Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.31.5ON1152115252080.0
Suva_3.1521.5ON1140115630680.0
Smik_3.141.5ON1113112329730.0
YCL061C (MRC1)1.5ON1096111428240.0
KAFR0D001401.5ON1041116911131e-133
NCAS0B091101.5ON10205067941e-88
NDAI0A001401.5ON10914887662e-84
SAKL0C00462g1.5ON11773907507e-82
KNAG0C002201.5ON11615167382e-80
Kpol_2002.81.5ON9854727181e-78
TPHA0E040101.5ON9655106801e-73
ZYRO0F18480g1.5ON9604796048e-64
CAGL0B00330g1.5ON11363775793e-60
TBLA0A075701.5ON12524825652e-58
TDEL0C069701.5ON9414735399e-56
Ecym_10081.5ON11183685232e-53
KLLA0C00484g1.5ON9253825183e-53
AFR745W1.5ON10183924865e-49
KLTH0F00484g1.5ON9933724704e-47
Kwal_33.130051.5ON9703613892e-37
Ecym_41528.415ON793135791.4
TDEL0G026002.330ON67485729.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.3
         (1152 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...  2010   0.0  
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...  1186   0.0  
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...  1149   0.0  
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...  1092   0.0  
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   433   e-133
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   310   1e-88
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   299   2e-84
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   293   7e-82
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   288   2e-80
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   281   1e-78
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   266   1e-73
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   237   8e-64
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   227   3e-60
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   222   2e-58
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   212   9e-56
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   206   2e-53
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   204   3e-53
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   191   5e-49
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   185   4e-47
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   154   2e-37
Ecym_4152 Chr4 (327931..330312) [2382 bp, 793 aa] {ON} similar t...    35   1.4  
TDEL0G02600 Chr7 complement(498005..500029) [2025 bp, 674 aa] {O...    32   9.3  

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score = 2010 bits (5208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1003/1152 (87%), Positives = 1003/1152 (87%)

Query: 1    MYMFEIFSILFWRIMKNANLKRVCSIVVDASSKTNLKTSKRVSHPILTGIIKFSTMDNVL 60
            MYMFEIFSILFWRIMKNANLKRVCSIVVDASSKTNLKTSKRVSHPILTGIIKFSTMDNVL
Sbjct: 1    MYMFEIFSILFWRIMKNANLKRVCSIVVDASSKTNLKTSKRVSHPILTGIIKFSTMDNVL 60

Query: 61   EVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNATLNRVK 120
            EVLSSLTSKKRVTTYKKIASPIP         LLSNNMGAPPALTGNGFLFGNATLNRVK
Sbjct: 61   EVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNATLNRVK 120

Query: 121  NRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGIAAFTQ 180
            NRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGIAAFTQ
Sbjct: 121  NRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGIAAFTQ 180

Query: 181  TQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPVATQRI 240
            TQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPVATQRI
Sbjct: 181  TQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPVATQRI 240

Query: 241  HSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTI 300
            HSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTI
Sbjct: 241  HSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTI 300

Query: 301  RMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHTLKIRELQSELALED 360
            RMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHTLKIRELQSELALED
Sbjct: 301  RMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHTLKIRELQSELALED 360

Query: 361  SKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEV 420
            SKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEV
Sbjct: 361  SKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEV 420

Query: 421  HENKPSEPNSVKNSRESYKNVPLLSSYANNLKREXXXXXXXXXXXXXXXXXXXXXYMGGN 480
            HENKPSEPNSVKNSRESYKNVPLLSSYANNLKRE                     YMGGN
Sbjct: 421  HENKPSEPNSVKNSRESYKNVPLLSSYANNLKREIDSSKCIILDLDSDSDDDGDDYMGGN 480

Query: 481  MSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRK 540
            MSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRK
Sbjct: 481  MSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRK 540

Query: 541  QILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQXXXXXXXXXXXXXXXXX 600
            QILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQ                 
Sbjct: 541  QILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQKEKEKEKLENKDSGSDS 600

Query: 601  XXXXXXXXXXDNEIANYELXXXXXXXXXXXXXXXXXXXXXXXXIVLNKKKSYHVKHVINE 660
                      DNEIANYEL                        IVLNKKKSYHVKHVINE
Sbjct: 601  GSESSKFEMSDNEIANYELSSSESEKNKNSDDEQEEEEEEEEDIVLNKKKSYHVKHVINE 660

Query: 661  SDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIK 720
            SDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIK
Sbjct: 661  SDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIK 720

Query: 721  THTXXXXXXXXXXXXXXXXXXXXAIRRELIDXXXXXXXXXXXXHVAELKEFKSKGITNFF 780
            THT                    AIRRELID            HVAELKEFKSKGITNFF
Sbjct: 721  THTIENREEEEVENDSIDEEVSEAIRRELIDKKKSQLRQKEKKHVAELKEFKSKGITNFF 780

Query: 781  XXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVK 840
                      WHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVK
Sbjct: 781  EMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVK 840

Query: 841  MINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLV 900
            MINRILYDIKNGGFRNKRAKN            VLQQY              IGDDTKLV
Sbjct: 841  MINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLV 900

Query: 901  KNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHR 960
            KNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHR
Sbjct: 901  KNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHR 960

Query: 961  RVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGDEGVEDLFTLKQHSS 1020
            RVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGDEGVEDLFTLKQHSS
Sbjct: 961  RVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGDEGVEDLFTLKQHSS 1020

Query: 1021 IKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDIN 1080
            IKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDIN
Sbjct: 1021 IKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDIN 1080

Query: 1081 DKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKS 1140
            DKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKS
Sbjct: 1081 DKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKS 1140

Query: 1141 KLFESGQDSFDS 1152
            KLFESGQDSFDS
Sbjct: 1141 KLFESGQDSFDS 1152

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1156 (57%), Positives = 779/1156 (67%), Gaps = 49/1156 (4%)

Query: 22   RVCSIVVDASSKTNL-KTSKRVSHPILTGIIKFSTMDNVLEVLSSLTSKKRVTTYKKIAS 80
            R+ +I+  AS  T + KTSK+  +PI T     STMD+ L  LSSLTSKKR TTYKK+AS
Sbjct: 9    RLLNIIFKASHVTIISKTSKQTYYPISTQHHILSTMDDALNALSSLTSKKRATTYKKVAS 68

Query: 81   PIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNATLNRVKNRLEGIDVPEDDRQIKDNEN 140
            PI          L  + M APPALTGNGFLFGNATLNRVKNRLEG +    D Q K+NE+
Sbjct: 69   PILDENYDTDGNLPIDGMNAPPALTGNGFLFGNATLNRVKNRLEGRNELGQDGQDKENED 128

Query: 141  EDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGIAAFTQTQRIPVSI-QSENVVDVPIH 199
            ED  STQLIANLYDGGE+LE +KS GD  + K  +++FTQTQRIPVSI Q  N ++VPIH
Sbjct: 129  EDVFSTQLIANLYDGGEELE-SKSNGDKNNQKVNVSSFTQTQRIPVSITQQNNEINVPIH 187

Query: 200  SINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPVATQRIHSRDTASQTQQVPFTKPIE 259
            SIN+G+  +  ++ G   T +QTQ I   TA+I    TQ +++    SQTQQ+P TKP E
Sbjct: 188  SINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQKTTQCLNNHGATSQTQQIPPTKPSE 247

Query: 260  PQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHDKYKTQLDT 319
             QTQ    TANDSDTQ  ++P+LT E S LFQT PD  P+               TQ++T
Sbjct: 248  AQTQADVATANDSDTQQ-KVPMLTTETSPLFQTVPDQSPS---------------TQMNT 291

Query: 320  MTQTAHDEGKTQVDTMPQTIHDDVSHTLKIRELQSELALEDSKREKARNVEYKKSRRNIP 379
               T HD+ +TQ+DT+ QT+ D V  TLKI ELQSELALED  R+KA+N EY+K ++ IP
Sbjct: 292  PPPTVHDD-RTQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIP 350

Query: 380  TMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRESYK 439
             +  FSKESFLADFDNSSSDE T+ +LE SQ KQQQ+  E+ +   S P   +   +  K
Sbjct: 351  IVKRFSKESFLADFDNSSSDEDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDK 410

Query: 440  NVPLLSSYANNLKREXXXXXXXXXXXXXXXXXXXXXYMGGNMSIKDESALPISRLSKAAI 499
             VPLLS+YANNLKRE                     +M  +   +DESALPIS+LSKA I
Sbjct: 411  KVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATI 470

Query: 500  LNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLED 559
             NLKARLSKQ+Q L Q  NKNK  K DHNKL N LRKASRKQILDHQRE++ETKGFKLED
Sbjct: 471  FNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLED 530

Query: 560  MAKEKEIVENLLEQEILRNRRIRQXXXXXXXXXXX-------XXXXXXXXXXXXXXXXDN 612
            M KEKEIVE+LLEQEILRN++IRQ                                  DN
Sbjct: 531  MVKEKEIVEDLLEQEILRNKKIRQKEKKKEELENNGFKLNSHDSDSDSGSESSKFALSDN 590

Query: 613  EIANYELXXXXXXXXXXXXXXXXXXXXXXXXIVLNKKKSYHVKHVINESDSEIETEQKMK 672
            EIA+YEL                         + NKKK Y  KH+++ESDSE+E EQKM+
Sbjct: 591  EIADYELSGSENEKGGDTDDGEEEDDN-----ITNKKKPYRTKHILDESDSEVEDEQKME 645

Query: 673  VSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIKTHTXXXXXXXXX 732
            V K  +  PKRNAIDLGHYG+NID + SNSF+ A  L+TQ++  I  +T T         
Sbjct: 646  VEKNVENVPKRNAIDLGHYGNNIDVDGSNSFQAAIVLDTQQVGEITTQTKTTEHEDDEGE 705

Query: 733  XXXXXXXXX---------------XXAIRRELIDXXXXXXXXXXXXHVAELKEFKSKGIT 777
                                      AIRRELID               +LKE KSKG+T
Sbjct: 706  EEKEETDDNDDDDDNDDDDNDDEVSEAIRRELIDREKSERRQKEKEQATKLKELKSKGVT 765

Query: 778  NFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEM 837
            NFF          WHGVGGADGEGS+EYDSEVEKMIDDYSKN FNSHEIREMLAAENKEM
Sbjct: 766  NFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEM 825

Query: 838  DVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDT 897
            DVKMIN+ILYDIKNGGFRNKRAKN            VLQQY              IGDDT
Sbjct: 826  DVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDT 885

Query: 898  KLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNN 957
            KLVKNPKSKAFFESMVEDIMEFKNPF AE+ES QD+TSTATDLDTQDND+ + GD+T NN
Sbjct: 886  KLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNN 945

Query: 958  EH-RRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGDEGVEDLFTLK 1016
            EH + V D+SKK IISEDFVQKSLSFL+SNNYDEFEMD+E ARIQH  G+  V DLFTLK
Sbjct: 946  EHNKHVGDKSKKLIISEDFVQKSLSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLK 1005

Query: 1017 QHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASR 1076
            QHSSIKSFTNS T+SLSS+ +N++I+LE+ TE N+E EN D SLIGGFKHPS+IKSFASR
Sbjct: 1006 QHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASR 1065

Query: 1077 TDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWK 1136
            TDINDKFKEGNKTVKISK+YKTVGSSKASITYMGKTRKLMAPK+K + +HH NH  K+ K
Sbjct: 1066 TDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKTEENHHPNHIKKS-K 1124

Query: 1137 TQKSKLFESGQDSFDS 1152
            TQKSKLFE+GQDSFDS
Sbjct: 1125 TQKSKLFENGQDSFDS 1140

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score = 1149 bits (2973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1123 (56%), Positives = 758/1123 (67%), Gaps = 36/1123 (3%)

Query: 56   MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
            MD+ L  LSSL SKKRVTTYKK+A  IP         L +N++ APPALTGNGFLF NAT
Sbjct: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 116  LNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGI 175
            LNRVKNRLEG   PE +   KD+E+ED  S+QLIANLY+GGEDLEETKS  ++ + K+ +
Sbjct: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120

Query: 176  AAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPV 235
              FTQTQRIPVSIQ + VVDVPIHS+N+ K  +II+DD F +   Q QK+  +T  I PV
Sbjct: 121  PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKL--STTTIKPV 178

Query: 236  ATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPD 295
            ATQRI S D  +Q+QQ    KPIE  +Q    T+ND D Q  + PVLT   S LFQ    
Sbjct: 179  ATQRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLT 238

Query: 296  CVPTIRMDPP---------------SQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIH 340
              P  +MD P                Q      KTQ+DT+ QT H E KTQ+DTM QT+ 
Sbjct: 239  RGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQ 298

Query: 341  DDVSHTLKIRELQSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDE 400
            D V HTLKIRE+Q+ELALEDS+RE+A NVEY K ++ I T + FSKESFLADFD+SSS+E
Sbjct: 299  DGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSNE 358

Query: 401  GTDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREXXXXXX 460
              ++++E +  K   ++ E+HE+K  EP+  + ++++ K VPLLSSYANNLKRE      
Sbjct: 359  DAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSKC 418

Query: 461  XXXXXXXXXXXXXXXYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKN 520
                            +     IKDE ALPIS+LSKA ILNLKARLSKQ+Q+++Q P + 
Sbjct: 419  ITLDLDSGSDDDDNIVVDDRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLEG 478

Query: 521  KGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRR 580
            + A++DHNKLFN LRKASRKQILDHQREVIETKGFKLEDM KEKE+VENLLEQEI+RN++
Sbjct: 479  RDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMVKEKELVENLLEQEIIRNKK 538

Query: 581  IRQXXXXXXXXXXXX-------XXXXXXXXXXXXXXXDNEIANYELXXXXXXXXXXXXXX 633
            IRQ                                   NE+ +YEL              
Sbjct: 539  IRQKEKRREKLENSEFKLSPHDSGSDSGSESSKFALSGNEVTDYELSGSEDEIREEPDNE 598

Query: 634  XXXXXXXXXXIVLNKKKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGD 693
                      IV  KKK++HVK +I+ESDSE E   K KV     + PKR AI+LGHYGD
Sbjct: 599  EEEEEDD---IVPKKKKAHHVKRMIDESDSENEAVPKEKVDA---SVPKRIAINLGHYGD 652

Query: 694  NIDEEASNSFEEATTLNTQKIDNIIIKTHTXXXXX----XXXXXXXXXXXXXXXAIRREL 749
            NI+EE  N F+E   +NTQ+ D I ++ +                         AIRREL
Sbjct: 653  NIEEEV-NKFQETNDMNTQQTDKITMERNIVENKAILEDTAVVDEDNINEEADEAIRREL 711

Query: 750  IDXXXXXXXXXXXXHVAELKEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEV 809
            ID               +LKE K KG+TNFF          WHG+GGADGEGS+EYDS+V
Sbjct: 712  IDKEKLQLRQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDV 771

Query: 810  EKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXX 869
            EKMIDDYSKN+FNSHEIREMLAAENKEMDVKMIN+ILYDIKNGGFRNKRAKN        
Sbjct: 772  EKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSD 831

Query: 870  XXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEES 929
                VLQQY              IGD TKLVKNPKSKAFFESMVEDIME+KNPF+AEEES
Sbjct: 832  DEDDVLQQYRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEES 891

Query: 930  HQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYD 989
            +QD+TSTATDLDT DN+S+ + DSTRNNE   VDD+SKK IISEDFVQKSLSFL+SNNY+
Sbjct: 892  NQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYN 951

Query: 990  EFEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTED 1049
            EFEMDKE A++QH   DE +EDLFTLKQHSSIKSFTNS TDS +S+ V +MIDLE+ TED
Sbjct: 952  EFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTED 1011

Query: 1050 NNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYM 1109
             +E+EN D SL+ GFKHPSI+KSFASRTDINDKFKEGNKTVKISK+YK VGSSKASITYM
Sbjct: 1012 EDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYM 1071

Query: 1110 GKTRKLMAPKKKADRDHHHNHHSKAWKTQKSKLFESGQDSFDS 1152
            GKTRKLMAPK+KA  D +H+ H    KT+ SKLFESGQ+SFDS
Sbjct: 1072 GKTRKLMAPKRKAGTDQNHHRHK-KTKTKTSKLFESGQNSFDS 1113

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score = 1092 bits (2824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1114 (56%), Positives = 753/1114 (67%), Gaps = 35/1114 (3%)

Query: 56   MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
            MD+ L  LSSLT+KKR TTYKK+A PI             N++  PP LTGNGFLF NAT
Sbjct: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNG-PNDIDNPPELTGNGFLFANAT 59

Query: 116  LNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGI 175
            LNRVKNRLEG   PE +     + +E+++ TQLI+NLYDGGE+LE+++   ++ S K+  
Sbjct: 60   LNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVS 119

Query: 176  AAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPV 235
            ++FTQTQRIPVSIQ + V +VPIHS+N GK  ++I++DG  +  +Q  K    T R  P 
Sbjct: 120  SSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGR--PG 177

Query: 236  ATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAE---ASLLFQT 292
            ATQRI S    SQTQ +   K IEPQ+QII T++N S+    +IP++  E    S LFQ+
Sbjct: 178  ATQRIDSSGATSQTQPI---KSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQS 234

Query: 293  TPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHTLKIREL 352
              +  P  +MD P Q  HD+ KTQ   + Q  H E KTQ+DT+ QT+ D+V HTLKIRE+
Sbjct: 235  IQNRGPDTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHTLKIREI 294

Query: 353  QSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLK 412
            QSELA EDSKREKARNVEYKK ++ IPT   FSKESFLADFD+SSS+E  D++LE +  K
Sbjct: 295  QSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSNEDDDIKLENAHPK 354

Query: 413  QQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREXXXXXXXXXXXXXXXXXX 472
              Q+D+E+HENK  E N    +R + K VPLLSSYANNLKRE                  
Sbjct: 355  PVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLDLDSDSDEY 414

Query: 473  XXXYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFN 532
                M      KDES LPIS+LSKA ILNLKARLSKQ+Q L+Q PNK+K  KVDHN L N
Sbjct: 415  GDDDMDSIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLN 474

Query: 533  ILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQXXXXXXXXX 592
             LRKASRKQILDHQ+EVIETKG KLEDMAKEKEIVENLLEQEILRN+RIRQ         
Sbjct: 475  TLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNKRIRQKEKRREKLE 534

Query: 593  XXXXXXXXXXXXXXXXX-------XDNEIANYELXXXXXXXXXXXXXXXXXXXXXXXXIV 645
                                      NEIA+YE                         I+
Sbjct: 535  ENDFQLNAHDSGSDSGSESSGFALSGNEIADYE-----SSGSENDNRRESDSEKEDDEII 589

Query: 646  LNKKKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEE 705
            L +KKS+HVKH+INESDS+ E E K K  K  ++ PKR AI+LGHYGDNI E+ ++ F+E
Sbjct: 590  LKQKKSHHVKHIINESDSDTEVEAKPK-EKADESLPKRIAINLGHYGDNIGED-TDKFQE 647

Query: 706  ATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXXXXXXXXAIRRELIDXXXXXXXXXXXXHV 765
               L+TQ I+ ++ + +T                    AIRR+LID            H 
Sbjct: 648  TNVLDTQNIEEVMAERNTIENEVKDDVYVNEEADE---AIRRQLIDKEKLQLKQKEKEHE 704

Query: 766  AELKEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHE 825
            A++KE K +G+TNFF          WHG+GGADGEGS++YDS++EKMIDDYSKN+FN HE
Sbjct: 705  AKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHE 764

Query: 826  IREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXX-VLQQYXXXXXX 884
            IREMLAAENKEMD+KMIN+ILYDIKNGGFRNKRAKN             VLQQY      
Sbjct: 765  IREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRE 824

Query: 885  XXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQD 944
                    IGDD KLVKNPKS AFFESMVEDI+E+KNPF AEEE + D+TSTATDLDTQD
Sbjct: 825  LMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQD 884

Query: 945  NDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDI 1004
            N SI +GD+T NNE + VD ++KK IISEDFVQKSLSFL+SNNY++FE DKE +RIQH  
Sbjct: 885  N-SINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYEDFETDKELSRIQHG- 942

Query: 1005 GDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGF 1064
             DE +EDL+TLKQ+SSIKSFTNS TDS +SK VN++IDLE+  ED +EVEN D SL+G F
Sbjct: 943  NDEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVF 1002

Query: 1065 KHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADR 1124
            KHPSIIKSFASRTDINDKFKEGNKTVKI K+YKTVGSSKASITYMGKTRKL+APK+K + 
Sbjct: 1003 KHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLIAPKRKTEG 1062

Query: 1125 DH--HHNHHSKAWKTQK----SKLFESGQDSFDS 1152
             H  HH+HH+K  K +     +KLFESGQDSFD+
Sbjct: 1063 SHRYHHDHHNKKMKMKTKTKSNKLFESGQDSFDN 1096

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  433 bits (1113), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 393/1169 (33%), Positives = 567/1169 (48%), Gaps = 200/1169 (17%)

Query: 56   MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
            MD +   L +L  KKR TTYKKI+  +            SNN   PPALTG GFLF N T
Sbjct: 1    MDGIFGNLQALKPKKR-TTYKKISDDLENDTSE------SNN--DPPALTGEGFLFDNPT 51

Query: 116  LNRVKNRLEGIDVPEDDRQIKDNENEDAVS-------TQLIANLYDGGEDL--------- 159
            LNR+K RL+G             E +D V        TQLI+NLY GGEDL         
Sbjct: 52   LNRIKKRLDG-------------EEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRE 98

Query: 160  -----EETKSMGDNASLKDGIAAFTQTQRIPVSIQSENVVDV----PIHSINQGKSARII 210
                 E+   +    + K  + AFT++        S N+ D+    P   I   + A+  
Sbjct: 99   KQQLHEQQLELTKKRASKGQLHAFTKS--------SGNINDLRLMQPTQVIGSTQLAKE- 149

Query: 211  RDDGFFSTAAQTQ-KIIP---ATARIIPVATQR----IHSRDTASQTQQVPFTKPIEPQT 262
                 FS  ++T  K +P    + ++I  ATQ     + +R+  +Q  Q+  T+ +   T
Sbjct: 150  -----FSPVSRTYFKYVPDVNQSTQVIHSATQDDTQVVSAREADTQATQM--TQVLSAST 202

Query: 263  QIIGTTANDSDTQPLRIPVLTAEASLLFQT-------TPDCVPTIRMDPPSQIEHDKYKT 315
            Q I  T           P+  + ++  ++T       TP+    I    P + + D    
Sbjct: 203  QGIYNTQETQSITDSTQPISYSSSTQDYKTNKFNRHPTPEDTQII----PREFDDDASTL 258

Query: 316  QLDTMTQTAHDEG---KTQVDTMPQ--TIHDDVSHTLKIRELQSELALEDSKREKARNVE 370
             +    +T  D     KTQ+D+  +  +    VS TLKI E+Q EL  E+S++ K    E
Sbjct: 259  PIPEGDKTQKDTSAVLKTQIDSTTEGTSYSATVSDTLKIHEIQREL--EESQKTKTI-PE 315

Query: 371  YKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEVHENKPSE--- 427
            YK+  R    +I F+KES+  +FD+   ++  +++ E    K Q   N    +K ++   
Sbjct: 316  YKQHVRTPKNVIVFTKESYFDEFDSDDEEKEENLESEGDSQKVQLLKNTSPSDKSNDGKR 375

Query: 428  -PNSVKNSRESYKNVPLLSSYANNLKREXXXXXXXXXXXXXXXXXXXXXYMGGNMSIKDE 486
             P+  + S      +  L++Y   LKR+                      +  N+   DE
Sbjct: 376  LPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQ----------------IDLNLDSDDE 419

Query: 487  SAL-------PISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASR 539
              +       PIS++SKA + ++KARLSK+ + + ++ N    +K   + LFN L+KASR
Sbjct: 420  DGIDRMGEKGPISQMSKATVFDIKARLSKK-RPIVKISN---DSKTTLHTLFNKLQKASR 475

Query: 540  KQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQXXXXXXXXXXXXXXXX 599
            +QI++HQ+EVIE KG  LED+ KEK+IVENLLEQEI RN++IRQ                
Sbjct: 476  QQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQLADAQDDE 535

Query: 600  XXXXXXXXXXXDNEIANYELXXXXXXXXXXXXXXXXXXXXXXXXIVLNKKKSYHVKHVIN 659
                        NE+   EL                          L K K    K ++ 
Sbjct: 536  NDLDFDHSA---NELDESELSGEESAIDSDNDYDD---------FSLEKTKRSKKKVIVE 583

Query: 660  ESDSEIETEQ-----KMKVSKKFDATPKRNAIDLGHYGDNI---------DEEASNSFEE 705
            +SD+EIE E+     +++  K       RNAI+LG YGDN+         ++++  +F+ 
Sbjct: 584  DSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPYGDNLSLAPIRITTEKQSGKNFKV 643

Query: 706  ATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXXXXXXXXAIRRELIDXXXXXXXXXXXXHV 765
            +     ++ + I  K                         R  LI+             +
Sbjct: 644  SRESGDERDEEIPEKD------------------------RIRLIEEKKQHELERQRKQM 679

Query: 766  AELKEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHE 825
             + KE K+KGITNF           WHG+GG DGE S+EYDSEVEKMIDDYSK +FN  E
Sbjct: 680  KKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDE 739

Query: 826  IREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXX 885
            IR+MLA ENKE D+KM+ +ILYDIKNGGFR KR K              L+QY       
Sbjct: 740  IRQMLADENKETDIKMVEKILYDIKNGGFR-KRRKGAMDLELSDEEDDELKQYRLKRREL 798

Query: 886  XXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDN 945
                   +G+   LVKNPKSKAFFESMV+DI+E KNPF   E   Q   +  TD  TQ+N
Sbjct: 799  MRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFE--PQRSGTITTDDGTQEN 856

Query: 946  DSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEFEMDKERARIQHDI 1004
             +   G +++N         SKK ++SE+FVQ++LSFL S+ + D+F   +    ++ + 
Sbjct: 857  ANSNEGAASQNP--------SKKVMLSEEFVQRTLSFLNSSKDMDQFAPARS---MRAEA 905

Query: 1005 GDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENE-DPSLIGG 1063
             DE +EDL  LK+ SSIKSF  +   S+S          ++PT+ + E ++  D  L   
Sbjct: 906  NDELIEDLTALKKQSSIKSFKTTRA-SVS----------QEPTDFDKENDDSFDDLLNSR 954

Query: 1064 FKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKAD 1123
                SI+K+F++  DINDKF+EG KTVK+SK YK+V SSKASITYMGK RKL+AP+KK  
Sbjct: 955  VGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKV- 1013

Query: 1124 RDHHHNHHSKAWKTQKSKLFESGQDSFDS 1152
              +  +   K   ++ SKLF    +SF+S
Sbjct: 1014 -ANLSSSDIKNTNSRTSKLFSRQDESFES 1041

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  310 bits (794), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 216/506 (42%), Positives = 272/506 (53%), Gaps = 68/506 (13%)

Query: 649  KKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATT 708
            +K  H   +I ESD E E               K N IDLG YG N+D            
Sbjct: 580  RKEKHPVRIIQESDDENEIN-------------KINTIDLGVYGGNLDN--------PNP 618

Query: 709  LNTQKIDNIIIKTHTXXXXXXXXXXXXXXXXXXXXAIRRELIDXXXXXXXXXXXXHVAEL 768
            L++Q          T                      R  LI             + A  
Sbjct: 619  LSSQ----------TEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLIEKKNAART 668

Query: 769  KEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIRE 828
            KE K KG+   F          WHG+GGADGE S+EYDSEVEKMIDDYSK++FN  EIR+
Sbjct: 669  KEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQ 728

Query: 829  MLAAENKEMDVKMINRILYDIKN-GGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXX 887
            MLA ENKEMD+ MI +ILYDIKN G  + +R                L++Y         
Sbjct: 729  MLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMK 788

Query: 888  XXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDS 947
                 IGDD KL+KNPKSKAFFESMVEDI++ KN F   E     +  ++T+LDTQ+   
Sbjct: 789  KRMLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE----SIEKSSTELDTQEEKE 844

Query: 948  IQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEFEMDKERARIQHDIGD 1006
              +           VD   KK +ISE+FVQK+LSFLRS  + +EF ++++ A+ QH    
Sbjct: 845  QDVTPG--------VD--KKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQH---G 891

Query: 1007 EGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKH 1066
            E VEDLF+LKQ S+IK F N P+ +       + IDL       N VEN + S +GGFK 
Sbjct: 892  ENVEDLFSLKQRSTIKEFRN-PSQT-------NTIDL------INNVENVESSPLGGFKP 937

Query: 1067 PSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDH 1126
            PS+IKSF+SRTDIN+KFK+GNKTV ISK YKTVGSSKASITY+GK+RKLM PKK  +R+ 
Sbjct: 938  PSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNRE- 996

Query: 1127 HHNHHSKAWKTQKSKLFESGQDSFDS 1152
                     K  +S LF S  +SF++
Sbjct: 997  ---KIGSKIKPTRSSLFSSHDESFEN 1019

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (74%), Gaps = 7/95 (7%)

Query: 489 LPISRLSKAAILNLKARLSKQSQNLTQMPNK-NKGAKVDHNKLFNILRKASRKQILDHQR 547
            PISR SKA +LNLKARLSK+       P K NK      + LF  L++ASRKQILDHQR
Sbjct: 395 FPISRTSKATLLNLKARLSKKK------PVKSNKSTNTSLDVLFQNLKQASRKQILDHQR 448

Query: 548 EVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIR 582
           E++E +GFKLED+ KEKEIVENLLE+EI RN+RIR
Sbjct: 449 ELVENRGFKLEDIEKEKEIVENLLEEEIKRNKRIR 483

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 103/371 (27%), Positives = 170/371 (45%), Gaps = 58/371 (15%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
           M+++ E  S L  K+R TTYKKI    P          +  ++ APP + GNGF+FGNA 
Sbjct: 1   MESIFEEFS-LPKKQRKTTYKKIHEE-PNNDEEALTEAV--DVMAPPVI-GNGFIFGNAL 55

Query: 116 LNRVKNRLEGIDVPEDDRQIKDNENEDAV--STQLIANLYDGGEDLEETKSMGDNASLKD 173
           +++++NRL+G          K+N+ +  V   TQ+I NLY   E+LEE     +  ++ +
Sbjct: 56  IDKIRNRLDG----------KENKEDTPVPTQTQMIDNLYKDAEELEEETIEYEKEAI-N 104

Query: 174 GIAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFF---STAAQTQKIIPATA 230
                 QTQ I  + + E + ++   S    +  + I +  F    +   +TQ+    T 
Sbjct: 105 KEQEVVQTQLI--AKEKEEIENIKNPSDAYLQETQPIEEKSFLLGTNKELETQE----TQ 158

Query: 231 RIIPVATQRIHSRDTASQTQQVP--FTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASL 288
            I PV ++   S + +S  +++P  FT+ I+   + +   + D          L+ + ++
Sbjct: 159 VINPVLSESQPSENRSS-NEKIPFTFTQKIQDFVETVENYSTDLS--------LSKDETI 209

Query: 289 LFQTTPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHD------- 341
                             +I  +  +T  D  TQ  ++   T +D +  T+ D       
Sbjct: 210 TINLPNHATDNSTSKRAHRISQELQRTMTDMDTQVINN---TNLDVIEATMADLPNLNEP 266

Query: 342 -----DVSHT-LKIRELQSELALEDSKREKARNVEYKKSRRNIPTM-INFSKESFLADFD 394
                D+  T LKI E+Q EL  E + +E     EYKK  + I  + I FSK S L  FD
Sbjct: 267 QSTVADIPSTGLKIHEIQKELERERNSKELK---EYKKPSKEIKVIPIKFSKTSLLDGFD 323

Query: 395 NSSSDEGTDVQ 405
           NSSSD+  +VQ
Sbjct: 324 NSSSDDELEVQ 334

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  299 bits (766), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 213/488 (43%), Positives = 275/488 (56%), Gaps = 54/488 (11%)

Query: 678  DATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXX 737
            D   KRNAIDLG YGDN+           TT N        +K+                
Sbjct: 643  DTISKRNAIDLGAYGDNL-----------TTAN--------VKSQDDDDLEVDDDKNENL 683

Query: 738  XXXXXXAIRRELIDXXXXXXXXXXXXHVA---ELKEFKSKGITNFFXXXXXXXXXXWHGV 794
                     +E ID                  + KE   KG+T FF          WHG+
Sbjct: 684  DTQPLELTEQERIDIIEAEKTKIKMQQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGI 743

Query: 795  GGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGF 854
            GG DGE S+EYDS+VEKMIDDYSK +F+ +EIREMLAAENKEMD+ MIN+ILYDIKNGGF
Sbjct: 744  GGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIKNGGF 803

Query: 855  RNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDD-TKLVKNPKSKAFFESMV 913
            R ++                L++Y              +GDD  KLVKNPKSKAFFESMV
Sbjct: 804  RKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMV 863

Query: 914  EDIMEFKNPFKAE---EESHQDLTSTATDLDTQDNDSI-QIGDSTRNNEHRRVDDRSKKT 969
            EDI + KN F  E   E S Q++ +T  D+  +D   + + GDS R         + KKT
Sbjct: 864  EDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKENGDSKRI--------KKKKT 915

Query: 970  IISEDFVQKSLSFLRSNNYD-EFEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSP 1028
            IISE+FVQ++LSFL+S+  D EF M++  A+ QH      VE+L +LKQ SSIK F  SP
Sbjct: 916  IISEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGT---KVENLLSLKQQSSIKVF-QSP 971

Query: 1029 TDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNK 1088
            +++ SSK    +I L+       + ++++ S I  FK PSI+KSF S+TDIN+KF++GNK
Sbjct: 972  SNN-SSK----VIKLDDINN---DDDDDEDSPIALFKVPSILKSFGSKTDINEKFQDGNK 1023

Query: 1089 TVKISKTYKTVGSSKASITYMGKTRKLMAP-----KKKADRDHHHNHHSKAWKTQKSKLF 1143
            TV ISK+Y+TVGSSKASITY+GK+RKLMAP     K    R   +N  +K  +   S LF
Sbjct: 1024 TVTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNNKITKGERNIGS-LF 1082

Query: 1144 ESGQDSFD 1151
             +G DSF+
Sbjct: 1083 STGDDSFE 1090

 Score =  148 bits (373), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 180/586 (30%), Positives = 264/586 (45%), Gaps = 108/586 (18%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASP-IPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNA 114
           MD++++ L  +T  ++ T  KK   P I           +++     P + G GFLF N+
Sbjct: 1   MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTILGTGFLFKNS 60

Query: 115 TLNRVKNRLEGIDVPEDDRQ-IKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKD 173
           T+++V+ RL G +  E ++  +  +E E    TQ+I NLY  GEDLE           KD
Sbjct: 61  TIDKVRARLSGKNYIEQEKTPLASSEQE----TQIITNLYTNGEDLE-----------KD 105

Query: 174 GIAAFTQTQRIPVS-----IQSENVVDVPIHSINQGKSARII----RDDGFFSTAAQTQK 224
            I     +Q  P++      Q E  + V I + +     ++I    RDD    TA +TQ 
Sbjct: 106 LIKHIPVSQTQPITNTGERTQLEQEIKVTIDNDSNEMPTQVIGSTERDD---ETAERTQ- 161

Query: 225 IIPATARIIP-----------------VATQRI--HSRDTASQTQ-------QVPFT--- 255
           I     ++IP                 + TQRI  +SRD  +QT         VPFT   
Sbjct: 162 IGEVATQLIPGDTYDRTSTMQKTQEQLLKTQRIPQNSRDNHNQTNIINESFGSVPFTFTQ 221

Query: 256 KPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHDKYKT 315
           K    +T I  T  ND  T        +   ++L  T  D V    +D  S +       
Sbjct: 222 KIKNFETNI--TNENDDFTNG------SKSQTVLISTNVDNVRAEYVDASSSL------L 267

Query: 316 QLDTMTQTAHDEGKTQVDTMPQTIHDD---VSHTLKIRELQSELALEDSKREKARNVEYK 372
           Q   +  T  D+G +    +  T+ DD       L I + Q EL  E+     ++  EYK
Sbjct: 268 QATAIAATVRDDGPSST-ALVGTVADDKLSSGSNLAIHKFQKELEEEEQLANNSKYKEYK 326

Query: 373 KSRRNIPT-MINFSKESFLADFDNSSSDE----GTDVQLEKSQLKQQ--------QDDNE 419
              + I T ++ F+K+SFL  FDNSSS      G  V+  K   K+         +++N 
Sbjct: 327 GISKPILTNIVKFTKDSFLQGFDNSSSSSSEEEGDKVKETKRNGKENTSSNSYSTKNNNS 386

Query: 420 VHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREXXXXXXXXXXXXXXXXXXXXXYMGG 479
              +  +       S + +  +  LS Y N LK                        +G 
Sbjct: 387 TASSDGTTIKPKIKSPKKFSKLNTLSRYENKLK--------------TVLNSKNQLQLGS 432

Query: 480 NMSIKD--ESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKA 537
           +    D  E++LP+SR SKA IL +KARLSKQ     +   K+     + NKLF  L+K+
Sbjct: 433 DDESSDDTENSLPVSRTSKATILTIKARLSKQKSK--KNVQKDGTVNTNLNKLFENLKKS 490

Query: 538 SRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQ 583
           SRKQIL++QRE+IE KG   ED+  EKE+VENLLEQEI RN++IRQ
Sbjct: 491 SRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKRNQKIRQ 536

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  293 bits (750), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 177/390 (45%), Positives = 237/390 (60%), Gaps = 26/390 (6%)

Query: 769  KEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIRE 828
            KE K KG++  F          WHGVGGADGE S+EYDSE+EKM+DDY+K +F+  EIR+
Sbjct: 808  KEMKRKGVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQ 867

Query: 829  MLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXX 888
            MLAAE+KE D K++N+IL+DIKNGGFR +R K              LQ+Y          
Sbjct: 868  MLAAEDKEYDEKIVNKILHDIKNGGFR-RRGKGALDIELSDDEDDELQRYHAKRRELLRQ 926

Query: 889  XXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSI 948
                 G+ +KLV NPKS AFFESMVED++E KNPF   E +  D +   ++ D  DN S 
Sbjct: 927  KVLENGEASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPD-SGAISENDKVDNASE 985

Query: 949  QIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNY--DEFEMDKERARIQHD-IG 1005
                     +  R +   K+  IS++FVQ+SLSFL S +   +EFE+D+  A+ QH  +G
Sbjct: 986  HGTQPDAGGQPVRTE--RKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLG 1043

Query: 1006 DEG--VEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGG 1063
            D+   +EDLFTLKQ+S IK+     T + +S R    +DL        EV+   P+   G
Sbjct: 1044 DDNDDLEDLFTLKQNSCIKTLH---TPARTSSRT---VDL--------EVDGNSPA--NG 1087

Query: 1064 FKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKK-A 1122
            FK PS+I SF+SR DIN+KFKEG KTVK+SK+YKT+G S+ASITY+GK RKL APK+K +
Sbjct: 1088 FKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKES 1147

Query: 1123 DRDHHHNHHSKAWKTQKSKLFESGQDSFDS 1152
             R     H       +++ LF    DSF++
Sbjct: 1148 GRKPVFGHRHPEAAPKRAGLFADNDDSFEA 1177

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 76/103 (73%), Gaps = 4/103 (3%)

Query: 482 SIKDESALPISRLSKAAILNLKARLSKQS--QNLTQMPNKNKGAKVDHNKLFNILRKASR 539
           S +DE+++P S++SKAA+L +KAR SK+   +   Q P+  +   +   +LF+ L+KA++
Sbjct: 435 SDEDENSVPASKMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSL--KELFSSLKKANK 492

Query: 540 KQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIR 582
           KQILDH+RE+ E +G  LED+ +EK+ VENLLEQEI RNR+IR
Sbjct: 493 KQILDHRREITEKRGLNLEDIEREKKEVENLLEQEIERNRKIR 535

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 94/327 (28%), Positives = 143/327 (43%), Gaps = 63/327 (19%)

Query: 102 PALTGNGFLFGNATL-NRVKNRLEGIDVPEDDRQIKDNENEDAV-STQLIANLYDGGEDL 159
           P L+   FLFGN+T+ ++VK+RL G+   E      D E  DA+  TQ+I N YDG EDL
Sbjct: 40  PQLSSASFLFGNSTIVDKVKSRLNGVSNEE-----TDGERGDALPQTQVIPNYYDG-EDL 93

Query: 160 EE-------TKSMGDNASLKDG-IAAFTQTQRIPV----SIQSENV-VDVPIH------- 199
           E+        + + +    +D    +  QTQ +P     + +S+ V V  P+        
Sbjct: 94  EQDFVSPPKPRRVSNTGHGQDCDCDSEEQTQLMPTQETGAYESQVVPVIAPVQVSETIPV 153

Query: 200 SINQG--------KSARIIRDDGFFSTAAQTQKIIPATARIIPVATQRIHSRDTASQTQQ 251
           SIN G         S   ++ +G  +T    +     T +IIP + Q  +S+    +TQ+
Sbjct: 154 SINDGLLGESLFKTSKDEVKGNGGNTTRNLAEPCYGLT-QIIP-SPQYKNSQQMQLETQE 211

Query: 252 VPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHD 311
              T+ ++   +I+  TA D        P L+ E   +  T  D    +           
Sbjct: 212 AGETQEVDKTQRILEATARD--------PTLSEE-DFVAATVADGSEAV----------- 251

Query: 312 KYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHTLKIRELQSELALEDSKREKARNVEY 371
              TQLDT        G  Q     Q+ H + S  L I E++ +L  E+ +REK R  E 
Sbjct: 252 --TTQLDTCVPDTSALGDVQPTAPDQSAHRN-SQRLLIHEIEKDLDAEE-EREK-RITEA 306

Query: 372 KKSRRNIPTMINFSKESFLADFDNSSS 398
           K     +     F KE+FL +FD SSS
Sbjct: 307 KPHDVVLVVKKKFDKEAFLNNFDCSSS 333

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  288 bits (738), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 204/516 (39%), Positives = 279/516 (54%), Gaps = 63/516 (12%)

Query: 645  VLNKKKSYHVKHVINESDSEIET--EQKMKVSKKFDATPKR-----NAIDLGHYGDNIDE 697
            VL  KK  +++ +  ESDSE ET      +V+   ++ P       NAIDLG YG+N++ 
Sbjct: 701  VLKGKKRKNMQ-IQPESDSEEETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEI 759

Query: 698  EASNSFEEATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXXXXXXXXAIRRELIDXXXXXX 757
             A  +       NT+K+D   +                         ++R          
Sbjct: 760  RAELN-------NTEKLDTKCMLDEKEHARAVDKERLKTIMKEKKLMLKR---------- 802

Query: 758  XXXXXXHVAELKEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYS 817
                    AELKE   KG++NFF          WHG+GG DGE S+EYDSEVEKMIDDYS
Sbjct: 803  --------AELKE---KGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYS 851

Query: 818  KNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQ 877
            +   +  EIR++L +ENKEMDVKM+N+IL+DIKNG FR KR ++             L+Q
Sbjct: 852  RADMDPEEIRKLLVSENKEMDVKMVNKILFDIKNGNFR-KRGRDTLELELSDEEDDDLRQ 910

Query: 878  YXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTA 937
            Y              +GDD KLVKN K+KAFF+S+VEDI+E KNPF    ++    T   
Sbjct: 911  YRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDET 970

Query: 938  TDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEFEMDKE 996
            T +DTQ  +S+       N E +   ++ KKT++SE+FVQ+SLSFL SN N  EFE +++
Sbjct: 971  TTIDTQTRESVS------NKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQD 1024

Query: 997  RARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENE 1056
             AR+QH   D+ V DL+TLK+ SS+KSF      S+ SK  N +I+++        V   
Sbjct: 1025 LARLQH---DDDVSDLYTLKKQSSVKSFK-----SVGSK--NEIINVDANDNSGTAV--- 1071

Query: 1057 DPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLM 1116
                   F+ PSIIKSF S+ +++DKF+ G KTVK  K+YK VG SK S+TYM K RKL 
Sbjct: 1072 ---ATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLT 1128

Query: 1117 APKKKADRDHHHNHHSKAWKTQKSKLFESGQDSFDS 1152
            AP  K+ +  H     +    Q S  F+S  + FDS
Sbjct: 1129 AP--KSLKKLHSTGGERKISAQTSHSFKSNSN-FDS 1161

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 118/375 (31%), Positives = 180/375 (48%), Gaps = 49/375 (13%)

Query: 222 TQKIIPATARIIPVATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPV 281
           TQ I    A+II   TQ     DT +Q  Q+     I+P TQ         ++    IP 
Sbjct: 288 TQLIDAQPAQIIDAETQPTQIIDTNAQPTQI-----IDPDTQPTQLINYSHESNGKHIPT 342

Query: 282 LTAEASLLFQTTPDC---VPTIRMDPPSQIEHDKYKTQ----LDTMTQTAHDEGKTQVDT 334
           L A  +LL   T      +P  R        + K+K      ++    T  D  +TQ   
Sbjct: 343 LPAPDALLSTGTSLLGLNIPLHRYATAGTTSNPKHKNDSQHIIEDNIATMRDRLETQ--E 400

Query: 335 MPQTIHDDV---SHTLKIRELQSELALEDSKREKARNVEYKKSRRNIPTMIN--FSKESF 389
              T+ DDV    +TLKI E+Q+++  E+++    R VE++KSR  +P+ +   F+KESF
Sbjct: 401 FQPTVADDVKSGGNTLKIHEIQTQID-EETRNMLNRGVEHRKSR-GVPSRVEVRFTKESF 458

Query: 390 LADFDNSSSDEGTDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRES--YKNVPLLSSY 447
           +ADF+   SD  +D++ +  Q+     +    +N  S+ N  +   E+   K V  LSSY
Sbjct: 459 MADFE--ESDSASDMESDSDQINDTTPETGSSQN--SDSNKARKPTEAPKTKRVTGLSSY 514

Query: 448 ANNLKREXXXXXXXXXXXXXXXXXXXXXYMGGNMSIKDESAL----PISRLSKAAILNLK 503
              L+ +                      +G + +   E        +S+ SKAA+LN+K
Sbjct: 515 ETILRNKVNDDECLD--------------LGSDDTYSSEEEYDKESKVSQASKAAVLNIK 560

Query: 504 ARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKE 563
           A+  K+   +    N NK      + LF+ L+K +R+QIL HQ E+I TKG   +D+ +E
Sbjct: 561 AKALKKKAIVKAA-NTNKTT---LDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDLERE 616

Query: 564 KEIVENLLEQEILRN 578
           KEIVE+LLEQEILRN
Sbjct: 617 KEIVEDLLEQEILRN 631

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 63/108 (58%), Gaps = 11/108 (10%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
           MD++LE  +S+  K+R TTYKK+                 ++   P +L GNGFLFGNAT
Sbjct: 1   MDDLLERFNSVKVKRR-TTYKKV-------QQNSTDEAAGDDDCVPTSLAGNGFLFGNAT 52

Query: 116 LNRVKNRLEGIDVPEDDRQIKDNENEDAV---STQLIANLYDGGEDLE 160
           ++++KNRL   D P     +  + +ED +    +QL++ LYDGGEDLE
Sbjct: 53  VDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLE 100

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  281 bits (718), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 190/472 (40%), Positives = 256/472 (54%), Gaps = 63/472 (13%)

Query: 681  PKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXXXXX 740
            P  N I+LGHYGDN+ +E +N   E   +++ + ++                        
Sbjct: 575  PSLNTINLGHYGDNLSQENNN---ERNNIDSDESED------------------------ 607

Query: 741  XXXAIRRELIDXXXXXXXXXXXXHVAELKEFKSKGITNFFXXXXXXXXXXWHGVGGADGE 800
                + +E++                +L+E K KGIT+ F          WHG+GG DGE
Sbjct: 608  --EELYKEMVKKEIDRRRDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDGE 665

Query: 801  GSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRAK 860
             S+EYDSEVEKMIDDYSK +FN+ EIRE LAAENK+MD+KM+NRIL DIKNGGFR +R  
Sbjct: 666  LSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKRR-- 723

Query: 861  NXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFK 920
            N             L+ Y                 + KL+ N KS AF ESMV+DI+E K
Sbjct: 724  NALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVK 783

Query: 921  NPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSL 980
            NPF   +++  D        DT + D+   GD   N     + ++ KK I+SE FVQKSL
Sbjct: 784  NPFDERDDNIMD--------DTPETDA--EGDVNSN----ELLNKKKKFILSEAFVQKSL 829

Query: 981  SFLRSN-NYDEFEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNS 1039
            SFL S+ N +EFEM+   A+ QH        D+F LK H SIKS  + P    +S  ++S
Sbjct: 830  SFLSSSRNLEEFEMNNNLAKEQH---SHAATDMFALKSHCSIKSLESLPGSHNNS--ISS 884

Query: 1040 MIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTV 1099
             +DL          E    +   G K  S+IKSF+S  DI+ KFK+GNKTVK+SK+Y+TV
Sbjct: 885  KLDLLH--------EEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTV 936

Query: 1100 GSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKSKLFESGQDSFD 1151
            GS+KASITY+GK RKL+ PKKK  + H H    K+     S+LF+   +SF+
Sbjct: 937  GSAKASITYLGKARKLVPPKKKEHKPHSH----KSKTASASRLFDEQDNSFE 984

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 166/544 (30%), Positives = 249/544 (45%), Gaps = 117/544 (21%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
           MD V + L +L  KKR TTYKK+              +   N+  P    G   LF N+ 
Sbjct: 1   MDFVFDGLDALKGKKR-TTYKKVTDG----DVEDEPKISEFNIELPGL--GQSILFNNSK 53

Query: 116 LNRVKNRLEGI--DVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKD 173
           L +++NRLEG   D   D  Q    E +    TQ+I+NLY+GGEDLEE          K+
Sbjct: 54  LKQIRNRLEGNNNDSENDSSQA---ETQVIADTQIISNLYEGGEDLEE----------KE 100

Query: 174 GIAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARII 233
                 +TQ +    Q   ++D  +       S++ I  +        TQK I A+    
Sbjct: 101 ERRFLQRTQIVEDHTQ---IIDASV-----TYSSKTIESNKM----DNTQKYINAS---- 144

Query: 234 PVATQRIHSRDTASQTQQV----PFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLL 289
                   S  T  Q  +V      T  ++ Q +++ TT    +TQ L            
Sbjct: 145 -------DSEPTQIQISKVDKLLKITDNLDSQKKVLDTTL---ETQELET---------- 184

Query: 290 FQTTPDCVPTIRMDPPSQIEHDKYKTQLDTM----TQTAHDEGKTQVDTMPQTIHDDVSH 345
            Q     V   ++D          KTQ+D      T  A DE K    T  QT+ DD +H
Sbjct: 185 -QYGKTQVDKTQVD----------KTQVDKTQIFPTLVADDEIK-HSSTAVQTV-DDNTH 231

Query: 346 T---LKIRELQSELALEDS-KREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEG 401
           +   LKI E++ +L  ED   +EK+   EYK++   + + + FSK  FL  FD+SSS+E 
Sbjct: 232 SNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFDSSSSEED 291

Query: 402 TDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREXXXXXXX 461
            +  +   +L   + +      + S P   K S+        LS+Y N LK++       
Sbjct: 292 EEGVV---KLSSTEPETAAMNLENSLPQFSKESK-----FIGLSNYENILKKDINKQNCI 343

Query: 462 XXXXXXXXXXXXXXYMGGNMSIKDESALPISRLSKAA---ILNLKARLSKQSQNLTQMPN 518
                                 +DE+ +  S++S+A+   IL++KA LS+     + + N
Sbjct: 344 EFSDS-----------------EDETEVT-SKVSRASKATILSIKANLSRHKPAQSSINN 385

Query: 519 KNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRN 578
           KN         LF+ L+KA++ QILDH++E++E KG+K+E++ KEKEIVENLLEQEI RN
Sbjct: 386 KNALG-----NLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQEIERN 440

Query: 579 RRIR 582
           R+IR
Sbjct: 441 RKIR 444

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  266 bits (680), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 193/510 (37%), Positives = 269/510 (52%), Gaps = 74/510 (14%)

Query: 649  KKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNI---DEEASNSFEE 705
            K+ +    ++++SDSEIE +  +  SK+       N IDLGHYGDNI     E  N  EE
Sbjct: 523  KRKHKKTEIVDDSDSEIEAQ--IVDSKEIITA---NTIDLGHYGDNIIQQSRETLNETEE 577

Query: 706  ATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXXXXXXXXAIRRELIDXXXXXXXXXXXXHV 765
            +   + ++ + II                          IR++                 
Sbjct: 578  SDEEDEERYNAII-----------------------SEGIRKQ---------KELEKREA 605

Query: 766  AELKEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHE 825
              LKE K+ G++  F          WHG+GG D + S+ YDSEVEKMIDDYS+ +FN  E
Sbjct: 606  KRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSE 665

Query: 826  IREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXX 885
            IREMLA ENKE D+ ++N+ILYDIKNGGFR ++ ++             L+ Y       
Sbjct: 666  IREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDD-LKAYRAKRRAL 724

Query: 886  XXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDN 945
                   I  D K+VKNPKSKAFFES+V+DI+E KNPF     S + +    T     DN
Sbjct: 725  MREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDN 784

Query: 946  DSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRS-NNYDEFEMDKERARIQHDI 1004
            D     + T+         + KK +ISE+FVQ+SLSFL S    DEFE++      QH+ 
Sbjct: 785  DEKLATNVTK---------KKKKIVISEEFVQRSLSFLNSCREQDEFEINN-----QHNG 830

Query: 1005 GDEGVE--DLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIG 1062
            G++     DL+TLK++SSIK+  +  +   SS   N     EQP++ +        SL  
Sbjct: 831  GEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLN---EQPSQSSG-------SLFN 880

Query: 1063 GFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKA 1122
              +  S++ SF+S  DIN KFKEG K+VK+S  YKTVGS++ASITYMG +R+L+APKK  
Sbjct: 881  DLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK-- 938

Query: 1123 DRDHHHNHHSKA-WKTQKSKLFESGQDSFD 1151
                     SKA  +T  S+LF++ + SF+
Sbjct: 939  ---SRLTTSSKANSRTTPSRLFDNQEGSFE 965

 Score = 85.5 bits (210), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 148/538 (27%), Positives = 227/538 (42%), Gaps = 106/538 (19%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
           MD++ + L+    KK+ TTY KI   +          +L N      +    G LFGN+ 
Sbjct: 1   MDSLFDQLNHF--KKKRTTYDKIPHDL-LEEEQESEDILKNKTAKEISQLDGGILFGNSI 57

Query: 116 LNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGI 175
           L +++NRL  ID            NED           D G++  E+ +  DN   +D  
Sbjct: 58  LGQIRNRLNNID------------NEDK----------DKGKEASESITSKDNE--QDST 93

Query: 176 AAFTQTQRIP-VSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIP 234
             F QTQ I  +    E++ +   H  N  K  +II D+    T    +       ++I 
Sbjct: 94  QIFPQTQIINNLYDGGEDLENEIFH--NSFKKTQIITDNILIETNTNDKSTQYEKTQVIT 151

Query: 235 VATQRIHSR--DTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQT 292
           +  +R+  +  D  + TQ V   +                +TQPL   + T   + +   
Sbjct: 152 I-NERLSDKPLDVVNNTQTVLVIE----------------NTQPLPSEIKTQVVNEVNSA 194

Query: 293 TPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDV---SHTLKI 349
            P   PT  +   +Q     Y TQ                + MP    DDV   S  LKI
Sbjct: 195 LPVTQPTQTI-VATQANEVTYDTQ----------------ELMPTV--DDVAMRSTGLKI 235

Query: 350 RELQSELALEDS-KREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEK 408
            +++ EL  E    +E     E+K           FSKE FL  FD+SSS E    + EK
Sbjct: 236 TDIEKELEEEQRLAKETEFGTEFKFKESESKISKKFSKEDFLNHFDDSSSSEDETSKNEK 295

Query: 409 SQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREXXXXXXXXXXXXXX 468
                      V +++   P++   +    K++  L +Y +NL+R+              
Sbjct: 296 GP--------NVDKSEVLHPDNKSKTLLKVKSINGLGNYEHNLRRKANNEQIIE------ 341

Query: 469 XXXXXXXYMGGNMSIKDESA---LPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKV 525
                        S  DE +   +  S  SKA ILN++A  SKQ   ++Q     K  + 
Sbjct: 342 ------------FSESDEDSDTNISPSYASKAVILNIRANKSKQQPKVSQ-----KSDQT 384

Query: 526 DHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIRQ 583
               L+N L++AS++QI+ +Q+E++E KG  LE++ KE EIVENLLEQEI RN++IRQ
Sbjct: 385 TLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARNQKIRQ 442

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  237 bits (604), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 174/479 (36%), Positives = 242/479 (50%), Gaps = 73/479 (15%)

Query: 678  DATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXX 737
            D T  RN IDLG YG+N+        E     ++ +ID                      
Sbjct: 551  DDTLPRNIIDLGPYGNNLQVNHEEDMENLPLSDSAEID---------------------- 588

Query: 738  XXXXXXAIRRELIDXXXXXXXXXXXXHVAELKEFKSKGITNFFXXXXXXXXXXWHGVGGA 797
                      ELI                 LK+ K+KG+              W GVGG 
Sbjct: 589  --AAEEEKTNELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKGVGGV 646

Query: 798  DGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNK 857
            DG+ S+E+DS++E+MIDD++K++ N  ++R++LA ENKE+D KM+N+ILYDIKNGGFR K
Sbjct: 647  DGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGGFR-K 705

Query: 858  RAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIM 917
            R +N             L+ Y                D  K  +N KSKAF ESMV+DI 
Sbjct: 706  RGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVDDID 765

Query: 918  EFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQ 977
            E KNPF   E   +D     TD+DTQ+N      D  +N E         K  +S++FVQ
Sbjct: 766  ESKNPFGDPEMDVED----NTDVDTQEN------DYPKNKE---------KNTLSQEFVQ 806

Query: 978  KSLSFLRSNNYD-EFEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKR 1036
            +SLSFL +NN   EFE+ +     Q  +GDE  +D+ +LK++SSI +  NS +       
Sbjct: 807  RSLSFLSNNNSSREFELGE-----QITLGDEE-QDVSSLKRNSSIHALHNSSS------- 853

Query: 1037 VNSMIDLEQPTEDNNEVENEDPSLIG--GFKHPSIIKSFASRTDINDKFKEGNKTVKISK 1094
                     P +++ E EN+D   I    FK PS+IKS A   D N+KF+ G KTV +SK
Sbjct: 854  ---------PIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSK 904

Query: 1095 TYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSK-AWKTQKSKLFESGQDSFDS 1152
            +Y+ VG S++SITY GK RKL+ PK   +R+   +   + A K    KL+ES Q+SFD+
Sbjct: 905  SYRAVGGSRSSITYFGKMRKLVGPK---NRNSTLSKGPRPASKPTMGKLWESQQNSFDT 960

 Score =  154 bits (389), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 153/536 (28%), Positives = 251/536 (46%), Gaps = 100/536 (18%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
           MD++LE L  L+SK+R TTYKK+               +SN    PP + GNGFLF N+T
Sbjct: 1   MDSLLEKLDPLSSKRR-TTYKKVFE----PQEEEETQQISN--SPPPPILGNGFLFQNST 53

Query: 116 LNRVKNRLEGID-----VPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNAS 170
           +++V+NRL   +     V + +++ +  +      TQ+IA+LY+G E+LEE         
Sbjct: 54  IDKVRNRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNK------ 107

Query: 171 LKDGIAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQ-KIIPAT 229
                    +  R+P+S ++                          S+A+Q + ++IP  
Sbjct: 108 ---------ERVRLPLSKKT--------------------------SSASQEKTQVIPWA 132

Query: 230 ARIIPVATQRIHSRDT-ASQTQQVPFTKPIEPQTQIIGT---TANDSDTQPLRIPVLTAE 285
             +  V        D    +TQQVP     + +TQ I +   T  +  TQ +  P  T +
Sbjct: 133 PTVEGVENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVEPLTQRISEPERTLD 192

Query: 286 ASLLFQTTPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSH 345
                 T+ D + T   +P          TQLD           + +   P         
Sbjct: 193 VPTYAATSEDQLDTQEQNPI---------TQLDISNSLLFQATDSDIPKSP-------PQ 236

Query: 346 TLKIRELQSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQ 405
            LK+ +++ EL  +  +R+  RN+EY+   + +     FSKE+FL +FD  SS E   ++
Sbjct: 237 RLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLKNFDEESSSEDELIE 296

Query: 406 LEKSQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREXXXXXXXXXXX 465
           L    ++++      H  K  + ++++N+ ES +   + S Y   LK E           
Sbjct: 297 LRSRDIEKK------HTEK--DKSTLENTTESSQRQRVFSVYEYKLKGE----------- 337

Query: 466 XXXXXXXXXXYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKV 525
                              ++  +P+SR+SKA +L++KAR SKQ + L+++    K  K 
Sbjct: 338 --LDSKRCIQLDDDEDESDEDVEVPLSRVSKATVLDIKARRSKQ-EPLSKI----KQKKT 390

Query: 526 DHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRI 581
             N L   L+KAS+KQI DHQ E+++++G+KLED+ K+KE +ENLLEQEI RN+R+
Sbjct: 391 TLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNKRL 446

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  227 bits (579), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 151/377 (40%), Positives = 208/377 (55%), Gaps = 46/377 (12%)

Query: 768  LKEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIR 827
            L+E  +KG+  +F          W G+GG DG+   EYDSEVEKMIDDYSK   +   +R
Sbjct: 795  LQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLR 854

Query: 828  EMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXX 887
            + +  ENKEMD+K++N+ILYDIKNGGFR KR +N             LQ++         
Sbjct: 855  QKIMDENKEMDLKLVNKILYDIKNGGFR-KRGRNDMELEFSDDEDAELQEFRRKRRELMK 913

Query: 888  XXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDS 947
                   D  KL KNPKSKAFFESM+ D++E KN F        DL+     ++ ++ + 
Sbjct: 914  QRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNF-------DDLSDQ---IELKEENI 963

Query: 948  IQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYDE-----FEMDKERARIQH 1002
             Q  +    NE +   ++  K  ISEDFVQK+LSFL ++   +     F M KE+     
Sbjct: 964  TQEDNEKEYNEAKS--NKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEK----- 1016

Query: 1003 DIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIG 1062
                 G+ D+  LK +SS+ SF +    S S K +N   D+ +  E              
Sbjct: 1017 -----GIGDMNALKSNSSL-SFCSKL--STSRKIINDEEDVIEEFE-------------- 1054

Query: 1063 GFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKA 1122
             FK PSII+SF+S+  I+DKFK+GNK+VK+S +YKTVG SKASITY+GKTRKL+ PK   
Sbjct: 1055 SFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPKNGP 1114

Query: 1123 D-RDHHHNHHSKAWKTQ 1138
              R  + N+ S+ +  Q
Sbjct: 1115 TVRKRNSNNTSRLFNIQ 1131

 Score = 94.4 bits (233), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 167/379 (44%), Gaps = 85/379 (22%)

Query: 254 FTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQT----------------TPDCV 297
           + + ++  TQIIG T +        +P+ T  + L  QT                TP+  
Sbjct: 277 YRQTMDASTQIIGATQH--------VPIETQNSYL--QTIKDHEDKTVGSSKDLHTPNFN 326

Query: 298 PTIRMDP---PSQIEHDKYKTQLDTMTQTAHD--EGKTQVDTMPQTIHDDVSHTLKIREL 352
           P   + P    +  E  + +TQ+D + +  H   E  TQ+D         ++  L I ++
Sbjct: 327 PNTSILPLFKNNSSEEAQSETQIDVVHEEVHKTKENDTQMDDTQ------ITEVLAITKI 380

Query: 353 QSELALEDSKREKARNVEY--KKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQ 410
           + EL   D +    +  EY  K+S   +P    F+KE  L +FD+SSSDE  D  L + Q
Sbjct: 381 EQELE-NDERAITDKQTEYIPKRSPNVLPAKSQFTKEKLLQNFDSSSSDE-EDTILGEKQ 438

Query: 411 LKQQQDDNEVHENK------------PSEPNSVKNSRE---SYKNVP-----------LL 444
             Q   D+E  EN              SE N   N      S ++ P           +L
Sbjct: 439 KDQNLSDSESLENNDIMTDQKTSVTPSSEYNGSDNEHSASISLRSSPISKPRWKSSSMIL 498

Query: 445 SSYANNLKREXXXXXXXXXXXXXXXXXXXXXYMGGNMSIKDESALPISRLSKAAILNLKA 504
            +Y NNLK++                     Y              +S  SKA +LNLK 
Sbjct: 499 PAYVNNLKQKVENKKLQLSSDSDDEVDSAVIY-------------KLSNKSKATLLNLKV 545

Query: 505 RLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEK 564
           RLSK+     +   K    K   N LFN LRKA+++QI+ H++E++E++G   ED+ K+K
Sbjct: 546 RLSKK-----KPVKKVHNEKDSTNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQK 600

Query: 565 EIVENLLEQEILRNRRIRQ 583
            +VE+LLE+EI RN +IR+
Sbjct: 601 VMVEDLLEKEIERNLKIRE 619

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 59/141 (41%), Gaps = 35/141 (24%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGN-------- 107
           MD + + L  +  KKR TTYKK+                SN +    A T +        
Sbjct: 1   MDFLFDELEQVKIKKR-TTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNN 59

Query: 108 ----GFLFGNATLNRVKNRL---EGIDVPED----DRQIKDNENE--------------- 141
               GFL  +  L+ +++RL   +  +V ED    + QI++   E               
Sbjct: 60  VNKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQS 119

Query: 142 DAVSTQLIANLYDGGEDLEET 162
           D +STQ+I   YDGGEDL+ T
Sbjct: 120 DDISTQIINEYYDGGEDLDAT 140

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  222 bits (565), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 185/482 (38%), Positives = 248/482 (51%), Gaps = 43/482 (8%)

Query: 654  VKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGDNIDEEASNSFEEATTLNTQK 713
            +K V  ESDSE +   +   S+K    P  N I+LGHYGDN+D + S  F E +    + 
Sbjct: 768  LKLVTEESDSENDNPLE---SEKIPINP--NIINLGHYGDNLDSK-STIFNENSKKFIED 821

Query: 714  IDNIIIKTHTXXXXXXXXXXXXXXXXXXXXAIRRELIDXXXXXXXXXXXXHVAELKEFKS 773
            I+       T                     I++EL                A+L+E K 
Sbjct: 822  IEQFEADNSTENSNNELNELEYKRH------IKQEL-----EKQKLKEAKKKAKLRELKK 870

Query: 774  KGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAE 833
             G +  F          W G+GGADGE S+EYDSEVEK+IDDYS+  FN  EIR  L  E
Sbjct: 871  VGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNE 930

Query: 834  NKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXI 893
            NKEMD+KM+NRILYDIKNGGFR KR +N             L++Y              +
Sbjct: 931  NKEMDIKMVNRILYDIKNGGFR-KRNRNNIDLELSDDEDDELREYRIKRREIMKKKRLEV 989

Query: 894  GDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDN-----DSI 948
             +  K++K  KSKAFF SMV+DI+E  NPF   + S  D      D  +  N     ++ 
Sbjct: 990  TNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSDDNNMDSISNKNHKDANNAK 1049

Query: 949  QIGDSTRNNEHRRVDDRS-KKTIISEDFVQKSLSFL-RSNNYDEFEMDKERARIQHDIGD 1006
            +     R ++H R+   S KK ++SEDFV K+LSFL +S   +EF+   E  + Q  IG 
Sbjct: 1050 KDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQ--IG- 1106

Query: 1007 EGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGF-- 1064
              + D+ +LKQ SSIK+        LS    ++ +DL+   +D++++ +   S    F  
Sbjct: 1107 -TINDIQSLKQKSSIKTM-----HVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNSFDD 1160

Query: 1065 ------KHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAP 1118
                  K PSIIK F S  DINDKFK+GNKTV IS +YKTVG  K SIT  G+ RKL+AP
Sbjct: 1161 PLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219

Query: 1119 KK 1120
             K
Sbjct: 1220 VK 1221

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 69/97 (71%), Gaps = 5/97 (5%)

Query: 486 ESALPISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDH 545
           +S +  S  SKA IL+++ +LSK+   + +        + + ++LFN L+KAS+KQI DH
Sbjct: 608 QSDILFSTASKAQILDIRHKLSKKKPQVKKK-----TIQTNLDQLFNKLKKASKKQIFDH 662

Query: 546 QREVIETKGFKLEDMAKEKEIVENLLEQEILRNRRIR 582
           Q+  IE+KG KLED+ KEKEIVENLLEQEI RNR+IR
Sbjct: 663 QKNAIESKGLKLEDLKKEKEIVENLLEQEIERNRKIR 699

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNAT 115
           MD V + L  L  KKR TTYKK+   +          + SN    P      GFLF N  
Sbjct: 3   MDAVFDSLDELKIKKR-TTYKKVPEQVATELDKAATTI-SN--PVPSFNLSEGFLFANDK 58

Query: 116 LNRVKNRL 123
           L ++KNRL
Sbjct: 59  LEKIKNRL 66

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  212 bits (539), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 232/473 (49%), Gaps = 78/473 (16%)

Query: 684  NAIDLGHYGDNI----DEEASNSFEEATTLNTQKIDNIIIKTHTXXXXXXXXXXXXXXXX 739
            +AI+LG YGDN+     +EA  S EE TT    +I     +T                  
Sbjct: 541  SAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQYRT----------------ME 584

Query: 740  XXXXAIRRELIDXXXXXXXXXXXXHVAELKEFKSKGITNFFXXXXXXXXXXWHGVGGADG 799
                 IR +                   LK+ K  G+TN F          W GVGG DG
Sbjct: 585  KEKSKIRAQ--------------EEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDG 630

Query: 800  EGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRA 859
            E  ++YDS++EKMIDD+S  + N+ +IR++L AENKE D+K +N+IL+DIKNGGFR +R 
Sbjct: 631  ETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQ 690

Query: 860  KNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEF 919
             N            +L                   DD KL+KN +SKAFFESMVEDI++ 
Sbjct: 691  NNLQLELSDDEDDELLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDL 750

Query: 920  KNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFV-QK 978
            K+PF  + E+ +           +D  S  + D++            +K  IS +FV Q 
Sbjct: 751  KDPFSNQAETSE-----------KDKKSEGLVDASNK----------QKDTISHEFVQQS 789

Query: 979  SLSFLRSNNYDEFEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVN 1038
                  S ++ EFE+    AR+  + G+    DL +LKQ S++K+   +P++ +S     
Sbjct: 790  LSFLSSSRDFSEFEV----ARVSQE-GERNT-DLNSLKQDSTVKTLY-APSNIIS----- 837

Query: 1039 SMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKT 1098
                 E    D+ E +N    L     + S++KSF    + NDK KEG KTV +SK+Y+T
Sbjct: 838  -----ESERADHEEFDN--SVLPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRT 890

Query: 1099 VGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKSKLFESGQDSFD 1151
            VG +KASITY+GK RKL+APKK    +      SK      SK+F + + SF+
Sbjct: 891  VGGNKASITYLGKMRKLVAPKKS---NAEVRTTSKLSTLGNSKIFRNFESSFE 940

 Score =  125 bits (313), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 145/488 (29%), Positives = 227/488 (46%), Gaps = 90/488 (18%)

Query: 100 APPALTGNGFLFGNATLNRVKNRLEGIDVPEDDRQIKDNENEDAV--STQLIANLYDGGE 157
            PPA+ GNGFLF ++TL++VKNRL            KD E       +TQ+++NLY+ GE
Sbjct: 36  VPPAVLGNGFLFNSSTLDKVKNRLN-----------KDQEQGTQAIDTTQVLSNLYEDGE 84

Query: 158 DLEETKSMGDNASLKDGIAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFS 217
           DLE                     + +P  +QS++    PI +I      R I    F  
Sbjct: 85  DLE---------------------KEVPSILQSKSK---PIPTILIPSIEREILKQPFNE 120

Query: 218 TAAQTQKIIP-ATARIIPVATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQP 276
               T   +P A +  I   T+ +   D  S   ++P T+PI         +A+D  TQ 
Sbjct: 121 NHNFTGVTVPIAKSSAI---TKNLDREDLESP--EIPETQPIP------DFSASDVPTQ- 168

Query: 277 LRIPVLTAEASLLFQTTPDCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMP 336
                     + + +TT +          + I +++  TQ++   QT  D+  +Q D + 
Sbjct: 169 ----------TQVLKTTSETAADTGTVATAAIAYEESLTQVEVSEQTYPDQRNSQEDIIQ 218

Query: 337 QTIHDDVSHT-LKIRELQSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDN 395
           QT  D V  T LKI E++   + E     K   V+Y+  R   P  + F+KE+F+ DFD 
Sbjct: 219 QTAADAVPITRLKIHEIEEMWSREVQTETKEHKVKYRAPR---PLKV-FTKEAFMQDFDK 274

Query: 396 SSSDEGTDVQLE-KSQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKRE 454
           SS  +      E K+     ++++ + E   S+   +K+     K+   L++Y   LK +
Sbjct: 275 SSDSDSDVFDQEIKATSPIGRNNDSISEVGTSDVKVLKD-----KSSGALTAYQRELKEK 329

Query: 455 XXXXXXXXXXXXXXXXXXXXXYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLT 514
                                 +      +++ A+  S  +KA +L LKARLSK+     
Sbjct: 330 AEIAKGV--------------MLLSESDDEEDLAVSTSHEAKATVLKLKARLSKR----- 370

Query: 515 QMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQE 574
           + P +++  K   + L   LR ++++QILD Q+E IE +G K ED+ KEKEIVENLLEQE
Sbjct: 371 RPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQE 430

Query: 575 ILRNRRIR 582
           I RN+RIR
Sbjct: 431 IARNKRIR 438

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  206 bits (523), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 198/368 (53%), Gaps = 53/368 (14%)

Query: 769  KEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIRE 828
            KE +  G+              WHGVGG D E S+EYDS+++KMIDDY+KN F+  EIR+
Sbjct: 775  KEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRK 834

Query: 829  MLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXX 888
            +LA+E+ + D  M+N+IL+DIK GGFR KR +             +LQ Y          
Sbjct: 835  ILASEDLQHDKNMVNKILHDIKTGGFR-KRGRGELDLELSEDEDGILQSYRAKRWNEQKQ 893

Query: 889  XXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSI 948
                   +T +  NPKS  FFESMV+   EF  P        +    T      Q  + +
Sbjct: 894  KMLDSEHNTSVKSNPKSLPFFESMVD---EFTIPV-------ERALGTPDSPPAQSTNVL 943

Query: 949  QIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEF--EMDKERARIQHDIG 1005
            ++  +T+           +K +ISE FV+++LSFL S+ N      E++ E+    +DI 
Sbjct: 944  ELKQNTK-----------QKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIY 992

Query: 1006 DEGVEDLFTLKQHSSIK---SFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIG 1062
               VEDL+TLK+ S+IK   +++  P        VN               E+ED +   
Sbjct: 993  SSEVEDLYTLKETSTIKVLNTYSGKPI-------VN---------------EDEDGAEF- 1029

Query: 1063 GFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKK-- 1120
            GFK PS++++F SR D+NDKFK+G K+VKIS  YKT+GSS+A+IT++GK RKL+ PK+  
Sbjct: 1030 GFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPKRSS 1089

Query: 1121 KADRDHHH 1128
            K+ RD  H
Sbjct: 1090 KSPRDSAH 1097

 Score = 79.0 bits (193), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 67/91 (73%), Gaps = 2/91 (2%)

Query: 492 SRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIE 551
           S + KAA+LN+KA++SK + NL++   ++  +     +LF  L+KA++KQILDH+RE+ E
Sbjct: 439 STMVKAALLNIKAKISK-NMNLSKNAEQSINSPT-LKQLFISLKKANKKQILDHRREITE 496

Query: 552 TKGFKLEDMAKEKEIVENLLEQEILRNRRIR 582
            +G  LE + +E+E VE+LLEQ+I RNRRIR
Sbjct: 497 KRGISLEQLEQEREKVEDLLEQKIKRNRRIR 527

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 12/55 (21%)

Query: 110 LFGNATLNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQL---IANLYDGGEDLEE 161
           +F NA +++V+NRLEG  +   DR        D +S++L   + NLYD GE LEE
Sbjct: 41  VFANAIVDKVRNRLEGT-ISSPDRL-------DTLSSKLSETVGNLYD-GEALEE 86

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  204 bits (518), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 143/382 (37%), Positives = 198/382 (51%), Gaps = 69/382 (18%)

Query: 771  FKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREML 830
             KS G+              WHGVGGADGE S++YDS+++ MIDD+SK+ F++  IRE L
Sbjct: 610  LKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERL 669

Query: 831  AAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXX 890
            A ENKEMD +MIN+IL+DI  GGFR KR +             +L+Q+            
Sbjct: 670  ALENKEMDERMINKILHDINTGGFR-KRGRGALDLELSDDEDELLRQFREKRREIMKQKL 728

Query: 891  XXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQI 950
                D   +V N KSKAFF+SMVEDI            + + + +  +  +T+D    ++
Sbjct: 729  LENVD--GVVNNSKSKAFFDSMVEDI------------TRKSIPAVTSFSNTRD----EM 770

Query: 951  GDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYD--EFEMDKERARIQHDIGDEG 1008
            G               KK +ISE+FVQ SLSFL + + D  EFE+        HD     
Sbjct: 771  G--------------KKKIVISEEFVQSSLSFLSAKDDDINEFEV----TEAAHD----A 808

Query: 1009 VEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPS 1068
             EDL +LKQ S+IKS      DS    R ++  D           + +  SL   FK PS
Sbjct: 809  TEDLESLKQRSNIKSL-----DSPQRNRNSAFFD-----------DVDGTSL--DFKLPS 850

Query: 1069 IIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHH 1128
            I+KSF+S +D+NDKFK G KTV ISK+Y+    S+++IT++GK RKL AP+ +       
Sbjct: 851  IVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGR------- 903

Query: 1129 NHHSKAWKTQKSKLFESGQDSF 1150
               +   +   S LF+S  DSF
Sbjct: 904  -KSTPLVRKPTSSLFDSNSDSF 924

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (59%), Gaps = 4/92 (4%)

Query: 492 SRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNK-LFNILRKASRKQILDHQREVI 550
           S+ SKAA+L +KA   K+S+N          + VD  K LF  L+  +R QIL+ +RE+ 
Sbjct: 336 SQSSKAALLLIKA---KRSRNKATKAKNMHVSTVDSLKELFTSLKTKNRDQILEFRREIS 392

Query: 551 ETKGFKLEDMAKEKEIVENLLEQEILRNRRIR 582
             KG  LE +  EK  VE LLEQE+ RNRR++
Sbjct: 393 GKKGISLEAIEDEKIQVEKLLEQELERNRRVK 424

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  191 bits (486), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 139/392 (35%), Positives = 197/392 (50%), Gaps = 60/392 (15%)

Query: 769  KEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIRE 828
            +E K KGIT             WHG+GG+D E SE+YDSEVEKMIDDYS +S N+  +R 
Sbjct: 679  REMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRA 738

Query: 829  MLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXX 888
            +LA   ++ D  ++N+IL+DI  GGFR +R K              LQQ+          
Sbjct: 739  ILAKNERQHDENIVNKILHDISTGGFR-RRGKGALDLEMSENEDQELQQFRQKRRELLKQ 797

Query: 889  XXXXIGDDTKLVKNPKSKAFFESMVEDIME--FKNPFKAEEESHQDLTSTATDLDTQDND 946
                 GD +KLV NPKS AFF++MV+D+ E  F N F A  +   D ++           
Sbjct: 798  KILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDEKTDPSAAG--------- 848

Query: 947  SIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHD-IG 1005
                                +K +ISE FV+++LSFL S + D  E+  E   I    + 
Sbjct: 849  --------------------RKIVISEQFVKETLSFLSSKSGDS-EIPAETKSISSSTVE 887

Query: 1006 DEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGF- 1064
             E ++DL TLKQ+S+IK    S               LE P +   E+ + D     GF 
Sbjct: 888  REEIQDLHTLKQNSNIKHLKGS---------------LELPAQ-MAELSSGDEGDY-GFS 930

Query: 1065 --KHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKK- 1121
              +  S  KSF + T+++DKFK G K V+I K  KT+G SKA+IT++G+ R+L+ PK   
Sbjct: 931  LDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKNDY 990

Query: 1122 ADRDHHHNHHSKAWKTQKSKLFESGQD-SFDS 1152
             D +   N   +A    +S+LF  G + SFD+
Sbjct: 991  KDSEPKLNSSKRA----RSQLFSEGNNRSFDT 1018

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 136/548 (24%), Positives = 224/548 (40%), Gaps = 119/548 (21%)

Query: 60  LEVLSSLT-SKKRVTTYKKIASPIPXXXXXXXXXLLSNNMGAPPALTGNGFLFGNATLNR 118
           +E+L  L  S ++ TTYKK+   I                   P+      +F ++ L+R
Sbjct: 1   MELLDGLCVSARKKTTYKKVRLGIAEQSKDE------------PSSNKPAAVFRSSLLDR 48

Query: 119 VKNRLEGIDVPEDDRQIKDNE--NEDAVSTQ--LIANLYDGGEDLEETKSMGDNASLKDG 174
           V+ RL           ++D    + DA+  +  L  ++YDG E+LE +  +GD  +  D 
Sbjct: 49  VRTRL----------NVEDGHAPSSDALEPESGLTDDVYDG-ENLEVSFDVGD--AEDDC 95

Query: 175 IAAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIP 234
           +   TQ    P  I+  NV   P    ++ K    + D G FS + Q    +    ++ P
Sbjct: 96  LP--TQADGKPEQIEV-NVGTAPEEPFSRIKIPLKLSDGGIFSPSTQVDDEM--AMQLQP 150

Query: 235 VATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTP 294
                         TQ++P   P  P  Q + T     D     + V   +  +    T 
Sbjct: 151 --------------TQKLP---PESPALQAVDTHTELQDELETGVAV---DGRISLSQTQ 190

Query: 295 DCVPTIRMDPPSQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIHDDVSHT-------- 346
             V      P ++++ +   TQ D+M         TQ  T+   + DD   T        
Sbjct: 191 VIVSGTNYGP-TRVDDEVVATQQDSMGTADAQCWDTQ--TLDCALADDFQATIPDAQTLA 247

Query: 347 ------LKIRELQSELALEDSKR----EKARNVEYKKSRRNIPTM-INFSKESFLADFDN 395
                 L I +++ E+A +  K      +A+   Y      IP   + F+K++FL  FD+
Sbjct: 248 TARHEKLFIHQIEEEIATKTQKELPMMTQAKEAPY------IPKQKLVFTKDNFLDSFDD 301

Query: 396 SSSDEGTDVQLEKSQLKQQQDDNEVHENKP--SEPNSVKNSRESYKNVPLLSSYANNLKR 453
            S  E     L+ S  +   +D E  E  P  S+P +    +++    P L S +   K 
Sbjct: 302 DSETE-IHGGLDGSDRQVSYNDREHTETGPQSSQP-ATGEGQDTQVLYPALQSLSITSK- 358

Query: 454 EXXXXXXXXXXXXXXXXXXXXXYMGGNMSIKDESALP------ISRLSKAAILNLKARLS 507
                                 Y      I DES+         S +SKAA+L +KAR S
Sbjct: 359 ---------------------SYQEARQIILDESSEDDTDVNLSSAVSKAAVLAIKARNS 397

Query: 508 KQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIV 567
           K      Q  ++ K +K   N+LF  LRKA+R+Q+L+ +R  IE +G  ++++ +E+E +
Sbjct: 398 KFI--TPQKIDETKSSK--SNELFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQL 453

Query: 568 ENLLEQEI 575
            NLLEQE+
Sbjct: 454 GNLLEQEL 461

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  185 bits (470), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 136/372 (36%), Positives = 193/372 (51%), Gaps = 54/372 (14%)

Query: 791  WHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIK 850
            WHG+GG DGE  +++DS++EKMIDDYS + F+S E+R+    E    D  M+N+IL+DI+
Sbjct: 666  WHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIE 725

Query: 851  NGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDDTKLVKNPKSKAFFE 910
             GGFR KR +N             L +Y               G+   L +NPKSKAFFE
Sbjct: 726  TGGFR-KRGRNALDLELSDDDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFE 784

Query: 911  SMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTI 970
            ++VEDI   K   + E        S+    + +++DS               D + KKT+
Sbjct: 785  TIVEDIRS-KGALEDEGPPPVRGFSSVNAPEEKNSDS---------------DKKGKKTV 828

Query: 971  ISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGD----------EGVEDLFTLKQHSS 1020
            +SE FVQ++LSFL S      E+ +E+   ++++G           E  +D+F LKQ+SS
Sbjct: 829  LSEAFVQQTLSFLTSG-----EVGEEKG-PENNLGSLPTHVPSFNTEETQDIFALKQNSS 882

Query: 1021 IKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDIN 1080
            IKS + +PT + S    N +ID           + ED  L+   +  S    F  R D N
Sbjct: 883  IKSLS-APTRNSS----NMLID-----------DQED--LLSRKRACSFFARFTKRVDAN 924

Query: 1081 DKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKS 1140
            +KF+EG KTV+   +YK  GSSKASITY+GK RKL APKK A +      H  A      
Sbjct: 925  EKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGF--- 981

Query: 1141 KLFESGQDSFDS 1152
             +F S  +SF+S
Sbjct: 982  GIFASNSESFES 993

 Score = 75.1 bits (183), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 61/87 (70%)

Query: 496 KAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKGF 555
           KAAIL+LKARLSK+SQ+L    +K       H  LF  LRKA++ QILD+++E  ++KG 
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

Query: 556 KLEDMAKEKEIVENLLEQEILRNRRIR 582
             + + +EK  +E+LLE+E+ RN++IR
Sbjct: 420 DYDKITEEKNSIESLLERELARNKKIR 446

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 102 PALTGNGFLFGNATLNRVKNRLEGIDVPEDD--RQIKDNENEDAVSTQLIANLYDGGEDL 159
           P +TG GFLFGN+ L RVK+RL   +  E D  +   DN   D   TQ++   YD GEDL
Sbjct: 29  PLVTGTGFLFGNSVLRRVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAYD-GEDL 87

Query: 160 EE 161
           E+
Sbjct: 88  EQ 89

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  154 bits (389), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 125/361 (34%), Positives = 175/361 (48%), Gaps = 51/361 (14%)

Query: 765  VAELKEFKSKGITNFFXXXXXXXXXXWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSH 824
            + EL   K+ G+ +F           W GVGGADGE S+ YDSE+++MIDDYS    +  
Sbjct: 627  MKELNRSKANGMIDF---EAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPE 683

Query: 825  EIREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXX 884
             +R+ L  E K  D  M++RIL+DI+NGGFR KR +              L +Y      
Sbjct: 684  FLRKKLMEEEKLHDKDMVDRILHDIENGGFR-KRGRYAMDLTLSDDEDDDLLRYHARRKE 742

Query: 885  XXXXXXXXIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQD 944
                      + + L  NPKSKAFF+S+ ED ++       E +SH      A D     
Sbjct: 743  LLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIANLKEYQSHASPLKAAKD----- 797

Query: 945  NDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARI---- 1000
                +I                ++T ISE FVQK+LSFL+S   DE + D E   +    
Sbjct: 798  ----EISG-------------KRETRISEQFVQKTLSFLKSKE-DE-QGDAEFVSVADTQ 838

Query: 1001 QHDIGDEG-VEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPS 1059
            +   GD     D + LKQ S IKSF         S  + S I L        +V N+D  
Sbjct: 839  ESSSGDFAEATDFYRLKQLSGIKSF---------SAPLRSSIRL--------QVRNKD-G 880

Query: 1060 LIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPK 1119
            ++ G  + ++++ F    D N+KF+EG KTVK   +YK  GSS+ASIT++GK R L A K
Sbjct: 881  VLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARK 940

Query: 1120 K 1120
            +
Sbjct: 941  R 941

 Score = 78.6 bits (192), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 63/89 (70%)

Query: 495 SKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQILDHQREVIETKG 554
           SKAAIL+LKAR+SK+ Q+L    +K          LF+ LRKA+R Q+++H+  ++  +G
Sbjct: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRG 397

Query: 555 FKLEDMAKEKEIVENLLEQEILRNRRIRQ 583
             L ++AKEKE VE+LLE+E+ RN++++Q
Sbjct: 398 VDLAEIAKEKESVESLLERELARNKKVKQ 426

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 33/67 (49%), Gaps = 13/67 (19%)

Query: 102 PALTGNGFLFGNATLNRVKNRLEGIDVPEDDRQIKDNEN--------EDAVSTQLIANLY 153
           P + G GFLF N+  N+VK R++      DD +I  N          +D   TQ I   Y
Sbjct: 30  PTVGGTGFLFENSIFNQVKKRIKAT----DDNEINHNAPTTASTEILKDTCETQAIERPY 85

Query: 154 DGGEDLE 160
           D GE+LE
Sbjct: 86  D-GEELE 91

>Ecym_4152 Chr4 (327931..330312) [2382 bp, 793 aa] {ON} similar to
            Ashbya gossypii AGL100W
          Length = 793

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 13/135 (9%)

Query: 948  IQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYDEFEMDKERARIQHDIGDE 1007
            +Q+ D +++  + R+      ++  E ++QK L ++++ NY     +  R+ +     D 
Sbjct: 202  VQVSDFSKSMRYFRIATLIVPSV-GETYLQKGLVYVQTANYGHAVYEFMRSSLSRMPTDA 260

Query: 1008 GVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHP 1067
            GV +L          S    P  SL  K   ++ DL     DNN++ N +   +  F   
Sbjct: 261  GVPNL---------NSIVADPNSSLFIKFQETLKDLRLKERDNNKIINRE---VLEFYFL 308

Query: 1068 SIIKSFASRTDINDK 1082
            +   S  +  + NDK
Sbjct: 309  AWFASLYAPENWNDK 323

>TDEL0G02600 Chr7 complement(498005..500029) [2025 bp, 674 aa] {ON}
           Anc_2.330 YDL109C
          Length = 674

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 11/85 (12%)

Query: 258 IEPQTQIIGTTA-----NDSDTQPLRIPVLTAEASLLFQTTPDCVPTIRMDPPSQ---IE 309
           + P T++IG  A     + + T P +I  + +  SLL    PD   +  +DP S+   I 
Sbjct: 424 VSPFTKVIGLLAPQKFPSKNSTIP-KISFMESAVSLLIPPLPDI--SFILDPNSRDPVII 480

Query: 310 HDKYKTQLDTMTQTAHDEGKTQVDT 334
           HDK  T+ D   + A DEG  +  T
Sbjct: 481 HDKVYTEDDIPQEPAEDEGTFEAST 505

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,644,527
Number of extensions: 4852297
Number of successful extensions: 23178
Number of sequences better than 10.0: 251
Number of HSP's gapped: 24314
Number of HSP's successfully gapped: 295
Length of query: 1152
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1031
Effective length of database: 39,606,813
Effective search space: 40834624203
Effective search space used: 40834624203
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)