLLGYNTYADYNLYDKMA 307
            +++     + R   + A  ++  + +   LD L +LR  LA L+G  ++A Y L  KMA
Sbjct: 299 SILRSCPDEEIRMNLWTA-MHRCSDKQINRLDQLLRLRAILAKLMGKESFAQYQLEGKMA 357

Query: 308 KDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVER------SKKDEDPNYYIWDHRY 361
           +  + V DF+  L   + P   +EL+ + ++K K  +R      S++D       WD  Y
Sbjct: 358 QTPQQVRDFIGTLVNYMRPKTIEELKFIYELKSKQEKREIQPSPSEQDIASMVRPWDREY 417

Query: 362 YDNKHLLENFN--VDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDV 419
           Y + + L+     +D E+IS YF L   I G+  ++E+++ ++ +E   P+    +  +V
Sbjct: 418 YTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLSDLFESIYGIR-LEPVVPKTGETFSPEV 476

Query: 420 KQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSY-------- 471
           ++L V    +      IG +Y DL  R GK  + ++F +  S  I   +  +        
Sbjct: 477 RRLNVVCEQEG----VIGVVYCDLFERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFN 532

Query: 472 --------PVTALVCNFSKSTKDKP---SLLKHNEIVTFFHELGHGIHDLVGQNKESRFN 520
                   PV ALVCNFS ST  +     LL+ NE+ T FHE+GH +H ++G+ +    +
Sbjct: 533 SEGLMFQLPVIALVCNFSSSTDSEGKSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNIS 592

Query: 521 GPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFT 580
           G      DFVE PS ++E +  +   L  +  H++TG  I E L+ + ++         T
Sbjct: 593 GT-RCATDFVELPSILMEHFARDVRVLERIGKHHRTGAPISEKLLLNYLEETKFMQHCET 651

Query: 581 LRQLHFGLFDMKVH---TCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSD 637
             Q    + D  +H     KD ++  +   + QL +++ ++ +  +   G   FGH+   
Sbjct: 652 FSQAKMAMLDQDLHGEKVIKDFDHFDVTAAYQQLERDMKVLVDDKSNWCG--KFGHLF-- 707

Query: 638 SYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGG 683
            Y A YY YL+    A+ ++ + F+ DP +  NG ++++ VL  GG
Sbjct: 708 GYGATYYSYLFDRAIASKVWDSLFSSDPYSRVNGEKFKECVLKWGG 753

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  182 bits (463), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 168/647 (25%), Positives = 299/647 (46%), Gaps = 62/647 (9%)

Query: 78  NFIEPFMKFENELGPIINRLTFLQHVSSDKE-IRDASVDSSMKLDELNIDLSLRHDIFLQ 136
           N+I    +  + L  +I+   F++    D + +R A +      + +N+ L+    +   
Sbjct: 119 NYIRNLDRLSDMLCRVIDLCEFIRASHPDSQFVRAAQLCHEEMFEFMNV-LNTDSTLCEI 177

Query: 137 FARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFS 196
             RV  D    A  L +E  K  +   +DF  SG+++      +   + ++IS+    F 
Sbjct: 178 LKRVLSD-DLIASKLSEEELKVGKILLEDFEKSGIDMAPEVGEQFINLSQQISIVGQEFI 236

Query: 197 KNLG-EQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV-TFKYPDIFPVMKLA 254
            N    + EY+  +  +LE    S L     ++  KG     YKV T+ Y   F +++  
Sbjct: 237 SNTDFPKSEYVKVSCNELETSGISPLLLNHLSRDTKGQN---YKVPTYGYI-AFSILRSC 292

Query: 255 SSAQTRKQAFLADQNKVPENEAILLDTL-KLRDELASLLGYNTYADYNLYDKMAKDSRTV 313
            S   R + + A  +  PE +   L  L KLR  LA ++G N+Y+DY L  KMAK    V
Sbjct: 293 PSENIRMKVWTA-VHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYV 351

Query: 314 MDFLNDLKGKLIPLGKKELQVLQDMKVK--DVERSKKDEDPNYYI--WDHRYYDNKHLLE 369
             F+  L   + PL  +EL+ L ++K    D+   K DE+   ++  WD  +Y     L+
Sbjct: 352 RGFVESLAEAIKPLAMRELRALANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLISLQ 411

Query: 370 NFNVDL--EKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNM 427
                L  E+I+ YF L T + G+  + E ++ ++ +E    +    W  +V+++ V  +
Sbjct: 412 QQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIR-LEPAVAKVGETWSPEVRRINV--V 468

Query: 428 DDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKR-----------------S 470
            D +    IG +Y DL  R GK  + A+F +  S  I   +                   
Sbjct: 469 SDQEG--VIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQ 526

Query: 471 YPVTALVCNFSKSTKDKP--SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWD 528
            PV +LVC+FS+++  K    LL+ +E+ T FHE+GH IH ++G+      +G      D
Sbjct: 527 LPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGT-RCATD 585

Query: 529 FVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALF-------TL 581
           FVE PS ++E +  +   L  +  HY T E +P+ L+       H+N           T 
Sbjct: 586 FVELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELL-------HLNQNELKYLQNTETF 638

Query: 582 RQLHFGLFDMKVHTCKDLEN--LSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSY 639
            Q    + D ++H+ + L +  + +   ++++ +++ ++ +  +   G   FGH++   Y
Sbjct: 639 SQAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDKSNWCG--RFGHLL--GY 694

Query: 640 SAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYD 686
            A YY YL+    A+ ++   FA DP + K+G ++++ VL  GG  D
Sbjct: 695 GASYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGGSRD 741

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  182 bits (462), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 146/566 (25%), Positives = 258/566 (45%), Gaps = 45/566 (7%)

Query: 151 LKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLG-EQKEYITFT 209
           L +E  K  +   +DF  SG+ +    R +  E+ + IS+   +F  N    + E+I   
Sbjct: 208 LTQEELKVGKILLEDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIA 267

Query: 210 KEQLE--GVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLAD 267
            E+L+  GV   +L Q  TT        T YKV       + +++   +   RK  + A 
Sbjct: 268 SEELDNSGVSPILLRQLTTTV-----RGTHYKVPAYGTAPYIILRSCKNENARKAVWTAL 322

Query: 268 QNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPL 327
            +   +    L   +K+R  L++++G   +A Y L  KMAK    V++F+  L     P+
Sbjct: 323 HSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPM 382

Query: 328 GKKELQVLQDMKVKDV----ERSKKDEDPNYYIWDHRYYDNK----HLLENFNVDLEKIS 379
             +EL++L +MK+ D+      S+K+       WD  YY  K       +N   + E I+
Sbjct: 383 AAEELKLLANMKLNDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQLTNHEPIN 442

Query: 380 EYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWI 439
            YF L + + G+  ++++++ +  +E         W  +V+++ V      ++   IG +
Sbjct: 443 AYFTLGSVLEGLSNLFKSIYGIS-LEVVASIPGETWSSEVRRVNV----KTENNNIIGVV 497

Query: 440 YFDLHPRDGKYGHAANFGLSSSFMI----ND------------SKRSYPVTALVCNFSKS 483
           Y DL  R  K    A+F +  S  +    ND             K   P+ +LVCNF+++
Sbjct: 498 YCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFART 557

Query: 484 TKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWN 543
           + ++  LL+ +EI T FHE+GH +H ++GQ K    +G      DFVE PS ++E +  +
Sbjct: 558 SDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARD 616

Query: 544 KNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCK---DLE 600
              L  +  HY T E++PE L+   + +        T  Q    + D +++       + 
Sbjct: 617 PRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFAQAKMAMLDQRLYDNNIIFHVR 676

Query: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           +L +   ++ L + + ++ +  T   G   FGH+    Y A YY YL     A  ++   
Sbjct: 677 DLDVVELYHDLERNLEVLVDDQTNWCG--KFGHLF--GYGATYYSYLLDRAIAAKIWDCL 732

Query: 661 FAKDPLNTKNGVQYRDIVLARGGLYD 686
           F  DP +   G  +++ VL  GGL D
Sbjct: 733 FVNDPFSRTGGENFKNAVLKWGGLRD 758

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  180 bits (456), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 170/635 (26%), Positives = 285/635 (44%), Gaps = 50/635 (7%)

Query: 90  LGPIINRLTFLQHVSSDKEIRDASVDSSMKLDE-LNIDLSLRHDIFL--QFARVWQDAQP 146
           L  +I+   FL+    D++   A+ +   ++ E +NI   L  D+ L  +  +V  D + 
Sbjct: 141 LCRVIDLCEFLRAAHPDEQFVAAAQECHEQMFEIMNI---LNTDVVLCKRLKQVLSD-EN 196

Query: 147 KADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGE-QKEY 205
            +  L  E  +      +DF  +G       R +  ++ + IS+   +F  N       Y
Sbjct: 197 ISSKLSSEEIRVGHILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSY 256

Query: 206 ITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFL 265
           I    + LE    S L   + TK   G     YK+       + ++    S   R+Q + 
Sbjct: 257 IKIPCKDLESSGTSHLVLRQLTKDTMGNN---YKIPTSGYAPYTLLNACPSEAIRRQVWT 313

Query: 266 ADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLI 325
           A  +   +    L   L+LR +LA+++G   Y  Y L  KMAK    V +FLN L     
Sbjct: 314 AMFSCSEKQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTK 373

Query: 326 PLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDN---KHLLENFNVD-LEKISEY 381
           PL   EL+ L  +K      S+ +       WD  YY +        N  VD    I+ Y
Sbjct: 374 PLAAGELEELAKLKRNVENLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTY 433

Query: 382 FPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYF 441
           F L   + G+  ++  ++ +  ++    Q    W  DV++L V +    ++   IG IY 
Sbjct: 434 FSLGVVMQGISDLFRDIYGIS-LKPVVAQAGETWAPDVRKLQVIS----ETEGIIGLIYC 488

Query: 442 DLHPRDGKYGHAANFGLSSSFMI----ND------------SKRSYPVTALVCNF--SKS 483
           DL  R GK    ++F +  S  I    ND            S+   PV +L+CNF  ++ 
Sbjct: 489 DLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRH 548

Query: 484 TKDKP-SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTW 542
            K+K   LL+ +++ T FHE+GH +H ++G+ +    +G   V  DFVE PS ++E +  
Sbjct: 549 GKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAK 607

Query: 543 NKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENL 602
           ++  L+ +SS+Y TGE IPE L+ +  +  +      T  Q+   + D ++H+  D ++ 
Sbjct: 608 DRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQDD- 666

Query: 603 SICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFA 662
            I   ++ L +E+ ++ +  T   G   FGH+    Y A YY YL     A  ++   F 
Sbjct: 667 -IIAVYHGLEREMEVLVDDQTNWCG--RFGHLF--GYGASYYSYLMDRAIAAKIWDHLFK 721

Query: 663 KDPLNTKNGVQYRDIVLARGGLYD----INDNLKE 693
           KDP +  +G ++++ VL  GG  D    I D L E
Sbjct: 722 KDPFSRSSGEKFKEGVLKWGGSRDAWQCIADALDE 756

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  175 bits (444), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 146/565 (25%), Positives = 263/565 (46%), Gaps = 46/565 (8%)

Query: 164 KDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLG-EQKEYITFTKEQLE--GVPDSI 220
           +DF  SG++++     +   I ++IS+    F  N    + +Y+    ++L+  GV   +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 221 LAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLD 280
           L Q       +      YKV       F +++   +   R + + A  +  PE +   L 
Sbjct: 263 LNQLSRDLKNQN-----YKVPAYGYAAFSILRSCPNENVRMKIWTA-MHSCPEKQISRLK 316

Query: 281 TL-KLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMK 339
            L  LR  LAS++G  +YA+Y L  KMAK    V  F+  L     PL  +EL+VL  +K
Sbjct: 317 QLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLK 376

Query: 340 VK--DVERSKKDEDPNYYI--WDHRYYDNKHLLENFNVDLEK--ISEYFPLETTITGMLQ 393
                V   + D D   ++  WD  +Y   + L+     LE   IS YF L T + G+ +
Sbjct: 377 SGHLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSR 436

Query: 394 IYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHA 453
           ++E ++ ++ +E    +    W  +V+++ V +  +      IG +Y DL  R GK  + 
Sbjct: 437 LFEDIYGIR-LEPVVAKAGETWSPEVRRINVVSEKEG----IIGVVYCDLFERQGKTSNP 491

Query: 454 ANFGLSSSFMI----------------NDSKRSYPVTALVCNFSKSTKDKP--SLLKHNE 495
           A+F +  S  I                +  K   PV +LVC+F++++  +    LL+ ++
Sbjct: 492 AHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSD 551

Query: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYK 555
           + T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +  HY 
Sbjct: 552 VDTLFHEMGHAMHSMLGRTSLQNISGT-RCATDFVELPSILMEHFARDSRVLSRIGRHYA 610

Query: 556 TGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLEN--LSICHTWNQLRQ 613
           T + IP  L+       +      T  Q    + D ++H+ K L +  L +   ++ + +
Sbjct: 611 TDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEK 670

Query: 614 EISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQ 673
           ++ ++ +    S     FGH++   Y A YY YL+    A+ ++   FA+DP N +NG +
Sbjct: 671 DMEVLADDQ--SNWCGRFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEK 726

Query: 674 YRDIVLARGGLYDINDNLKEFLGRE 698
           +++ VL  GG  D  + + + L R+
Sbjct: 727 FKESVLKWGGSKDPWECVADALDRK 751

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  172 bits (435), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 165/635 (25%), Positives = 293/635 (46%), Gaps = 62/635 (9%)

Query: 90  LGPIINRLTFLQHVSSDKEIRDASVDSSMKLDE----LNIDLSLRHDIFLQFARVWQDAQ 145
           L  +I+   F++    D E    S +    + E    LN D+ L + +      + +D +
Sbjct: 151 LCRVIDLCEFIRSAHPDDEYLKVSQECYELMFEFMNTLNTDVQLCYTL----KHILED-E 205

Query: 146 PKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLG-EQKE 204
                L  E +K  +   +DF  SG+ ++   R K  E+ ++IS+    F  N     K 
Sbjct: 206 KICSKLTDEEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTKN 265

Query: 205 YITFTKEQLEGVPDSILAQFE-----TTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQT 259
            I   +E L       L++ E       K++  G+   YK+    P  + ++   S+   
Sbjct: 266 NILIDRESLN------LSELELPFTYQLKTDITGKH--YKIPTTGPIPYSILTNCSNETI 317

Query: 260 RKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLND 319
           RK+ +    +   E    L   + LR +LA LL   ++A+Y L  KMAK+   V  F++ 
Sbjct: 318 RKKIWTELHSCSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFIST 377

Query: 320 LKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYI-----WDHRYYDNKHLLENFNV- 373
           L     PL  KEL  L ++K  D+  + K+ D N+ +     WD  YY   +  EN    
Sbjct: 378 LLDFTKPLAIKELTSLAEVKAADLGLAFKN-DSNFIVNLIRPWDRNYYSKINRYENKQTM 436

Query: 374 -DLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKS 432
            DL ++  YF L   I G+  ++  ++ ++F E   P+ +  W  +V++L V +    +S
Sbjct: 437 EDLNELPYYFSLGNVIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS----ES 491

Query: 433 PRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKR---------------SYPVTALV 477
              IG +Y DL  R  K  +AA+F +  S  I   +                  P+ +L+
Sbjct: 492 EGLIGIVYCDLFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLI 551

Query: 478 CNFSKS---TKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPS 534
           CNFSKS    ++ P  L+ +EI T FHE+GH +H ++G+ +    +G      DFVE PS
Sbjct: 552 CNFSKSHLFEENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPS 610

Query: 535 QMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH 594
            ++E +  +   + S+SSHY + E     L+ + + +      L    Q    + D  +H
Sbjct: 611 ILMEHFAKDVRVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILH 670

Query: 595 T---CKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEV 651
           +    +D +++++  ++N L +++ L  +  +   G   FGH+    Y A YY YL+   
Sbjct: 671 SNEIFEDQKDINVVKSYNDLEKKLELFSDDQSNWCG--KFGHLF--GYGASYYSYLFDRA 726

Query: 652 FATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYD 686
            A+ ++ + F ++P +  +G++++D VL  GG  D
Sbjct: 727 IASKVWESLFKQNPFSRTSGLKFKDSVLRWGGSRD 761

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  163 bits (412), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 170/671 (25%), Positives = 294/671 (43%), Gaps = 72/671 (10%)

Query: 63  KFYELMSQVESPSVTNFIEPFMKFENELGPIINRLT----FLQHVSSDKEIRDASVDSSM 118
           K  EL+ ++ S    + ++ ++K  ++L  ++ R+     F++    DK+    +     
Sbjct: 102 KAKELVQKIHSIETQDEMKYYIKDLDQLSDVLCRVIDLCEFIRATHPDKKFVQTAQQCHE 161

Query: 119 KLDE----LNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELD 174
           K+ E    LN D+ L  D+  Q  R     +     L  E  +  +   +DF  SG+ + 
Sbjct: 162 KMFEIMNILNTDVRL-CDLLTQCLR-----ESDVLGLDSEEIRTGKILLEDFEKSGIYMK 215

Query: 175 EANRLKIKEIKKKISMNSINFSKNLG-EQKEYITFTKEQLEGVPDSILAQFETTKSEKGG 233
              R K  ++ ++IS+   +F  N    +  YI  + E ++   + ++      K +  G
Sbjct: 216 PEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKISCELMDAHVNKMVC--SQMKKDITG 273

Query: 234 EDTLYKV-TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLL 292
           E   YKV T+ Y     +++  S    R + +    +        L   + LR ELA LL
Sbjct: 274 E--YYKVPTYGYIP-HTLLRTCSDEVIRMKIWTEMHSCSDAQIERLTKLISLRVELAKLL 330

Query: 293 GYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMK--VKDVERSKKDE 350
           G   +A Y L+ KMAK    V  FL  L          EL+ L  +K  +   +     E
Sbjct: 331 GSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVLKSELTGTQTPHTSE 390

Query: 351 DPNYYI--WDHRYYDN-KHLLENFNVDL---EKISEYFPLETTITGMLQIYETLFNLKFI 404
           +    +  WD  YY + + L +  +  L   E IS  F L   + G+  ++E ++ +K +
Sbjct: 391 EVLELMKPWDRDYYGSIQALAQRRSSSLDNGESISSSFSLGVVMQGLSDLFEKIYGIKLV 450

Query: 405 ETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMI 464
               P+    W  DV+++ V +  D      IG +Y DL  R+GK  + A+F +  S  +
Sbjct: 451 PAT-PKTGETWSPDVRRIDVVDEHDG----LIGVMYCDLFEREGKTPNPAHFTVCCSRNM 505

Query: 465 ----------------NDSKRSYPVTALVCNF-------SKSTKDKPSLLKHNEIVTFFH 501
                           N  K   PV +LVC+F             +  LL+ NEI T FH
Sbjct: 506 YLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDGKHQQMCLLQLNEIETLFH 565

Query: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIP 561
           E+GH +H ++G+ +    +G      DFVE PS ++E +  +   L S+SSHYKTG+   
Sbjct: 566 EMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARDTRVLSSISSHYKTGK--- 621

Query: 562 ESLIDSLIKTKHVNGALF----TLRQLHFGLFDMKVHTCKDLENLSI--CHTWNQLRQEI 615
            SL   ++K   +         T  Q+     D ++H      + SI     +++L + +
Sbjct: 622 -SLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELHNLDHTTDGSIDVIAIYHRLERRL 680

Query: 616 SLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYR 675
           +++P+  +   G   FGH+    Y A YY YL+    A+ ++   F +DP N  NG +++
Sbjct: 681 AVLPDDQSNWCG--KFGHLFG--YGASYYSYLFDRAIASKIWDHLFEQDPFNRTNGTKFK 736

Query: 676 DIVLARGGLYD 686
           + +L  GG  D
Sbjct: 737 EGLLQWGGSRD 747

>Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {ON}
           YHR178W (STB5) - Zinc finger (6-Cys) [contig 1] FULL
          Length = 692

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 32  SFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELG 91
           S PI   A    + T    GG+TT ++     F      +E P    FI  + K  +   
Sbjct: 214 SIPIRASAIQIETVTSVFKGGRTTSMLTPEGNF----KHIERPLYDRFIAAYFKHNHRSY 269

Query: 92  PIINRLTFLQHVSSDKEIRD 111
           P+IN++ FL  VS+ ++  +
Sbjct: 270 PLINKIEFLNKVSTIRQFEE 289

>KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} similar
           to uniprot|P38699 Saccharomyces cerevisiae YHR178W STB5
           binds Sin3p in two-hybrid assay Zinc finger (6-Cys)
          Length = 634

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 32  SFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELG 91
           S PI   +    + T    GG+TT +++ +  F      +E P    FI  + K  +   
Sbjct: 156 SIPIKASSIQIETVTAVFKGGRTTPMVEPNGSF----KHIERPLYDRFIAAYFKHNHRSY 211

Query: 92  PIINRLTFLQHVSSDKEIRD 111
           P++N++ FL  VS+ ++ ++
Sbjct: 212 PLLNKIEFLNKVSTIRDFKE 231

>TDEL0D02550 Chr4 (490475..491305) [831 bp, 276 aa] {ON} Anc_5.446
           YDR374C
          Length = 276

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 65/161 (40%), Gaps = 51/161 (31%)

Query: 298 ADYNLYDKMAKDSRTVMDFLNDLKGKLI---------PLGKKELQVLQD----------- 337
           ADY  +D+M++      + +N   G++          PL KK   ++             
Sbjct: 69  ADYQYFDEMSEYQHVSPNAINTYTGRVSMALKQKGRKPLAKKTSAIIPPWIDVPEHSRFF 128

Query: 338 -MKVKDVERSKKDEDPNYY--IWDHRYYDNKHLLENFNVDLEKISEYF------------ 382
            +K   +E  KK    ++Y  IW   Y+ NK L E +  +L K S+ F            
Sbjct: 129 VIKSSSLENVKK----SFYNGIWSSTYFGNKRLSEAY-FNLPKGSKIFLFFSVNASGRFC 183

Query: 383 -----------PLETTITGMLQIYETLFNLKFIETKEPQNK 412
                       L+T+I G  + Y+T F +++I  ++ QN+
Sbjct: 184 GVAEMISGLESGLDTSIWGNNEKYDTAFKVRWIVVRDVQNR 224

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,641,205
Number of extensions: 3964838
Number of successful extensions: 13455
Number of sequences better than 10.0: 135
Number of HSP's gapped: 13865
Number of HSP's successfully gapped: 138
Length of query: 712
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 595
Effective length of database: 40,065,477
Effective search space: 23838958815
Effective search space used: 23838958815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)