Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.61.8ON97974946e-66
YCL057C-A (MOS1)1.8ON97974531e-59
Smik_3.171.8ON97974442e-58
Suva_3.1551.8ON97974356e-57
TPHA0E039801.8ON86853053e-37
CAGL0B00396g1.8ON88743001e-36
NCAS0B090801.8ON93902983e-36
TBLA0A049601.8ON96972984e-36
SAKL0C00528g1.8ON110942979e-36
ZYRO0F18414g1.8ON87692941e-35
AFR743W1.8ON82962932e-35
Kpol_2002.111.8ON86702896e-35
KLLA0C00550g1.8ON82772897e-35
KLTH0F00550g1.8ON82962862e-34
Ecym_10101.8ON82692844e-34
Kwal_33.130161.8ON82962714e-32
KAFR0D001701.8ON90972584e-30
TDEL0C069401.8ON86982472e-28
NDAI0A001701.8ON96972473e-28
KNAG0C002501.8ON94702412e-27
Suva_7.5725.23ON55351690.33
YGR276C (RNH70)5.23ON55351670.55
Skud_7.6095.23ON55251670.60
CAGL0M06765g2.296ON28050660.65
KNAG0J022103.285ON58164632.1
Skud_2.1923.285ON61970604.3
Smik_16.325.23ON55251604.5
NDAI0E038207.62ON46236604.8
Smik_2.2023.285ON61770597.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.6
         (97 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   194   6e-66
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   179   1e-59
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   175   2e-58
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   172   6e-57
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   122   3e-37
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   120   1e-36
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   119   3e-36
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   119   4e-36
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   119   9e-36
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   117   1e-35
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   117   2e-35
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   115   6e-35
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   115   7e-35
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   114   2e-34
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   114   4e-34
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   108   4e-32
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   103   4e-30
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   100   2e-28
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   100   3e-28
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    97   2e-27
Suva_7.572 Chr7 complement(998747..1000408) [1662 bp, 553 aa] {O...    31   0.33 
YGR276C Chr7 complement(1043819..1045480) [1662 bp, 553 aa] {ON}...    30   0.55 
Skud_7.609 Chr7 complement(1018396..1020054) [1659 bp, 552 aa] {...    30   0.60 
CAGL0M06765g Chr13 (690036..690878) [843 bp, 280 aa] {ON} simila...    30   0.65 
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...    29   2.1  
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...    28   4.3  
Smik_16.32 Chr16 (52014..53672) [1659 bp, 552 aa] {ON} YGR276C (...    28   4.5  
NDAI0E03820 Chr5 (835913..837301) [1389 bp, 462 aa] {ON} Anc_7.6...    28   4.8  
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...    27   7.3  

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  194 bits (494), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  179 bits (453), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 88/97 (90%), Positives = 92/97 (94%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQA+ Q+PAKST S DS KNGS+VSTILD KWDIV+SNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  175 bits (444), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/97 (88%), Positives = 90/97 (92%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQA+ Q+PAK T S DS KNGS VST+LD KWDIV+SNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  172 bits (435), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 84/97 (86%), Positives = 90/97 (92%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQA+   PAKST S +S +NGSAVST+LDAKWDIV+SNMLVKTAMGFG+GVFTSVLFF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFP WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  122 bits (305), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 56/85 (65%), Positives = 72/85 (84%)

Query: 13 STSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIG 72
          S   N++    ++  +IL+ KWD+V+SNMLVKT +GFGVGV TS+L FKRRAFPVWLGIG
Sbjct: 2  SEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIG 61

Query: 73 FGVGRGYAEGDAIFRSSAGLRSSKV 97
          FGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 62 FGVGRGYSDGDAIFRSAAGLRSTRI 86

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%)

Query: 24 SAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGD 83
          + V +IL+ KWD+V+SNM+VK  +GFGVGV TSVLFFKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74

Query: 84 AIFRSSAGLRSSKV 97
          AIFRS+AGLRS KV
Sbjct: 75 AIFRSTAGLRSVKV 88

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  119 bits (298), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (78%), Gaps = 1/90 (1%)

Query: 8  QEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67
            P +ST ++ ++   +   +IL+ KWD+V+SNMLVK  +GF VGV  SV+FFKRR FPV
Sbjct: 5  NNPNQSTPTSTAV-TPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPV 63

Query: 68 WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          WLGIGFGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 64 WLGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  119 bits (298), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 63/97 (64%), Positives = 74/97 (76%), Gaps = 1/97 (1%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ   Q    +T+ + S    S  S IL+ KWDIV+SNMLVKT  GFG GV  SV+FF
Sbjct: 1  MSEQIAQQTTTPTTTESASTAVTSNRS-ILNDKWDIVISNMLVKTTFGFGAGVLASVIFF 59

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLG+GFG+GRGY+EGDAIFRS+AGLRS +V
Sbjct: 60 KRRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  119 bits (297), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 15/94 (15%)

Query: 1   MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
           MSEQ ++ +P KS               IL+ KWD+V+SN++VKT +GFG G+  SVL F
Sbjct: 29  MSEQLQVSKPNKS---------------ILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73

Query: 61  KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRS 94
           KRRAFPVWLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  117 bits (294), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (92%)

Query: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          +IL+ KWD+V+SN+LVK+ +GFGVGV  SVL FKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77

Query: 88 SSAGLRSSK 96
          S+AGLR+SK
Sbjct: 78 SAAGLRTSK 86

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  117 bits (293), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (73%), Gaps = 15/96 (15%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MS Q ++  P++S               IL+ KWD+V+SN++VKT +GFG GVF SVLFF
Sbjct: 1  MSGQLEVSAPSRS---------------ILNDKWDVVLSNLVVKTGLGFGAGVFASVLFF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVWLG+GFG+GRGYAEGDAIFRS AGLR+ +
Sbjct: 46 KRRAFPVWLGVGFGLGRGYAEGDAIFRSHAGLRAVR 81

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  115 bits (289), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (88%)

Query: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          +IL+ KWD+V+SN LVKT++GFG GV  SV+ FKRRAFPVWLGIGFG+GRGY+EGDAIFR
Sbjct: 17 SILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSEGDAIFR 76

Query: 88 SSAGLRSSKV 97
          S+AGLR S V
Sbjct: 77 SAAGLRKSTV 86

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  115 bits (289), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 67/77 (87%)

Query: 17 NDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVG 76
          ++ ++   AV +ILD +WD+V+SN++ KTA+G GVG+  SVLFFKRRAFPVW+G+GFG+G
Sbjct: 2  SEQVQTTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLG 61

Query: 77 RGYAEGDAIFRSSAGLR 93
          RGYAEGDAIFR++AGLR
Sbjct: 62 RGYAEGDAIFRTNAGLR 78

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  114 bits (286), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (72%), Gaps = 15/96 (15%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ K+   ++S               +L+ KWD+V+SN++VKT +GFG GV  SVL F
Sbjct: 1  MSEQLKVSPTSRS---------------LLNDKWDVVLSNLVVKTGLGFGAGVVASVLLF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVW+G+GFG+GRGYAEGDAIFRSSAGLR+ K
Sbjct: 46 KRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  114 bits (284), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%)

Query: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          +IL+ KWD+V+SN++VK  +GF VGV  SVLFFKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 13 SILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIFR 72

Query: 88 SSAGLRSSK 96
          S AGLR+ K
Sbjct: 73 SHAGLRTMK 81

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  108 bits (271), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 69/96 (71%), Gaps = 15/96 (15%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MS+QAK+   ++S               +L+ KWD+V+SN++VK  +GFG GV  SVL F
Sbjct: 1  MSDQAKIAPVSRS---------------LLNDKWDVVLSNLVVKVGLGFGAGVVASVLLF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRA PVW+G+GFG+GRGY+EGDAIFRSSAGLR+ K
Sbjct: 46 KRRAAPVWIGVGFGLGRGYSEGDAIFRSSAGLRTVK 81

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  103 bits (258), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 62/97 (63%), Positives = 78/97 (80%), Gaps = 7/97 (7%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSE+ K+ +PA+   SN+SI       +IL+ KWD+V+SNMLVK  +GFGVGV TSV+FF
Sbjct: 1  MSEEDKVGKPAEY--SNNSIDR-----SILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFF 53

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score = 99.8 bits (247), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 74/98 (75%), Gaps = 15/98 (15%)

Query: 1  MSE--QAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVL 58
          MSE  QA+LQ  A S S             IL+ KWD+V+SNMLVKT +GFGVGV  SVL
Sbjct: 1  MSEKSQAQLQVAAPSRS-------------ILNDKWDVVLSNMLVKTGLGFGVGVVGSVL 47

Query: 59 FFKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          FFKRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 48 FFKRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 99.8 bits (247), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 70/97 (72%), Gaps = 1/97 (1%)

Query: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ    E   + +     +  +   +IL+ KWDIV+SN LVK  +GFGVGV TSV+FF
Sbjct: 1  MSEQVNKTEHQNAVAPPQQ-QLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFF 59

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRR FPVWLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 60 KRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 97.4 bits (241), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 53/70 (75%), Positives = 64/70 (91%)

Query: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+V+SNMLVK  MGFGVGV TSVL F+RRAFPVWLGIGFGVGRGY+EGDAIFR
Sbjct: 25 SLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEGDAIFR 84

Query: 88 SSAGLRSSKV 97
          S++G+R+ KV
Sbjct: 85 STSGIRTVKV 94

>Suva_7.572 Chr7 complement(998747..1000408) [1662 bp, 553 aa] {ON}
           YGR276C (REAL)
          Length = 553

 Score = 31.2 bits (69), Expect = 0.33,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 17  NDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67
           N SI+NG    +I DA+  + ++ + +   + FG+G+ T  LF K   F V
Sbjct: 352 NKSIQNGEH-DSIEDARACLELTKLKILNGLAFGIGINTENLFTKLHRFEV 401

>YGR276C Chr7 complement(1043819..1045480) [1662 bp, 553 aa] {ON}
           RNH703'-5' exoribonuclease; required for maturation of
           3' ends of 5S rRNA and tRNA-Arg3 from dicistronic
           transcripts
          Length = 553

 Score = 30.4 bits (67), Expect = 0.55,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 17  NDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67
           N SI+NG    ++ DA+  + ++ + +   + FG+G+ T  LF K   F V
Sbjct: 352 NKSIQNGEH-DSVEDARACLELTKLKILNGLAFGIGINTENLFTKLHRFEV 401

>Skud_7.609 Chr7 complement(1018396..1020054) [1659 bp, 552 aa] {ON}
           YGR276C (REAL)
          Length = 552

 Score = 30.4 bits (67), Expect = 0.60,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 17  NDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67
           N SI+NG    ++ DA+  + ++ + +   + FG+G+ T  LF K   F V
Sbjct: 351 NKSIQNGEH-DSVEDARACLELTKLKILNGLAFGIGINTENLFSKLHRFEV 400

>CAGL0M06765g Chr13 (690036..690878) [843 bp, 280 aa] {ON} similar
          to uniprot|P53965 Saccharomyces cerevisiae YNL032w
          SIW14
          Length = 280

 Score = 30.0 bits (66), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 3  EQAKLQEPAKSTSS---NDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGF 49
          E++ L++  +STSS   +D IKN S +  IL+ + D++M N  V+     
Sbjct: 7  EESPLRDIVRSTSSLKIDDLIKNESDIIRILNQQEDLLMDNGRVRNVHHL 56

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 23  GSAVSTILDAKWDIVMSNMLVKTAMG---FGVGVFTSVLFFKRRAFPVWLGIGFGVGRGY 79
           G A+S +   +W IV+   LV  AM    + VGV   V  F   +F V + I  G  RGY
Sbjct: 167 GFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNLDV--FVLASFVVVVLINLGGARGY 224

Query: 80  AEGD 83
            E +
Sbjct: 225 VEAE 228

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score = 27.7 bits (60), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 23  GSAVSTILDAKWDIVMSNMLVKTAM------GFGVGVFTSVLFFKRRAFPVWLGIGFGVG 76
           G AVS +   +W  V+   LV  AM           +F +V+F     F + + + FG  
Sbjct: 173 GFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTNVNADIFVAVVFI----FVIIINL-FG-S 226

Query: 77  RGYAEGDAIF 86
           RGYAE + IF
Sbjct: 227 RGYAEAEFIF 236

>Smik_16.32 Chr16 (52014..53672) [1659 bp, 552 aa] {ON} YGR276C
           (REAL)
          Length = 552

 Score = 27.7 bits (60), Expect = 4.5,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 17  NDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPV 67
           N  I+NG    ++ DA+  + ++ + +   + FG+G+ T  LF K   F V
Sbjct: 351 NKIIQNGEH-DSVEDARACLELTKLKILNGLAFGIGINTENLFTKLHRFEV 400

>NDAI0E03820 Chr5 (835913..837301) [1389 bp, 462 aa] {ON} Anc_7.62
           YOR334W
          Length = 462

 Score = 27.7 bits (60), Expect = 4.8,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 23  GSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVL 58
           G  V+T+L A + + + N + ++ +GFG  VF S++
Sbjct: 330 GFTVATLLPAFYGMNLKNFIEESYLGFGAVVFLSIV 365

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score = 27.3 bits (59), Expect = 7.3,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 23  GSAVSTILDAKWDIVMSNMLVKTAM------GFGVGVFTSVLFFKRRAFPVWLGIGFGVG 76
           G AVS +   +W  V+   LV  AM           +F +V+F     F + + + FG  
Sbjct: 173 GFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTSVNSDIFVAVVFI----FVIIINL-FG-S 226

Query: 77  RGYAEGDAIF 86
           RGYAE + IF
Sbjct: 227 RGYAEAEFIF 236

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,478,197
Number of extensions: 267340
Number of successful extensions: 955
Number of sequences better than 10.0: 33
Number of HSP's gapped: 954
Number of HSP's successfully gapped: 33
Length of query: 97
Length of database: 53,481,399
Length adjustment: 68
Effective length of query: 29
Effective length of database: 45,684,111
Effective search space: 1324839219
Effective search space used: 1324839219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)