Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.21.4ON42642619940.0
Smik_3.131.4ON42542616600.0
YCL063W (VAC17)1.4ON42342616390.0
Suva_3.1511.4ON42142615730.0
TDEL0C069801.4ON4263714912e-56
ZYRO0F18502g1.4ON4503614703e-53
Kpol_2002.71.4ON4743074208e-46
SAKL0C00440g1.4ON4623653724e-39
KNAG0C001901.4ON4423853662e-38
TPHA0E040201.4ON5404323598e-37
NDAI0A001301.4ON4785043472e-35
CAGL0B00308g1.4ON4304573346e-34
NCAS0B091201.4ON4334683251e-32
TBLA0A075801.4ON5133212627e-24
KLLA0C00462g1.4ON4603752609e-24
KAFR0D001201.4ON3994612041e-16
Kwal_33.130031.4ON4492461836e-14
KLTH0F00462g1.4ON4512411622e-11
Ecym_10071.4ON462158800.28
Kpol_1031.165.415ON11664720.73
TDEL0E009004.280ON205172770.82
Skud_5.1587.217ON39138750.88
CAGL0D01672g3.340ON101460732.3
Smik_5.1737.217ON39144712.6
YER048C (CAJ1)7.217ON39144712.7
KLLA0A09427g5.51ON101197713.6
Skud_13.2212.632ON501219704.6
KNAG0L013307.217ON39638694.8
Suva_5.1507.217ON39138686.9
NOTE: 1 genes in the same pillar as Skud_3.2 were not hit in these BLAST results
LIST: AFR746C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.2
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      772   0.0  
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   644   0.0  
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   635   0.0  
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   610   0.0  
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   193   2e-56
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   185   3e-53
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   166   8e-46
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   147   4e-39
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   145   2e-38
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   142   8e-37
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   138   2e-35
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   133   6e-34
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   129   1e-32
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   105   7e-24
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   104   9e-24
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    83   1e-16
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    75   6e-14
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    67   2e-11
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    35   0.28 
Kpol_1031.16 s1031 complement(41507..41857) [351 bp, 116 aa] {ON...    32   0.73 
TDEL0E00900 Chr5 (183627..189782) [6156 bp, 2051 aa] {ON} Anc_4....    34   0.82 
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    33   0.88 
CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa] ...    33   2.3  
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    32   2.6  
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    32   2.7  
KLLA0A09427g Chr1 complement(821244..824279) [3036 bp, 1011 aa] ...    32   3.6  
Skud_13.221 Chr13 (374262..375767) [1506 bp, 501 aa] {ON} YMR065...    32   4.6  
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    31   4.8  
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    31   6.9  

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/426 (89%), Positives = 382/426 (89%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60
           MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGV     
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 121 XXXXXXXXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
                        PRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFF             T
Sbjct: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300
           IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT
Sbjct: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300

Query: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360
           FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF
Sbjct: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360

Query: 361 LDKFNSSLSTISESFQXXXXXXXXXXXXXRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420
           LDKFNSSLSTISESFQ             RISNLNHIATQEQKKNIMDMSVSIEELQDAL
Sbjct: 361 LDKFNSSLSTISESFQNKKGKKNKDVNDGRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420

Query: 421 NTELLF 426
           NTELLF
Sbjct: 421 NTELLF 426

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/426 (76%), Positives = 348/426 (81%), Gaps = 1/426 (0%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60
           M TQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQT+DQE LDK+S+QYNQYMSQLN
Sbjct: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLV EFQDIT RLNELAT P+ V     
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120

Query: 121 XXXXXXXXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
                        PRPLKIIERQR+CMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           K PAKN TLRAAKSHDTGLNKSKK SS DAYESFFKN+QRLSLTFF             T
Sbjct: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300
           +ILPNISTPPH+NVTAKGAEFEPLRRYNSHESILSNKPAP+MS SLG FP SF+KPS+PT
Sbjct: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300

Query: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360
           FGTS SNVQ +CHPTIT +MA RRNG +APSSKALLSSFI R +R   KQ+  NLKH S 
Sbjct: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360

Query: 361 LDKFNSSLSTISESFQXXXXXXXXXXXXXRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420
           LDKFNSSL+TISESFQ             RIS+L+HI   ++   IMDMSVSIEELQDAL
Sbjct: 361 LDKFNSSLTTISESFQ-SKKKKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDAL 419

Query: 421 NTELLF 426
           NTELL 
Sbjct: 420 NTELLL 425

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/426 (76%), Positives = 346/426 (81%), Gaps = 3/426 (0%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60
           MATQALEDITERLLIRSQEAILQLDLWIQRQQRSS+CQT+DQESLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLV EFQDIT RLNELATVP+       
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120

Query: 121 XXXXXXXXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
                        PRPLKIIERQR+CMVTPSKPPKKSVGFNPIN+VDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180

Query: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           K PA+NRTLRAAKSHDTGLNKSKK SS+D YESFFKN+QRLSLTFF             T
Sbjct: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300
           IILPNISTPPH+ VTAKGAEFEPLRRYNSHESILSNKPAP  SL+LG F  SF++PS+PT
Sbjct: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300

Query: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360
           FGTS SNVQV+CHPT+  +MA  RNG    SSKALLSSFIAR D    K++ TNLKH SF
Sbjct: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360

Query: 361 LDKFNSSLSTISESFQXXXXXXXXXXXXXRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420
           +DKFNSSLSTISESFQ             RIS  NH   QEQK N MD+SVSIEELQDAL
Sbjct: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERIS--NHNVAQEQKNN-MDISVSIEELQDAL 417

Query: 421 NTELLF 426
           NTELLF
Sbjct: 418 NTELLF 423

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/426 (73%), Positives = 336/426 (78%), Gaps = 5/426 (1%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60
           MATQALEDITERLL RS+EAILQLDLWIQRQQRSSVC+ SD++SLDKLSQQYNQYMSQLN
Sbjct: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
           SLYVRSESVRDKLSKEQ RRL TE+NEH+RIEDLVHEFQDIT RLN+LATVP+       
Sbjct: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120

Query: 121 XXXXXXXXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
                        PRPLKIIERQR+C+VTPSKPPKKSV FNPINDV+CPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180

Query: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXT 240
           K P K  TLRAAKSHDTGLNKSKK SSTDAYESFFKNKQRLSLTFF             T
Sbjct: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300
           IILPNISTP HM++  KGAEFEPLRRYNSHESILSNKPAP MSLSLG FP  F+KPS+PT
Sbjct: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFP--FFKPSNPT 298

Query: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360
           FGTS SNVQV+  P +  SM  +RNG  AP+SKALLSSFIA+PDRI  KQ  TNLKHTSF
Sbjct: 299 FGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSF 358

Query: 361 LDKFNSSLSTISESFQXXXXXXXXXXXXXRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420
           LDKFNSSLSTISESFQ             RI    HI   E   N+MDM VSIEELQDAL
Sbjct: 359 LDKFNSSLSTISESFQNKKGKKSSDLNDDRIP--PHIMP-EHNNNLMDMGVSIEELQDAL 415

Query: 421 NTELLF 426
           NTELL 
Sbjct: 416 NTELLL 421

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  193 bits (491), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 152/371 (40%), Positives = 200/371 (53%), Gaps = 41/371 (11%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYVR 65
           LED++ERLL RSQEAILQL+LWIQRQQ     + S   S+DKL  QYN Y++QLNSL VR
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDS---SIDKLGNQYNVYIAQLNSLCVR 59

Query: 66  SESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXXXXXXX 125
           SE VRDKL+KE++RR+ +  N+ + IEDLV EFQDIT +LNELA                
Sbjct: 60  SEYVRDKLNKERERRM-SIINDRKYIEDLVFEFQDITVKLNELAQ--SQSIDSTPSSKST 116

Query: 126 XXXXXXXXPRPLKIIERQ----RVCMVTP--SKPPKKSVGFNPINDV--DCPSKTNSLPC 177
                   PRPLK+ ER     +    +P  +K   KSV F+ ++D   +  SK  SLP 
Sbjct: 117 RSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176

Query: 178 SPKKPPAKNRTLRAAKSHDTGLN--KSKKMSSTDAYE--SFFKNKQRLSLTFFXXXXXXX 233
           SP +     R++R AKS+DTGLN   +KK   +  Y+  S F+  QRLS+T F       
Sbjct: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDFDEDA 236

Query: 234 XXXXXXTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSF 293
                   +   IS  P     A   +  PLRR+NSHESILS K  PI SL L     SF
Sbjct: 237 DSTSDQDTV---ISLVP-----ADDGKGLPLRRFNSHESILSTKVQPISSLPLF---SSF 285

Query: 294 YKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPT 353
             PS  +   S  +V+V   P  + + A         SS+ LLS+F+ RP + +   + T
Sbjct: 286 LLPS--SNRPSMKSVRVSSAPVFSKTSA-------PASSRDLLSTFVTRPGKAS---NAT 333

Query: 354 NLKHTSFLDKF 364
            +K  + L  F
Sbjct: 334 GIKQENKLGFF 344

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  185 bits (470), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 145/361 (40%), Positives = 183/361 (50%), Gaps = 47/361 (13%)

Query: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYV 64
           +L+DI+ERL IRSQEA+LQL+LWI+RQQ   + +   + + DK++ QYN YM+QLNSL V
Sbjct: 3   SLDDISERLFIRSQEAVLQLELWIRRQQH--LSEIEHEHARDKIADQYNLYMAQLNSLCV 60

Query: 65  RSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXXXXXX 124
           RSE VRDKL+   Q R     NE   IEDLV+EFQDIT +LNELA   +           
Sbjct: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118

Query: 125 XXXXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVG-FNPINDVD-------CPSKTNSLP 176
                    PRPLKI ER R  +    + P +  G    +N V+       CPSK  SLP
Sbjct: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178

Query: 177 CSPKK--PPAK--NRTLRAAKSHDTGLNKSKKMSSTDAYE----SFFKNKQRLSLTFFXX 228
            SP K   P +  +R LR AKS+DTGLN + +       E    S FK  QRLS+TF   
Sbjct: 179 GSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238

Query: 229 XXXXXXXXXXXTIILPNISTPPHMNVTAK-GAEFEPLRRYNSHESILSNKPAPIMSLSLG 287
                        ++     PP   +     +E  PLRRYNSH+S+LS K  PI S    
Sbjct: 239 IDEGSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKC- 297

Query: 288 GFPGSFYKPSHPTFGT-------STSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFI 340
                      PTF T       S  +V V   P I+ +      G  A SSK LLSSFI
Sbjct: 298 -----------PTFLTIPTANRPSMKSVTVSSAPIISST------GGKA-SSKDLLSSFI 339

Query: 341 A 341
           +
Sbjct: 340 S 340

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  166 bits (420), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 164/307 (53%), Gaps = 31/307 (10%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTS-DQESLDKLSQQYNQYMSQL 59
           M    ++D++ERLL+RSQEAILQLDLWIQRQQ+ +    + D+  L+K++  YN YMSQL
Sbjct: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60

Query: 60  NSLYVRSESVRDKLSKEQQRRLIT---------EDNEHQRIEDLVHEFQDITSRLNELAT 110
           NSLY+RS++VRDKL+ +++ R  T           N    IEDL+ EFQDIT +LN LA+
Sbjct: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAS 120

Query: 111 VPHGVXXXXXXXXXXXXXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVGFN--PINDVDC 168
                                  P+PLKI  ++   +    +  KK+V F+   + D++ 
Sbjct: 121 S-RRRCSSSKSSSSRSSSIGSFQPKPLKISLKRNKSL---KEQNKKTVTFDVEEVTDLNI 176

Query: 169 PSKTNSLPCSP----KKPPAKNRTLRAAKSHDTGLN-----KSKKMSSTDAYESFFKNKQ 219
            S   SLP SP    +  P  N  LR AKS+DTGLN     K KK      Y+S FKN Q
Sbjct: 177 NSVI-SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTFKNTQ 235

Query: 220 RLSLTFF---XXXXXXXXXXXXXTIILPNIST--PPHMNVTAKGAEFEPLRRYNSHESIL 274
           RLS++ F                T+I  +  T   P   +  +    +PLRRYNSHESIL
Sbjct: 236 RLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESIL 295

Query: 275 SNKPAPI 281
           S K  PI
Sbjct: 296 STKIRPI 302

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  147 bits (372), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 131/365 (35%), Positives = 182/365 (49%), Gaps = 45/365 (12%)

Query: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQES---LDKLSQQYNQYMSQLN 60
           + L +I+++LL+RSQEAILQLDL+IQRQQR    +T DQ     L KL Q+Y   ++QLN
Sbjct: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
           SL++RSE +RD+++    R   ++D +   I  LV EFQ IT++LNELA           
Sbjct: 61  SLHIRSEHLRDRIASTDHR--ASQDGDS--IGHLVTEFQKITTKLNELAATQD--RAYQS 114

Query: 121 XXXXXXXXXXXXXPRPLKIIERQRVCMVT-PSK----PPKKSVGF--NPIND----VDCP 169
                        P+PLKI+ER ++   T P+K    PPKK      NP  D        
Sbjct: 115 PGSQSTKSVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174

Query: 170 SKTNSLPCSPKKPPA------KNRTLRAAKSHDTGLNK-SKKMSSTDAYESFFKNKQRLS 222
           SK+ SLP SP    +      + R  R AKS D GLNK  ++   +D   +FFK  QRLS
Sbjct: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234

Query: 223 LTFFXXXXXXXXXXXXXTIILPNISTPPHMNVTAKG-AEFEPLRRYNSHESILSNK---P 278
           ++FF                   IS  P    + KG  + EPLRRYNSHES+LS K   P
Sbjct: 235 ISFFDDEIDYSSDEDTV------ISVSPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLP 288

Query: 279 A--PIMSLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALL 336
           A  P  +     + G   KP          +V ++  P  + +   R +     +SK LL
Sbjct: 289 AALPARAGWFSLWAGRNNKPK-----PMAESVSINDKPVYSTAALLRSHSKTTETSKDLL 343

Query: 337 SSFIA 341
           + F++
Sbjct: 344 AQFVS 348

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  145 bits (366), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 137/385 (35%), Positives = 187/385 (48%), Gaps = 61/385 (15%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQ--TSDQESLDKLSQQYNQYMSQLNSLY 63
           LED+T+RLLIRSQ+AILQL+LW+Q+Q++  +    + D++  + ++QQ N ++SQLNSL 
Sbjct: 4   LEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSLC 63

Query: 64  VRSESVRDKLSKEQQRRLITEDNEHQR--IEDLVHEFQDITSRLNELATVPHGVXXXXXX 121
           +RS  +++KL+ E   R I    + +R  IE+LV+EFQDI   LNEL+            
Sbjct: 64  LRSRYIKEKLASE---RNICSIRKGRRSYIENLVYEFQDIAMSLNELSET--NRKNGSPV 118

Query: 122 XXXXXXXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVGFNPI-----------NDVDCPS 170
                       P+PL+I+ERQR C      P K++     I           N  DC  
Sbjct: 119 SQATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNSNHIKIPRETEKSDFTENVADCLH 176

Query: 171 KTNSLPCSP-KKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFXXX 229
             +SLP SP +      +T+R  KS+   LN  K  S +      F  K RLSL  F   
Sbjct: 177 --SSLPSSPLRGSNGSQQTIRLTKSYHESLNGQKPTSHSPLMNP-FNAKNRLSLYLFDNI 233

Query: 230 XXXXXX------XXXXTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILS-NKPAPIM 282
                           T++    ++P    V +KGA FEPLRRYNSHESILS  K API 
Sbjct: 234 DEKELTPCDDDNSDQETVMY---NSP----VVSKGAAFEPLRRYNSHESILSVAKKAPIH 286

Query: 283 SLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTIT--VSMASRRNGCYAPSSKALLSSFI 340
           S         FY PS     TS  +V V   P  T  +S+ SR        SK LLSS  
Sbjct: 287 S---SAQKLQFY-PSATNGTTSAQSVFVSSKPVYTKPLSVQSR--------SKDLLSS-- 332

Query: 341 ARPDRIAAKQDPTNLKHTSFLDKFN 365
                IA  +   + K TS  + +N
Sbjct: 333 -----IAHAEASKDTKTTSVFNGWN 352

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  142 bits (359), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 132/432 (30%), Positives = 195/432 (45%), Gaps = 96/432 (22%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQR-------SSVCQTSDQ-----ESLDKLSQQYN 53
           LE+++E+LLIRSQEAILQLDLWI RQQ+        +   T ++     E+L+ L   Y+
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYD 67

Query: 54  QYMSQLNSLYVRSESVRDKLSKEQQRRLITEDN-EHQRIEDLVHEFQDITSRLNELATVP 112
            YMSQLNSLYVRSE +RDKL+ E+    + + N +H+ IE+LV EFQ+I  +LN+LA   
Sbjct: 68  LYMSQLNSLYVRSEFIRDKLNSEKNN--VNKFNLDHRNIEELVFEFQNIREKLNQLAASS 125

Query: 113 HGVXXXXXXXXXXXXXXXXXXPRPLKIIER--QRVCMVTPSKPPKKSVGFNPINDVDCPS 170
                                 +PLK++ +  +R+      K  +KSV F     +    
Sbjct: 126 KLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGKETRISLT- 184

Query: 171 KTNSLP----------CSPKKPPAKNRTLRAAKSHDTGLN---KSKKMSSTD-------A 210
            TN +            SP+    K + LR A S+DTGLN   KS K S+ +       A
Sbjct: 185 -TNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRKKNDAA 243

Query: 211 YESFFKNKQRLSLTFFXXXXXXXXXXX----------------------XXTII----LP 244
           Y+S FKNKQR S++ F                                   T+I    LP
Sbjct: 244 YDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQETVISSSHLP 303

Query: 245 NISTPP--------------HMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGG-- 288
            I+  P              + N      +   LRR NSHESILS K       ++G   
Sbjct: 304 CITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENTFYKNVGSNF 363

Query: 289 ----FPGSFYKPSHPTFGTSTSNVQ--------VDCHPTITVSMASRRNGCYAPSSKALL 336
                  SFY+P+  +  T+++N++           +  + + + S   G    +S+ LL
Sbjct: 364 YDRFIFSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQLPLTSSTRGV---TSRELL 420

Query: 337 SSFIARPDRIAA 348
           S F  +P+++ A
Sbjct: 421 SKFADKPEQLKA 432

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  138 bits (347), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 152/504 (30%), Positives = 220/504 (43%), Gaps = 104/504 (20%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQR---QQRSSVCQTSDQESLDKL-SQQYNQYM 56
           M+T  L+DITERLLIRSQEAILQLDLWIQR   QQ  S    S+  + D + +QQYN Y+
Sbjct: 1   MST-TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYL 59

Query: 57  SQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVX 116
           +QLNSL VR + +RDK      +   T+D E + IE+LV+EF+ IT +LN+L+       
Sbjct: 60  AQLNSLIVRVQYIRDKFLHNINQLDSTQD-EQKYIENLVYEFKQITLKLNDLSKKNKTTS 118

Query: 117 XXXXXXXXXXXXXXXXX--PRPLKIIERQRVCMVTPSKPPKKSVGFNPINDV----DCPS 170
                              P+PLKII+R +          K S   N  +D+    +   
Sbjct: 119 SSENSSKTASSKSSMESFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENLQ 171

Query: 171 KTNSLPCSPKKPPA------KNRTLRAAKSHD----------TGLNKSKKMSSTDAYESF 214
           + NSLP SP +  +        + LR  KS D          T  N  +K  + D    F
Sbjct: 172 RPNSLPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFEN-DTINQF 230

Query: 215 FKNKQRLSLTFFXXXXXXXXXXXXXT-------IILPNISTPPHMNVTAKGA------EF 261
           FK++QRLS+  F             T        +  N S      V ++G       +F
Sbjct: 231 FKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNS--DQATVISQGTIKRNDDDF 288

Query: 262 EPLRRYNSHESILSNK--PAPIM----SLSLGG---FPGSFYKPSHPTFGTSTSNVQVDC 312
            PLRRYNSHESILS K    P++    +L+         S  +PS  +       + V  
Sbjct: 289 TPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQS-------IHVTS 341

Query: 313 HPTITVSMASRRNGCYAPSSKALLSSFIAR--------------PDRIAAKQDPTNLKHT 358
           +P    S           +SK LLSSF+                  R  ++++     HT
Sbjct: 342 NPIFARS-------SQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHT 394

Query: 359 -------------SFLDKFNSSLSTISESFQXXXXXXXXXXXXXRISNLNHIATQEQ--- 402
                        +FL++FN   S  + +               R  N++   T +    
Sbjct: 395 INQTSTSSFFGNWNFLNRFNMITSETNTTTNRKRNYNIPLVNQSRAHNIDVNDTMDSISI 454

Query: 403 KKNIMDMSVSIEELQDALNTELLF 426
           K+ + D ++S+++L+DALNTELL 
Sbjct: 455 KEPVYDNTISLDDLEDALNTELLL 478

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  133 bits (334), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 216/457 (47%), Gaps = 64/457 (14%)

Query: 5   ALEDITERLLIRSQEAILQLDLWI--QRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      S  +S+++L  +Y +++ +LNSL
Sbjct: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62

Query: 63  YVRSESVRDKLSKEQQRRLITEDNE--HQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
           Y+RS+ ++DK+  E+  +     +E    RI++L+ EF++IT  LNE+A           
Sbjct: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122

Query: 121 --XXXXXXXXXXXXXPRPLKIIERQRVCMVTPSKPPKK-SVGFNPINDVDCPSKTNSLPC 177
                          P+PLKI+ R  +     + PPKK ++ F PI++    ++  SLP 
Sbjct: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYESLPS 182

Query: 178 SPKKP---PAKNRTLRAAKSHDTGLNKSK-KMSSTDAYESFFKNKQRLSLTFFXXXXX-- 231
           SP +      + + L  A+S  TGL   K +    +  + +FK+KQRLSLT F       
Sbjct: 183 SPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRLSLTLFGSADADD 242

Query: 232 -----XXXXXXXXTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILS--NKPAPIMSL 284
                        T+I    ++  ++   A   + +P+RR NSHES+LS  NK  P  + 
Sbjct: 243 GESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNNN 299

Query: 285 SLGG------FPGSFYKPSHPTFGT-STSNVQVDCHPTITVSMASRRNG-----CYAPSS 332
           +L        F       ++  F   S  N+QV    T T+S  SR          + +S
Sbjct: 300 NLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSG--TSTLSRFSREQDREMTQLGSKTS 357

Query: 333 KALLSSFI-ARPDRIAAKQDPTNLKHTSFLDKFNS--SLSTISESFQXXXXXXXXXXXXX 389
           K LL+S + A P  I  +++       +F DKFNS  + STISE                
Sbjct: 358 KDLLTSVMTATP--ITTQRN----NKLTFFDKFNSMFNFSTISEE--------------- 396

Query: 390 RISNLNHIATQEQKKNIMDMSVSIEELQDALNTELLF 426
           + + +    + E  +N     VSIEEL +AL T ++ 
Sbjct: 397 QKTTVEKNRSAESPRNDF---VSIEELNEALTTNMVM 430

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  129 bits (325), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 144/468 (30%), Positives = 207/468 (44%), Gaps = 85/468 (18%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSD---------------QESLDKLSQ 50
           L+DI+ERLL+RSQEAILQLD+WIQRQ+R       +               + +L +  +
Sbjct: 4   LQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLE 63

Query: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQQRRLITEDNEHQRIEDLVHEFQDITS 103
           QYN YM+QLNSL VR E +RD L        + QQ       +E + I+DLVHEFQDIT 
Sbjct: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123

Query: 104 RLNELATVPHGVXXXXXXXXXXXXXXXXXXPRPLKIIERQRV-CMVTPSKPPKKSVGFNP 162
           +L+EL+TV                      P+PL+II R      +       K V FN 
Sbjct: 124 KLSELSTV-RNPSTASSRSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182

Query: 163 INDVDCPSKTNSLPCSPKKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLS 222
               D  + + S   S +     +++LR  KS D  L +S   + +D +     ++QRLS
Sbjct: 183 ----DESNSSISHSRSMESLHENSKSLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236

Query: 223 LTFFXXX----------XXXXXXXXXXTIILPNISTPPHMNVTAKGAEFEPLRRYNSHES 272
           +  F                       T+I  +  TP       +GA+   LRRYNSHES
Sbjct: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVI--SHGTP------IRGADTPLLRRYNSHES 288

Query: 273 IL-------SNKPAPIMSLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRN 325
           IL       S +P  I+  S      S  +PS  +   +++ +     P  T        
Sbjct: 289 ILSFRKPTQSRQPNQILPYS------SVRQPSMQSVAVNSNPIFSRMRPNAT-------- 334

Query: 326 GCYAPSSKALLSSFIAR--PDRIAAKQDPTN----LKHTSFLDKFNSSLSTISESFQXXX 379
                 SK LLSSFI +  P+R+  ++   N        +F +KFNS  S I  +     
Sbjct: 335 ------SKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLY 388

Query: 380 XXXXXXXXXXRISNLNHI-ATQEQKKNIMDMSVSIEELQDALNTELLF 426
                        N N I ++   ++ + D S+ +E+L DALNTELL 
Sbjct: 389 PTNSSMSNKF---NPNDIPSSASIREPVFDDSLHLEDLNDALNTELLL 433

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  105 bits (262), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 96/321 (29%), Positives = 140/321 (43%), Gaps = 59/321 (18%)

Query: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQ---RSSVCQTSDQESLDKLSQQYNQYMS 57
           MA Q  E+++ RLL ++QEA+LQLDLWI+ QQ        + S  ESL++  + YN+YM 
Sbjct: 1   MALQ--EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMF 58

Query: 58  QLNSLYVRSESVRDKLSKEQQRRLITED------NEHQRIEDLVHEFQDITSRLNELATV 111
           QLNSLY+R++ +RDK+ K+    L   D      N H  ++ LV EF  ++ ++NEL+ +
Sbjct: 59  QLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAI 118

Query: 112 PHGVXXXXXXXXXXXXXXXXX--------XPRPLKIIERQRVCMVTPSKPPKKSVGFNPI 163
              V                          PRPLKI++RQ+            +   +P 
Sbjct: 119 QENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKH---------NNNQNTHPQ 169

Query: 164 NDVDCP------SKTNSLPCSPKKPPAKNRTLRAAKSHDTGL------------------ 199
            D++ P      S  N L  S KK     +   + KS +  L                  
Sbjct: 170 PDLESPLKLKHRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFS 229

Query: 200 --NKSKKMSSTDAYESFFKNKQRLSLTFFXXXXXXXXXXXXXTIILPN---ISTPPHMNV 254
             N   K S    + S FK   RLS+ F               I   +   +STP   + 
Sbjct: 230 VANTRNKNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTPKIASS 289

Query: 255 TAKGAEFEPLRRYNSHESILS 275
               +  EPLR++NSHESILS
Sbjct: 290 IKNTS--EPLRKFNSHESILS 308

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  104 bits (260), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 115/375 (30%), Positives = 177/375 (47%), Gaps = 65/375 (17%)

Query: 9   ITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLS-QQYNQYMSQLNSLYVRSE 67
           + ERL+IR  EA++QL+L IQR+    +C+     S   +  Q+Y  ++++L+SL +R+E
Sbjct: 7   VAERLVIRCNEAVMQLELSIQRK----MCEFDPNNSHCFIQVQEYYSFLARLSSLKLRAE 62

Query: 68  SVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXXXXXXXXX 127
            V++ L + Q++       E++ +E L++EFQDIT  LNE+A                  
Sbjct: 63  HVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVA---RAYQSPTKSARSGSS 118

Query: 128 XXXXXXP-RPLKIIERQRVCMV--TPSK---------------PPKKSVGFNPINDVDC- 168
                 P + LKIIER R  ++  +P K               P K++V F   +D+D  
Sbjct: 119 KESSVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQE-DDLDIL 177

Query: 169 -----PSKTNSLPCSP--------KKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFF 215
                  + NSLP SP        +    +++TLR AKS+D GLN   K    +A   FF
Sbjct: 178 HHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAK---KNADWEFF 234

Query: 216 KNKQRLSLTFFXXXXXXXXXXXXX-TIILPNISTPPHMNVTAKGAEFEPLRRYNSHESIL 274
           KNK RLSL+ F              ++  PNIS   +++        + +RR NSHESIL
Sbjct: 235 KNKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCNSHESIL 292

Query: 275 SNKPAPIMSLSLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPS--- 331
           S K   I+S S    P +      PT+ +      +   PTI+ S +   N   +P+   
Sbjct: 293 SRK---ILSPST---PANLIM--RPTYQSVWQKKAIVTKPTISCSTS---NSTASPTIGS 341

Query: 332 ---SKALLSSFIARP 343
              SK +LS F+  P
Sbjct: 342 PHLSKDMLSQFVTAP 356

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 118/461 (25%), Positives = 195/461 (42%), Gaps = 109/461 (23%)

Query: 9   ITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYVRSES 68
           +++ LL RS+EA+ QL+ W+++Q++     T++ + L+ L  + ++Y+S L  L   S S
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQLHQT-TAEYKQLNSLCAK-SKYISNL--LKDDSSS 60

Query: 69  VRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXXXXXXXXXX 128
           +   L ++++R  I        +E L+HEF +I+++LNE+ T                  
Sbjct: 61  IPHDLMEQKERSFI--------VESLIHEFNEISTKLNEIVT-----------HTSPQST 101

Query: 129 XXXXXPRPLKIIERQRVCM-------VTPSKPPKK-SVGFNPINDVDCPSKTNSLPCSPK 180
                P+PL ++ + ++         VT  +  +K S+   P++     +K NS+P SPK
Sbjct: 102 IDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMH---TTTKCNSVPTSPK 158

Query: 181 ---KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFXXXXX------ 231
                    RTLR  KS+  GLN          Y + FK   RLS++FF           
Sbjct: 159 CKSTSTLNQRTLRNIKSYHYGLNGD--------YINPFKENNRLSISFFNGDNTFNDNNS 210

Query: 232 --XXXXXXXXTIIL--PNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKP---APIMSL 284
                     T+++  P ++ P            + L+R NS +S+  N+     P    
Sbjct: 211 DSESDIDDDDTVLVTSPFLTNPK-----------QKLKRSNSQDSVFWNENYLRKPSFQK 259

Query: 285 SLGGFPGSFYKPSHPTFGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPD 344
            L  FP +  KP+        S+ QV    T          G    SSKALL+SF+   D
Sbjct: 260 QLNLFPSTLTKPT-----AELSSTQVFLKNT----------GRLGSSSKALLTSFVK--D 302

Query: 345 RIAAKQDPTNLKHTSFLDKFNSSLSTISE-------------------SFQXXXXXXXXX 385
            +  +Q   N   +SF + FNS  S I +                   S           
Sbjct: 303 NLQQQQRTHNA--SSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVISTLITSKK 360

Query: 386 XXXXRISNLNHIATQEQKKNIMDMSVSIEELQDALNTELLF 426
               R S++++I+    KK I++  V   +L DALNTE L+
Sbjct: 361 SRFNRFSSVDNIS--PTKKPIINNDVQYSDLNDALNTEFLY 399

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 116/246 (47%), Gaps = 36/246 (14%)

Query: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQ---ESLDKLSQQYNQYMSQLN 60
           + L  I +  L RS+EA+++L+  + +Q+R    + SDQ   E       QY  Y+ QLN
Sbjct: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
            LY++++S++D +     R     ++  + IE L H+++ + +  NEL      +     
Sbjct: 62  CLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNL--EDS 116

Query: 121 XXXXXXXXXXXXXPRPLKIIERQ---------RVCMVTPSKPPKKSVGFNPINDV--DCP 169
                        P+PLKIIER+         +VC  T         G +  +D   D  
Sbjct: 117 PSCLSPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEI 176

Query: 170 SKTNSL----PCS--PKKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYE---SFFKNKQR 220
            KTNS     PC+   KK P   + +R  KS  TGLNK      ++ +E   SFF+++QR
Sbjct: 177 GKTNSCNTNSPCTNEAKKEP---KFIRVVKSCGTGLNK-----HSNPHENRLSFFRDRQR 228

Query: 221 LSLTFF 226
           LS++F 
Sbjct: 229 LSISFI 234

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 119/241 (49%), Gaps = 27/241 (11%)

Query: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLS---QQYNQYMSQLN 60
           + L++I +  L  SQ A+ +LD  ++RQ+R       DQ   DK S    QY +Y+ QL 
Sbjct: 2   EQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLY 61

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVXXXXX 120
           SLY +++ + D +     + L +   + + IE+L+ EFQ+I    N+   + + +     
Sbjct: 62  SLYTKAQKLSDTVILSDSKSLSSV--QQRAIENLIQEFQEIAK--NDENFISYSM--RES 115

Query: 121 XXXXXXXXXXXXXPRPLKIIERQRVCMVTPSK---PPKKSVGFNPINDVDCPSKTN---- 173
                        P+PLKI++R++  + +P+K    P  S+  N  ++ +  + ++    
Sbjct: 116 PNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQE 175

Query: 174 ----SLPCS-----PKKPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLT 224
               S P S     P    A    +R+AKS D GLN  ++ +  +   +FFK++QRLS++
Sbjct: 176 RLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN--RRSNPHENRLNFFKDRQRLSIS 233

Query: 225 F 225
           F
Sbjct: 234 F 234

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 66/158 (41%), Gaps = 31/158 (19%)

Query: 12  RLLIRSQEAILQLDLWIQRQQR---------------------SSVCQTSDQESL-DKLS 49
           RLL R QE+++ L+L IQ                            C+++ Q+S  D+ +
Sbjct: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQRT 69

Query: 50  QQYNQY---MSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLN 106
           +Q  +Y   M+ L SL +R++ + DK  K      I  D     ++ L  EF+DI+  L 
Sbjct: 70  EQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----VKKLGSEFEDISHNLC 125

Query: 107 ELATVPHGVXXXXXXXXXXXXXXXXXXPRPLKIIERQR 144
            L   P+ V                   RPLK+++R R
Sbjct: 126 FLE--PNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR 161

>Kpol_1031.16 s1031 complement(41507..41857) [351 bp, 116 aa] {ON}
           complement(41507..41857) [351 nt, 117 aa]
          Length = 116

 Score = 32.3 bits (72), Expect = 0.73,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 45  LDKLSQQYNQYMSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSR 104
           +DKLS  Y+  + ++N  YV S  ++ K   ++Q  LI+++     ++  +  F+DI S+
Sbjct: 20  IDKLSVDYDYLLYKIND-YVNSIQIQTKEVCQRQNELISQNVVEDIVDVNIQSFKDILSK 78

Query: 105 LNEL 108
             EL
Sbjct: 79  CEEL 82

>TDEL0E00900 Chr5 (183627..189782) [6156 bp, 2051 aa] {ON} Anc_4.280
           YKL182W
          Length = 2051

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 10/72 (13%)

Query: 183 PAKNRT-LRAAKSHDTGLNKSKKMSSTDAYESFFKN-KQRLSLTFFXXXXXXXXXXXXXT 240
           P + R+ L  A  H  GL  +  ++  D++ESFF++ K+ +SL FF              
Sbjct: 261 PGELRSHLNGATGHSQGLATAVAIAEADSWESFFESMKKAISLLFFIGVHCY-------- 312

Query: 241 IILPNISTPPHM 252
           +  PN S PP +
Sbjct: 313 LAYPNTSLPPSI 324

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 28/38 (73%), Gaps = 2/38 (5%)

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNE 107
           +DKLSKEQ+ +L+  + E +R ED++ +  ++T +LNE
Sbjct: 154 KDKLSKEQREKLL--EMEKKRREDMMKQVDELTEKLNE 189

>CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa]
           {ON} similar to uniprot|P32855 Saccharomyces cerevisiae
           YPR055w SEC8 transport protein
          Length = 1014

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 3   TQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSL 62
           TQA+  IT     +SQ+ IL+L   ++      V   SD E L+  S +YNQ +  LNS+
Sbjct: 109 TQAVNAIT-----KSQQKILELKDSVREANHKFVLDKSDLEDLNNQSLKYNQVIEDLNSI 163

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 32/44 (72%), Gaps = 3/44 (6%)

Query: 65  RSESVR-DKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNE 107
           ++ES++ DKLSKEQ+ +L+  + E +R ED++ +  ++  +LNE
Sbjct: 148 KAESLKKDKLSKEQREKLL--EMERKRREDMMKQVDELAEKLNE 189

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
           CAJ1Nuclear type II J heat shock protein of the E. coli
           dnaJ family, contains a leucine zipper-like motif, binds
           to non-native substrates for presentation to Ssa3p, may
           function during protein translocation, assembly and
           disassembly
          Length = 391

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 32/44 (72%), Gaps = 3/44 (6%)

Query: 65  RSESVR-DKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNE 107
           ++ES++ DKLSKEQ+ +L+  + E +R ED++ +  ++  +LNE
Sbjct: 148 KAESLKKDKLSKEQREKLM--EMEKKRREDMMKQVDELAEKLNE 189

>KLLA0A09427g Chr1 complement(821244..824279) [3036 bp, 1011 aa]
           {ON} similar to uniprot|P07276 Saccharomyces cerevisiae
           YGR258C RAD2 Single-stranded DNA endonuclease cleaves
           single-stranded DNA during nucleotide excision repair to
           excise damaged DNA subunit of Nucleotide Excision Repair
           Factor 3 (NEF3) homolog of human XPG protein
          Length = 1011

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 10/97 (10%)

Query: 10  TERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYVRSESV 69
           +E    R Q  IL  D +   ++R +   T +QE        YN + S LN   V +  +
Sbjct: 676 SESAATREQLPILDYDFYEDEEERLAEQLTREQED-------YNHFKSTLNPNLVNTAFL 728

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLN 106
            D+L ++Q++     D +   IE ++HE Q + SR  
Sbjct: 729 EDELFEQQKKD--KRDADEVTIE-MIHEIQSLLSRFG 762

>Skud_13.221 Chr13 (374262..375767) [1506 bp, 501 aa] {ON} YMR065W
           (REAL)
          Length = 501

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 94/219 (42%), Gaps = 23/219 (10%)

Query: 12  RLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSLYVRSESVRD 71
           R +  S   IL+ DL + R + + V   + ++   ++ ++ NQ +  +NS++     + D
Sbjct: 202 RNMTESNRIILESDLSLFRSKVNDVLYDTSEQLEVQIIEKNNQLLDNVNSIHRTMSELTD 261

Query: 72  KLSKEQQRRLITE--DNEHQRIEDLV---HEFQDITSRLNELATVPHGVXXXXXXXXXXX 126
           +L+K   R  I +  D     ++DLV   H+ ++  SR NEL      V           
Sbjct: 262 ELNKGDMRSKIYDLKDENLNNLQDLVEMSHDVKEYYSRNNEL------VNAELENFLIDL 315

Query: 127 XXXXXXXPRPLKIIERQRVCMVTPSKPPKKSVGFNPI-NDVDCPSKTNSLPCSPKKPPAK 185
                   R L   + + + ++          GFN I +D   PS TN +   P+    K
Sbjct: 316 KTQLGATSRDLSESQIEAIDLLQ---------GFNSILHDSLLPSITNEIV--PEMKNFK 364

Query: 186 NRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLT 224
           N  L+   +  + LNK   + + + + +F +  ++L+ T
Sbjct: 365 NSVLQEWTAMTSTLNKDFALWNEEIFSTFSEISEKLNGT 403

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {ON}
           Anc_7.217 YER048C
          Length = 396

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNE 107
           R+KL+KEQ+ +L+  + E +R EDL  +  D+T +LNE
Sbjct: 159 RNKLTKEQREKLM--ELEKRRREDLEKQVVDLTKKLNE 194

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 28/38 (73%), Gaps = 2/38 (5%)

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNE 107
           +D+LSKEQ+++L+  + E +R ED++ +  ++  +LNE
Sbjct: 154 KDRLSKEQRKKLL--EMERKRREDMMKQVDELAVKLNE 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,184,776
Number of extensions: 1521947
Number of successful extensions: 7594
Number of sequences better than 10.0: 97
Number of HSP's gapped: 7856
Number of HSP's successfully gapped: 100
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)