Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.51.7ON1131134724e-62
YCL058W-A (ADF1)1.7ON1131133762e-47
Suva_3.1541.7ON1131133658e-46
Smik_3.161.7ON1131133604e-45
SAKL0C00506g1.7ON105871677e-16
KAFR0D001601.7ON111871618e-15
NDAI0A001601.7ON123921592e-14
TBLA0A049501.7ON113871563e-14
CAGL0B00374g1.7ON121911522e-13
NCAS0B090901.7ON119891503e-13
KNAG0C002401.7ON126951504e-13
TPHA0E039901.7ON116871409e-12
Kpol_2002.101.7ON111931331e-10
KLTH0F00528g1.7ON104821233e-09
Kwal_YGOB_YCL058W-A1.7ON105891224e-09
Kwal_33.13015singletonOFF105891224e-09
TDEL0C069501.7ON111891164e-08
ZYRO0F18436g1.7ON112881146e-08
AFR743CA1.7ON101871024e-06
KLLA0C00528g1.7ON11677680.29
TPHA0E032005.180ON62657623.5
KLLA0F24002g2.154ON46394623.5
NDAI0G011903.444ON96153607.6
KLTH0B05126g2.154ON47778599.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.5
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)   186   4e-62
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...   149   2e-47
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...   145   8e-46
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...   143   4e-45
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    69   7e-16
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    67   8e-15
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    66   2e-14
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    65   3e-14
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    63   2e-13
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    62   3e-13
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    62   4e-13
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    59   9e-12
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    56   1e-10
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    52   3e-09
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    52   4e-09
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    52   4e-09
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    49   4e-08
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    49   6e-08
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    44   4e-06
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    31   0.29 
TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {O...    28   3.5  
KLLA0F24002g Chr6 complement(2237722..2239113) [1392 bp, 463 aa]...    28   3.5  
NDAI0G01190 Chr7 complement(257644..260529) [2886 bp, 961 aa] {O...    28   7.6  
KLTH0B05126g Chr2 complement(423735..425168) [1434 bp, 477 aa] {...    27   9.9  

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score =  186 bits (472), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 97/113 (85%), Positives = 97/113 (85%)

Query: 1   MGKSSLRMXXXXXXXXXXXXXXXXRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60
           MGKSSLRM                RPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ
Sbjct: 1   MGKSSLRMKTQGKNGGVGKKVQKKRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60

Query: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL
Sbjct: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score =  149 bits (376), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 79/113 (69%), Positives = 88/113 (77%)

Query: 1   MGKSSLRMXXXXXXXXXXXXXXXXRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60
           MGK S++                 R ISTAERKRTKLQVEKLNKSSE MIPTLLRE +TQ
Sbjct: 1   MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60

Query: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           EP K +A++TLKAEEL+KDQ KD KVREQI+TEKSKTNDSML+QIEMISGFSL
Sbjct: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  145 bits (365), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 87/113 (76%)

Query: 1   MGKSSLRMXXXXXXXXXXXXXXXXRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60
           MGKSS+R                 RPISTAE KRTKLQVE+LNKSSE MIPTLL+E + Q
Sbjct: 1   MGKSSMRKKTQGKNGGVGKKQQKKRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60

Query: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           +  KK+ +STL+AEELVKDQA+D KVRE I+TEKSKTNDSML+QIEMISGFSL
Sbjct: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  143 bits (360), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 85/113 (75%)

Query: 1   MGKSSLRMXXXXXXXXXXXXXXXXRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60
           MGK+S+R                 R ISTA +KRTKLQVEKLNKSSE+MIPTLLRET  Q
Sbjct: 1   MGKNSMRRKSVGKNVGVGKKVQKRRSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60

Query: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           EP K++ +STLKA +L+KDQ KD KVRE IQ EKSKTND+ML+QIEMISGFSL
Sbjct: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 68.9 bits (167), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 61/87 (70%), Gaps = 2/87 (2%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDCKV 86
           I  +++KRT++QVE+LNK  E ++  L    A    TK++ K TL+A+ L +DQ KD + 
Sbjct: 21  IKKSQKKRTRIQVEQLNKQ-EFLLSDLNMTNAGSTKTKEKPK-TLQAKALAQDQKKDKET 78

Query: 87  REQIQTEKSKTNDSMLEQIEMISGFSL 113
           R++++ ++  TND+ML Q+EMISGFSL
Sbjct: 79  RDKLEKQRKDTNDNMLAQLEMISGFSL 105

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 66.6 bits (161), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 59/87 (67%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDCKV 86
           IS +ERK+ KL VEK N+ +   +  L ++    +    + K+ L+ ++L+ DQA+D +V
Sbjct: 25  ISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKRRLSKTKNALETKKLLHDQARDHEV 84

Query: 87  REQIQTEKSKTNDSMLEQIEMISGFSL 113
           ++ I+T+  +T DSML+QIEMISGFSL
Sbjct: 85  KQNIETKLKETEDSMLKQIEMISGFSL 111

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 65.9 bits (159), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKK-----RAKSTLKAEELVKDQA 81
           I  ++RK+ K++V   NK S + +      + +  P K+     R  S+L A +L+ DQ 
Sbjct: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQK 91

Query: 82  KDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           KD +   +IQTEK + ND ML QIEMISGF  
Sbjct: 92  KDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 64.7 bits (156), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 56/87 (64%), Gaps = 2/87 (2%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDCKV 86
           IS  ++KR KLQVEK+NK   ++   +     ++E  K    +TL +++L KDQ KD  +
Sbjct: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNV--NTLSSKQLKKDQEKDRLL 86

Query: 87  REQIQTEKSKTNDSMLEQIEMISGFSL 113
             +I+ +K +TND ++ QIEMISGFSL
Sbjct: 87  NVEIKNKKKQTNDDLIAQIEMISGFSL 113

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 63.2 bits (152), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 6/91 (6%)

Query: 27  ISTAERKRTKLQVEKLNKSSEI----MIPTLLRETATQEPTKKRAKSTLKAEELVKDQAK 82
           IS +ERK++K+   +LNK +++    +I  L      +EP K++  + L    LVKDQ +
Sbjct: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQ--TALDMNCLVKDQKR 90

Query: 83  DCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           D KVRE I+   S+TN  ML+Q+E++SGFSL
Sbjct: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 62.4 bits (150), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 57/89 (64%), Gaps = 2/89 (2%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRA--KSTLKAEELVKDQAKDC 84
           IS ++RK+ K QVEKLNK   ++   +L     +  +KK    KS L A  L++DQ KD 
Sbjct: 31  ISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDK 90

Query: 85  KVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           ++R +I+ E+  T+DS+ +QIEMISGF+ 
Sbjct: 91  EIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 62.4 bits (150), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (58%), Gaps = 8/95 (8%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPT--------LLRETATQEPTKKRAKSTLKAEELVK 78
           I  +ERKR KLQVEKLN+ +  MI          + +     E   +    +L  E+L +
Sbjct: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91

Query: 79  DQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           D++KD  ++EQ+  ++ +T+ SML QIEMISGFSL
Sbjct: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 58.5 bits (140), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 56/87 (64%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDCKV 86
           +S+  RK TK +VEKLNK   I    +    A     +++  S L+A+ L KD  KD ++
Sbjct: 30  LSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKDRQL 89

Query: 87  REQIQTEKSKTNDSMLEQIEMISGFSL 113
            E+I+++K +TN S+L+QIEM+SGFSL
Sbjct: 90  IEKIESKKKETNASLLQQIEMMSGFSL 116

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 55.8 bits (133), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 62/93 (66%), Gaps = 11/93 (11%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPT----LLRET--ATQEPTKKRAKSTLKAEELVKDQ 80
           IS +E+KR K+++EK+NK  E ++P+    L  ET     E  K+RA   L++++L +D 
Sbjct: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNKERA---LESQKLQQDN 78

Query: 81  AKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
            KD +   +I+  K +T+DSML+QIE+++GFSL
Sbjct: 79  VKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 52.0 bits (123), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 55/82 (67%), Gaps = 7/82 (8%)

Query: 34  RTKLQVEKLNKSSEIMIPTLLRETATQEPTKKR--AKSTLKAEELVKDQAKDCKVREQIQ 91
           RTKL+VE+ NK S      L+ E   +E   KR  A  +LK  +L++D+ KD  ++++++
Sbjct: 28  RTKLKVEQANKES-----FLISELNEREHNTKRTPALESLKVSDLIEDREKDKSMQKKME 82

Query: 92  TEKSKTNDSMLEQIEMISGFSL 113
            +K  T+++++EQ+E+ISGFSL
Sbjct: 83  EQKQSTDNNIIEQLELISGFSL 104

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 51.6 bits (122), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 58/89 (65%), Gaps = 7/89 (7%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKS--TLKAEELVKDQAKDC 84
           I   ++ RTKL+VE+ NK  E+    L+ E   +E TK+++    +LK   LVKD  KD 
Sbjct: 22  IKKHQKIRTKLKVEQANK--EVF---LISELNKREDTKRQSSPLESLKPSRLVKDIKKDQ 76

Query: 85  KVREQIQTEKSKTNDSMLEQIEMISGFSL 113
             ++Q+++++  T++++L Q+E+ISGFSL
Sbjct: 77  NAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 51.6 bits (122), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 58/89 (65%), Gaps = 7/89 (7%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKS--TLKAEELVKDQAKDC 84
           I   ++ RTKL+VE+ NK  E+    L+ E   +E TK+++    +LK   LVKD  KD 
Sbjct: 22  IKKHQKIRTKLKVEQANK--EVF---LISELNKREDTKRQSSPLESLKPSRLVKDIKKDQ 76

Query: 85  KVREQIQTEKSKTNDSMLEQIEMISGFSL 113
             ++Q+++++  T++++L Q+E+ISGFSL
Sbjct: 77  NAQKQLESQRKATDENVLRQLELISGFSL 105

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 49.3 bits (116), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 51/89 (57%)

Query: 25  RPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDC 84
           + IS  + K+TK +VE LN+ +  +   +    +T      R  +TL+   L KD  KD 
Sbjct: 23  KAISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQ 82

Query: 85  KVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           K+RE+ + EK +  +++ +QIE ISGFSL
Sbjct: 83  KIREKSKAEKEEMANNLEKQIEDISGFSL 111

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 48.5 bits (114), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (63%), Gaps = 3/88 (3%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPT-LLRETATQEPTKKRAKSTLKAEELVKDQAKDCK 85
           IS +++KRTK +VEKL+  ++ ++P+ + +   +         S+L A  L +D+  D  
Sbjct: 27  ISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRSASSKTSNGSSSLLARNLEQDRKMDQD 84

Query: 86  VREQIQTEKSKTNDSMLEQIEMISGFSL 113
            R++   +K +T++++L+QIEMISGFSL
Sbjct: 85  TRDKANAKKKETDNNILQQIEMISGFSL 112

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 43.9 bits (102), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDCKV 86
           IS A++KR KLQVEKL+K         +                L+A  L +DQ  D + 
Sbjct: 22  ISKADKKRAKLQVEKLDKRG-------VLLAELTAAAPAAKTGVLQAASLAQDQRSDAQA 74

Query: 87  REQIQTEKSKTNDSMLEQIEMISGFSL 113
           ++Q   E+S  +  +++Q+E I+GFSL
Sbjct: 75  QQQRAQERSNVDKKVVQQLEAIAGFSL 101

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 30.8 bits (68), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 47/77 (61%), Gaps = 4/77 (5%)

Query: 37  LQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSK 96
           +QV +L+K  ++ I  ++   A ++P   R+ ++L+ +++ +   +D +V ++   EK  
Sbjct: 44  MQVRQLDKL-DLSIADIVPNKAQKKP---RSSASLEGQKVREHYKEDKEVVKKHDKEKKA 99

Query: 97  TNDSMLEQIEMISGFSL 113
           T   + +Q+E+ISGFSL
Sbjct: 100 TEKKIEDQLELISGFSL 116

>TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {ON}
           Anc_5.180
          Length = 626

 Score = 28.5 bits (62), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 53  LLRETATQEPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMIS 109
            L ET  Q   K+RAK   K  +L  DQ+       +++T K   NDS+L  + ++S
Sbjct: 328 FLPETHHQTILKRRAK---KLRKLTGDQSYRAVSEIKVRTLKEIANDSLLRPLILLS 381

>KLLA0F24002g Chr6 complement(2237722..2239113) [1392 bp, 463 aa]
           {ON} similar to uniprot|P53923 Saccharomyces cerevisiae
           YNL119W NCS2 Protein with a role in urmylation and in
           invasive and pseudohyphal growth inhibits replication of
           Brome mosaic virus in S. cerevisiae which is a model
           system for studying replication of positive-strand RNA
           viruses in their natural hosts
          Length = 463

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 15/94 (15%)

Query: 27  ISTAERKRTKLQVEKLNKSSEIMIP-----------TLLRETATQEPTKKRAKSTLKAEE 75
           IS  ++KR + + +K N+ S +++P            +L +T  ++    R K+    E 
Sbjct: 50  ISYPDKKRGQAEADKQNQDSNVLVPLSLGSSSLAVLDILNDTLLEQKQTHRGKTGFHVEV 109

Query: 76  L-VKDQAKDCKVREQIQTEKSK---TNDSMLEQI 105
           + +  QA+  +VR +I+  KSK    +D +L  I
Sbjct: 110 ITICGQAEFEEVRGKIELLKSKYKENSDKILFHI 143

>NDAI0G01190 Chr7 complement(257644..260529) [2886 bp, 961 aa] {ON}
           Anc_3.444
          Length = 961

 Score = 27.7 bits (60), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113
           EP K      L  ++ ++D   D  V+E I  +++  N S L+QIE+ SG ++
Sbjct: 676 EPWKSGRFVDLLTKKSIEDDIADTIVKETITDDRTGVN-STLDQIELPSGVTI 727

>KLTH0B05126g Chr2 complement(423735..425168) [1434 bp, 477 aa] {ON}
           similar to uniprot|P53923 Saccharomyces cerevisiae
           YNL119W NCS2 Protein with a role in urmylation and in
           invasive and pseudohyphal growth inhibits replication of
           Brome mosaic virus in S. cerevisiae which is a model
           system for studying replication of positive- strand RNA
           viruses in their natural hosts
          Length = 477

 Score = 27.3 bits (59), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 38/78 (48%), Gaps = 17/78 (21%)

Query: 31  ERKRTKLQVEKLNKSSEIMIP-----------TLLRETATQEPTKKRAKSTLKAEELVKD 79
           ++K+T  + E+LN+ S I++P            +L +T T++    R K+  + + LV  
Sbjct: 57  DKKKTAEEAERLNQGSRILVPLSFGSSSIVMLDVLNDTLTEQREMHRGKTGFRIDVLV-- 114

Query: 80  QAKDCKVREQIQTEKSKT 97
               C +++ ++  K K 
Sbjct: 115 ----CYLKDDLEELKRKA 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.121    0.300 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,730,809
Number of extensions: 238381
Number of successful extensions: 1726
Number of sequences better than 10.0: 122
Number of HSP's gapped: 1710
Number of HSP's successfully gapped: 124
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)