Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.41.6ON31631614960.0
YCL059C (KRR1)1.6ON31631614600.0
Smik_3.151.6ON31631614530.0
Suva_3.1531.6ON31631614390.0
CAGL0B00352g1.6ON33731413260.0
NDAI0A001501.6ON31731413230.0
NCAS0B091001.6ON32731413220.0
SAKL0C00484g1.6ON33931413170.0
Kwal_33.130111.6ON33431113050.0
KNAG0C002301.6ON34931112931e-180
Kpol_2002.91.6ON33831412821e-178
KLTH0F00506g1.6ON33231412811e-178
Ecym_10091.6ON33631612771e-178
KLLA0C00506g1.6ON33032012731e-177
TDEL0C069601.6ON35031412691e-176
ZYRO0F18458g1.6ON31431512641e-176
TPHA0E040001.6ON31631412631e-176
KAFR0D001501.6ON34427212331e-171
TBLA0A049401.6ON31631412211e-169
AFR744W1.6ON34332212021e-166
SAKL0G03740g5.482ON266146970.001
ZYRO0D11440g5.482ON269168970.001
Suva_8.1975.482ON274148960.001
TDEL0A034605.482ON272146960.001
Kpol_543.135.482ON268146950.002
Ecym_45525.482ON271146950.002
Kwal_47.188645.482ON271146950.002
KLTH0G02574g5.482ON271146940.002
CAGL0K09460g5.482ON261146920.004
Skud_15.3105.482ON276148920.004
KLLA0C06446g5.482ON274146920.004
NCAS0A119605.482ON270146920.005
TPHA0J028205.482ON268146910.005
YOR145C (PNO1)5.482ON274148910.006
KAFR0E036005.482ON276146900.007
Smik_15.3265.482ON274148900.008
NDAI0A043105.482ON274146880.014
KNAG0C046105.482ON277146870.020
AAR002W1.420ON178163840.029
TBLA0D018905.482ON271163830.058
Suva_2.5945.523ON63186740.89
KAFR0B030308.309ON46754712.2
KLTH0E14014g8.798ON48699703.0
AGL183C8.309ON50724703.2
Ecym_35923.86ON90037685.6
KNAG0G023508.309ON49724676.1
TBLA0G001302.3ON527110676.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.4
         (316 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   580   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   566   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   564   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   558   0.0  
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   515   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   514   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   513   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   511   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   507   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   502   e-180
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   498   e-178
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   498   e-178
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   496   e-178
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   494   e-177
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   493   e-176
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   491   e-176
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   491   e-176
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   479   e-171
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   474   e-169
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   467   e-166
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    42   0.001
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    42   0.001
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    42   0.001
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    42   0.001
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    41   0.002
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    41   0.002
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    41   0.002
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    41   0.002
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    40   0.004
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    40   0.004
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    40   0.004
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    40   0.005
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    40   0.005
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    40   0.006
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    39   0.007
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    39   0.008
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    39   0.014
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    38   0.020
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    37   0.029
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    37   0.058
Suva_2.594 Chr2 (1054727..1056622) [1896 bp, 631 aa] {ON} YDR419...    33   0.89 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.2  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    32   3.0  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   3.2  
Ecym_3592 Chr3 complement(1121639..1124341) [2703 bp, 900 aa] {O...    31   5.6  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    30   6.1  
TBLA0G00130 Chr7 complement(13365..14948) [1584 bp, 527 aa] {ON}...    30   6.5  

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/316 (90%), Positives = 285/316 (90%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMF            I
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLN                  
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 301 XDFTAPEEESYKPSKN 316
            DFTAPEEESYKPSKN
Sbjct: 301 KDFTAPEEESYKPSKN 316

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/316 (87%), Positives = 282/316 (89%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNR+KPWDTDDIDKWKIEEFKEEDN SGQPFAEESSFMTLFPKYRE YLKTIWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMF            I
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKR+KQ+KKLN                  
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 301 XDFTAPEEESYKPSKN 316
            DF APEEE+YKP++N
Sbjct: 301 KDFIAPEEEAYKPNQN 316

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/316 (86%), Positives = 282/316 (89%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNR+KPWDTDDIDKWKIEEFKEEDN SGQPFAEESSFMTLFPKYRE YLKTIWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRPELANEDWSRFLPMF            I
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           RN+EKKVYTPFPPAQLPRKVDLEIESGEYFLSKR+KQ+KKL+                  
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 301 XDFTAPEEESYKPSKN 316
            DF APEEE+YKP++N
Sbjct: 301 KDFIAPEEETYKPNQN 316

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/316 (85%), Positives = 280/316 (88%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNR+KPWDTDD+DKW IEEFKEEDN SGQPFAEESSFMTLFPKYRE YLKTIWNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNI+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRPELANEDWSRFLPMF            I
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           RN+EKKVYTPFPPAQLPRKVDLEIESGEYFLSKR+KQ+KKLN                  
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 301 XDFTAPEEESYKPSKN 316
            +F AP+EE+YKP+ N
Sbjct: 301 KNFVAPQEEAYKPNNN 316

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/314 (78%), Positives = 270/314 (85%), Gaps = 1/314 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVST+N++KPWDT+DIDKWKIEEFK EDN SGQPFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KE+RRVV DCMKN+HPIYHIKELMIKRELAKRPELANEDWSRFLPMF            +
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           +  EKKVYTPFPPAQLPRKVDL+IESGEYFLSK++K++KKL+                  
Sbjct: 241 K-AEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299

Query: 301 XDFTAPEEESYKPS 314
            D+ AP+E+ YK S
Sbjct: 300 KDYIAPKEDEYKSS 313

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/314 (80%), Positives = 269/314 (85%), Gaps = 1/314 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNR+KPWDT++I+KWKIEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ HN+ACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKNIHPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKK- 239

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
              EKK+YTPFPPAQLPRKVDLEIESGEYFLSKR+K++KKLN                  
Sbjct: 240 VKKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERN 299

Query: 301 XDFTAPEEESYKPS 314
            D+ AP E +YK S
Sbjct: 300 KDYVAPSEPTYKSS 313

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/314 (79%), Positives = 269/314 (85%), Gaps = 1/314 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNR+KPWDT D+DKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHN+ CVLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKK- 239

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
              EKK+YTPFPPAQLPRKVDLEIESGEYFLSKR+K++KKL+                  
Sbjct: 240 VRKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERN 299

Query: 301 XDFTAPEEESYKPS 314
            ++ APEEE+YK S
Sbjct: 300 KNYIAPEEETYKSS 313

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/314 (79%), Positives = 267/314 (85%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           M STHN++KPWDT +IDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+IAC LDLVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           +  EKKVYTPFPPAQLPRKVDLEIESGEYFLSK++K+VKKL                   
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 301 XDFTAPEEESYKPS 314
            D+ APEE  YK +
Sbjct: 301 KDYVAPEEAEYKST 314

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/311 (78%), Positives = 264/311 (84%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           M STHN++KPWDT DIDKWKIEEFK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+I+CVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMF            I
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           ++ E KVYTPFPP Q PRKVDL+IESGEYFLSK++K+ KKL+                  
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 301 XDFTAPEEESY 311
            D+ AP E+ Y
Sbjct: 301 KDYVAPSEKEY 311

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  502 bits (1293), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 245/311 (78%), Positives = 264/311 (84%), Gaps = 1/311 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHN++KPWDTDDIDKW IEEFK EDN SGQPFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALD H+IAC LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KE+RRVVEDCM N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKK- 239

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
              EKKVYTPFPPAQLPRKVDLEIESGEYFL+K++KQ KKL                   
Sbjct: 240 IKKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERR 299

Query: 301 XDFTAPEEESY 311
            D+TAP+E++Y
Sbjct: 300 KDYTAPKEKAY 310

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  498 bits (1282), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 244/314 (77%), Positives = 264/314 (84%), Gaps = 1/314 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHN++KPWDT+DIDKWK+EEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDK +IAC LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KE+RRVVEDCMKN+HPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAK- 239

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
              EKKVYTPFPPAQ PRKVDLEIESGEYFLSK++K+VK+L                   
Sbjct: 240 PKKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERS 299

Query: 301 XDFTAPEEESYKPS 314
            D+ AP EE YK +
Sbjct: 300 KDYVAPMEEEYKST 313

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  498 bits (1281), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 247/314 (78%), Positives = 265/314 (84%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           M STHN++KPWDT DIDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHNIACVLDLVEGSMTVKTTR+TYDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAKRP+LA EDWSRFLPMF            I
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           +  E KVYTPFPPAQ PRK+DL+IESGEYFL+K++K+ KKL                   
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 301 XDFTAPEEESYKPS 314
            D+ AP E+ Y+ S
Sbjct: 301 KDYVAPIEKGYEGS 314

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  496 bits (1277), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 244/316 (77%), Positives = 268/316 (84%), Gaps = 2/316 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHN++KPWDT DIDKWKIEEFK EDN SG PFAEESSFMTLFPKYRE YLK+ WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH++AC L+LVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF--KKRNIARKKPK 238

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           +  EKKVYTPFPPAQLPRKVDLEIE+GEYFLSK +K++KKL                   
Sbjct: 239 KIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERA 298

Query: 301 XDFTAPEEESYKPSKN 316
            D+ AP+E+ YK + N
Sbjct: 299 EDYIAPDEKEYKNALN 314

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  494 bits (1273), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 243/320 (75%), Positives = 265/320 (82%), Gaps = 20/320 (6%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHN++KPWDTD++DKW IEEFK EDN SG PFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TR+LD H+IAC L+LVEGSMTVKTTRKTYDPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKRELAK+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKK----------- 229

Query: 241 RNVEK---------KVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXX 291
           RNV +         K+YTPFPPAQLPRKVDLEIESGEYFLSKR+K+VKKL+         
Sbjct: 230 RNVARKKPKKIKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAK 289

Query: 292 XXXXXXXXXXDFTAPEEESY 311
                     DF AP+E  Y
Sbjct: 290 HAEKESERAKDFIAPKETDY 309

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  493 bits (1269), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/314 (76%), Positives = 263/314 (83%), Gaps = 1/314 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNR+KPWDT+DIDKW++EEFK EDN SG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ H+IACVLDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVED M+N+HPIY IKELMIKRELAKRPELA EDWSRFLPMF            I
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           R  EKKVYTPFPPAQ PRK+DLEIESGEYFLSK++K++ KL                   
Sbjct: 241 R-AEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARS 299

Query: 301 XDFTAPEEESYKPS 314
            D+ AP+E+ YK S
Sbjct: 300 KDYIAPKEDVYKSS 313

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  491 bits (1264), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 261/315 (82%), Gaps = 1/315 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHN++KPWDT +IDKW  +EFKEEDN SG PFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+K+++ACVLDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVED MKNIHPIYHIKELMIKRELAKRPELANEDWSRFLP F            I
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
           R  EKKVYTPFPPAQ PRKVDLEIESGEYFL+KR+K+ KKL                   
Sbjct: 241 RK-EKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERR 299

Query: 301 XDFTAPEEESYKPSK 315
            DF  P+EE YK SK
Sbjct: 300 KDFLPPKEEDYKKSK 314

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  491 bits (1263), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/314 (76%), Positives = 264/314 (84%), Gaps = 1/314 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHN+EKPWDT+DIDKWK+E+FK EDN SG PF+EESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDKH++AC L+LV+GSMTV TTRKTYDP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KE+RRVVED M+N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKK- 239

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
              EKKVYTPFPP+QLPRKVDLEIESGEYFLSK++K+VK+L+                  
Sbjct: 240 PKREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERS 299

Query: 301 XDFTAPEEESYKPS 314
            ++ AP+EE Y  S
Sbjct: 300 KNYIAPKEEKYVSS 313

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  479 bits (1233), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/272 (85%), Positives = 248/272 (91%), Gaps = 1/272 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVST+N+EKPWDT+DIDKW+ EEFK EDN SG PFAEESSFMTLFPKYRE YLK++W DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+KH+IAC+LDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCM N+HPIYHIKELMIKRELAK+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKK- 239

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLS 272
              EKKVYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 240 IRKEKKVYTPFPPTQLPRKVDLEIESGEYFLS 271

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  474 bits (1221), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 240/314 (76%), Positives = 263/314 (83%), Gaps = 1/314 (0%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVSTHNR+KPWDT DI+KW+I+EFK EDN SG PF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T++LDK+++AC LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCMKN+HPIYHIKELMIKREL+KRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKK- 239

Query: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXXXXXXXXXXX 300
              EKKVYTPFPPAQLPRKVDLEIESGEYFLSK++K++KKL                   
Sbjct: 240 PKKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERR 299

Query: 301 XDFTAPEEESYKPS 314
            DF AP E+ YK S
Sbjct: 300 KDFIAPSEKEYKSS 313

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  467 bits (1202), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 238/322 (73%), Positives = 259/322 (80%), Gaps = 20/322 (6%)

Query: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60
           MVST N++KPWDT D+DKW IEEF  ED+ SG PFAEESSFMTLFPKYRE YLK+IW +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH+IAC L+LVEGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFXXXXXXXXXXXXI 240
           KEVRRVVEDCM+NIHPIYHIKELMIKRELAKRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKK----------- 229

Query: 241 RNVEK---------KVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNXXXXXXXXX 291
           RNV +         KVYTPFPPAQLPRKVDLEIE+GEYFLSK++K+ KKL          
Sbjct: 230 RNVARKKPKKIKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEK 289

Query: 292 XXXXXXXXXXDFTAPEEESYKP 313
                     D+ AP E  Y P
Sbjct: 290 QSEKEKERAKDYIAPAEPEYSP 311

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 75/168 (44%), Gaps = 5/168 (2%)

Query: 24  FKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTV 82
           F      SG+    ES  + + P +R   L+  W  +   L +H  +   ++L   S+ +
Sbjct: 76  FGSAKKSSGERVKIESRKVGV-PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVEL 134

Query: 83  KTT-RKTYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFV 139
           ++  R+T DP  + K  D IK          ++ +L+ DD+  +  ++ +  T N +   
Sbjct: 135 RSHPRQTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLS 194

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           +   R+ G +G T  A+E  T+  I++    +  +G F  ++  R  V
Sbjct: 195 RAIGRIAGKDGKTKFAIENATRTRIVLADAKIHILGGFTHIRMAREAV 242

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L+  W  +   L +H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  WN +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   LK  W+ +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVTNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 98  PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 157

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 158 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 217

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 218 TRIVLADTKIHILGGFTHIRMAREAV 243

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W+ +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R   L+  W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R   L+  W  +   L  H  +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 105 PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 164

Query: 104 LARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +  T + +   +   R+ G +G T  A+E  T+
Sbjct: 165 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 224

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 225 TRIVLADSKIHILGGFTHIRMARESV 250

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 66/163 (40%), Gaps = 35/163 (21%)

Query: 54  KTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQA 113
           + +W +V RAL +   A    L  GS +V            +  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSECTAALFPRLELGSGSV------------IAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPFKGLKEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPE 214
            + G +K L  +      CM  +  I HI ++  + + A+ P+
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ 133

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 70/163 (42%), Gaps = 4/163 (2%)

Query: 29  NGSGQPFAEESSFMTLFPKYREGYLKTIWNDVTRALDKH-NIACVLDLVEGSMTVKTTRK 87
           N S Q   +  S     P +R   L+  W  +   L  H  +   ++L   S+ ++T  K
Sbjct: 82  NKSKQTKVKLESRKVAVPPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPK 141

Query: 88  -TYDPAIILKARDLIKLLARSVPFPQAVKILQ-DDMACDVIKIGNFVT-NKERFVKRRQR 144
            T DP  + K  D IK          ++ +L+ DD+  +  ++ +  T   +   +   R
Sbjct: 142 HTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGR 201

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           + G +G T  A+E  T+  I++  + +  +G F  ++  R  +
Sbjct: 202 IAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESI 244

>Suva_2.594 Chr2 (1054727..1056622) [1896 bp, 631 aa] {ON} YDR419W
           (REAL)
          Length = 631

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 9/86 (10%)

Query: 46  PKYREGYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLA 105
           P++R+  L T W+DV  AL       V D ++ S+   T+        + K       LA
Sbjct: 224 PEHRD--LITDWDDVVLALGSQITKGVRDTIKDSLGYTTSCGVSSTKNVCK-------LA 274

Query: 106 RSVPFPQAVKILQDDMACDVIKIGNF 131
            +   P A  I+++D  CD +  G F
Sbjct: 275 SNYKKPDAQTIVKNDCLCDFLDCGKF 300

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIY 198
           L+GP GNTL+ L+  +KC I ++G      G  K  K    + E  M    P++
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLH 199

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        NIH
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKRPELANEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>Ecym_3592 Chr3 complement(1121639..1124341) [2703 bp, 900 aa] {ON}
           similar to Ashbya gossypii AFR341C
          Length = 900

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 33  QPFAEESSFMTLFPKYREGYLKTIWNDVTRALDKHNI 69
           Q +  ES F  +FP +R+ + KT   ++ ++L KHNI
Sbjct: 848 QDYQFESFFEIIFPIFRKYHQKTTQQEIKKSLLKHNI 884

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>TBLA0G00130 Chr7 complement(13365..14948) [1584 bp, 527 aa] {ON}
           Anc_2.3 YNL241C
          Length = 527

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 6/110 (5%)

Query: 23  EFKEED----NGSGQPFAEESSFMTLFPKYREGYLKTIWNDVTRALDKHNIACVLDLVEG 78
           EFKE       G+    A++ +F  LF  +REGYL +    +  A  K   A +   +E 
Sbjct: 10  EFKENTVIVIFGASGDLAKKKTFPALFGLFREGYLSSTTKIIGYARSKLTDAKLRANIEP 69

Query: 79  SMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKI 128
            + +       +P I+     L+K +  S P+      LQ     D  KI
Sbjct: 70  HLNITKESLARNPNIVNDFFQLVKYV--SGPYDTEEGFLQLKEEIDTFKI 117

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,061,536
Number of extensions: 1271778
Number of successful extensions: 3443
Number of sequences better than 10.0: 53
Number of HSP's gapped: 3518
Number of HSP's successfully gapped: 53
Length of query: 316
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 207
Effective length of database: 40,982,805
Effective search space: 8483440635
Effective search space used: 8483440635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)