Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_3.11.3ON36036017760.0
Smik_3.121.3ON36036015880.0
Suva_3.1501.3ON36136115680.0
YCL064C (CHA1)1.3ON36036015680.0
NCAS0B091301.3ON36734212931e-179
NDAI0A001201.3ON37736812341e-170
KNAG0C001801.3ON35934012271e-169
KAFR0D001101.3ON36536511841e-162
TPHA0E040401.3ON35733611671e-160
Kpol_2002.61.3ON35034811561e-158
CAGL0B00286g1.3ON36033611001e-150
TBLA0A049201.3ON36035810921e-148
ZYRO0F15774gsingletonON41036010751e-145
KAFR0I00130singletonON34434210451e-142
KAFR0F04430singletonON34334010351e-140
NCAS0A15330singletonON34734010311e-139
SAKL0C00418g1.3ON3643449681e-130
NDAI0K02950singletonON3343289391e-125
KLTH0F00440g1.3ON3413318591e-113
ZYRO0F18524g1.3ON3353318551e-113
KLLA0C00440g1.3ON3773308431e-110
Ecym_10061.3ON3643398381e-110
KNAG0D05380singletonON3343338341e-110
SAKL0C13904gsingletonON3393308321e-109
Smik_9.2na 1ON3383238301e-109
AFR747W1.3ON4263648341e-108
Scer_YGOB_SDL1 (SDL1)na 1ON3373238061e-105
Skud_9.2na 1ON3393267951e-104
TDEL0D06540singletonON3373247531e-97
KLLA0E01805gsingletonON3223217155e-92
KNAG0A01150singletonON2312215441e-67
YIL167W (SDL1)singletonOFF2101895342e-66
YIL168WsingletonOFF1271202852e-30
SAKL0F11858g7.367ON5622671721e-12
KAFR0K017007.367ON5792501622e-11
SAKL0A10626gsingletonON3203171574e-11
Suva_5.1997.367ON5762721561e-10
NCAS0A142307.367ON5692641561e-10
YER086W (ILV1)7.367ON5762811552e-10
CAGL0I05126g7.367ON5712641542e-10
Skud_5.2057.367ON5762721542e-10
Smik_5.2257.367ON5762811523e-10
NDAI0A018107.367ON5702501523e-10
Kpol_530.167.367ON5662501505e-10
TDEL0C018007.367ON5692641481e-09
Ecym_47087.367ON5702861472e-09
ZYRO0B02772g7.367ON5692501462e-09
TPHA0F031307.367ON5682641453e-09
KLLA0E19779g7.367ON5672861443e-09
TBLA0C050707.367ON5752541409e-09
YKL218C (SRY1)na 2ON3263181381e-08
ACR232C7.367ON5602501363e-08
KNAG0C036907.367ON5772641346e-08
Kwal_33.148227.367ON5622641222e-06
Skud_11.2na 2ON3263141175e-06
KLTH0B04884g7.367ON5732641104e-05
KLLA0A11814g5.157ON30235741.1
Smik_11.3na 2ON269254731.1
TBLA0E012304.148ON399156712.4
NCAS0I011203.357ON159108683.5
SAKL0H23144g4.148ON390161694.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_3.1
         (360 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   688   0.0  
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   616   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   608   0.0  
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   608   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    502   e-179
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   479   e-170
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   477   e-169
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   460   e-162
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   454   e-160
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   449   e-158
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   428   e-150
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   425   e-148
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   418   e-145
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   407   e-142
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              403   e-140
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            401   e-139
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   377   e-130
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             366   e-125
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   335   e-113
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   333   e-113
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   329   e-110
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   327   e-110
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   325   e-110
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   325   e-109
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      324   e-109
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   325   e-108
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   315   e-105
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      310   e-104
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            294   1e-97
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   280   5e-92
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   214   1e-67
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   210   2e-66
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   114   2e-30
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    71   1e-12
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    67   2e-11
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    65   4e-11
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    65   1e-10
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    65   1e-10
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    64   2e-10
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    64   2e-10
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    64   2e-10
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    63   3e-10
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    63   3e-10
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    62   5e-10
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    62   1e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    61   2e-09
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    61   2e-09
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    60   3e-09
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    60   3e-09
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    59   9e-09
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    58   1e-08
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    57   3e-08
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    56   6e-08
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    52   2e-06
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    50   5e-06
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    47   4e-05
KLLA0A11814g Chr1 (1021526..1022434) [909 bp, 302 aa] {ON} highl...    33   1.1  
Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON} YKL...    33   1.1  
TBLA0E01230 Chr5 complement(272660..273859) [1200 bp, 399 aa] {O...    32   2.4  
NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON...    31   3.5  
SAKL0H23144g Chr8 (2005986..2007158) [1173 bp, 390 aa] {ON} high...    31   4.4  

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/360 (93%), Positives = 335/360 (93%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
           QVF            TTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT
Sbjct: 61  QVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV
Sbjct: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
           VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTILKSA 360
           LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTILKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTILKSA 360

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/360 (81%), Positives = 316/360 (87%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           MSIVYNKTPLLRQFFP KSPAQFFLKYECLQPSGSFKSRGIGNLI+K+AIRIQKDG++SP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
           Q+F            T CQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIV+GAYWKEADT
Sbjct: 61  QIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           FLKA++M +ID+QVVEPIYVHPFDNPDIWEGHSSMVDE+VQDL+ QRISMNKVKGIVCSV
Sbjct: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ERY LADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
           VISNQTF+YA KYNT+SVVIEDKDVI+TCLKYTHQ NMV EPACGAALHLGY+TEILE+A
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTILKSA 360
           LGSKLAADDIVIIIACGGSSNT+QDLEE L+   K+  PAIE  DNFIF EKT+  LKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATLKSA 360

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/361 (81%), Positives = 314/361 (86%), Gaps = 1/361 (0%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           MSIVYNKTPLLRQFFP KS AQF+LKYECLQPSGSFKSRGIGNLILKNAIRIQK+G+RSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
           QVF            T CQRLSLPCTVVVPTATK+RMVEKIRNTGAQVIVNGA+WKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           +LK N+MN ID Q VEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQR+ M KVKGIVCSV
Sbjct: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ER+ LADKIPIVGVET GCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
            ISNQTFEYA KYNTKSVV+EDKDVIETCLKY+HQ NMV EPACGAALHLGYHT+ILE A
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEK-TSTILKS 359
           L +KLAADDIV+IIACGGSSNTVQDLEETL  +KK+G+PAIE ADNFIF EK +STILKS
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEKISSTILKS 360

Query: 360 A 360
           A
Sbjct: 361 A 361

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/360 (81%), Positives = 314/360 (87%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           MSIVYNKTPLLRQFFP K+ AQFFLKYECLQPSGSFKSRGIGNLI+K+AIRIQKDG+RSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
           QVF            T CQRLSLPCTVVVPTATKKRMV+KIRNTGAQVIV+GAYWKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           FLK N+MN+IDSQV+EPIYVHPFDNPDIWEGHSSM+DEIVQDLKSQ IS+NKVKGIVCSV
Sbjct: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        ERY LAD+IPIVGVETNGCHVFNTSL+IGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
           VISNQTFEYA KYNT+SVVIEDKDVIETCLKYTHQ NMV EPACGAALHLGY+T+ILE A
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTILKSA 360
           LGSKLAADDIVIIIACGGSSNT++DLEE L+ ++K+  P IE ADNFIF EK    LKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEKNIVNLKSA 360

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  502 bits (1293), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/342 (70%), Positives = 276/342 (80%), Gaps = 6/342 (1%)

Query: 1   MSIVYNKTPLLRQFFP------SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           MSIVYNKTPLLRQFFP      S S  QFFLKYECLQPSGSFKSRGIGNLI+KNAIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  DGRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114
            G +SPQVF            T  QRLSLPCTVVVPTATK+RMVEKIR TGA VI+NGA+
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 115 WKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVK 174
           WKEADT+LK+++MN ID    EPIYVHPFDNPDIWEGHS+MVDEIV  L  Q I++NK+K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
           GIVCSV             E++ LADKIPIVGVET GCHVFNTSL++G+ ++F KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHT 294
           TSLGTA IS+QTFEYA KY+T+SVV+ED DVIETCLKYT   NMVAEPACGA+LHL Y+T
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 EILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQ 336
            ILE ALG KL++DDI+++IACGGSSNTVQDLEETL  L+++
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREK 342

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  479 bits (1234), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 238/368 (64%), Positives = 281/368 (76%), Gaps = 15/368 (4%)

Query: 1   MSIVYNKTPLLRQFFP---SKSPA--------QFFLKYECLQPSGSFKSRGIGNLILKNA 49
           MS+VYNKTPLLRQFF    +KS A        QFF+KYECLQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  IRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVI 109
           + I K G+++PQVF            T CQRLSLPCTVVVPTATK+RMVEKI++TGA VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 110 VNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRIS 169
           +NGA+WKEAD FLK +IMN+ID+  +EPIYVHPFDNP IWEGH++MVDEI+  L  Q I 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 170 MNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229
           +NKVKGIVCSV             ++Y+LADKIPIVGVET GCHVFNTSL++ + ++F K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 230 ITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALH 289
           ITSIATSLGTA IS +TFEYA KY T+SVVIEDK+VIETCLKYT   NMV EPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 290 LGYHTEILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLK---KQGL-PAIETAD 345
           L YHT+ILEK+LG KL +DDI+++IACGGSSNT  DLE  L ++K   KQ L  +  T  
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360

Query: 346 NFIFVEKT 353
           NFI  E T
Sbjct: 361 NFIDTENT 368

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  477 bits (1227), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/340 (66%), Positives = 265/340 (77%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           MS+VYNKTPLLRQFFP K+  Q FLKYECLQPSGSFKSRGIGNLILKNA+RIQK G R  
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
            VF            T CQRLSLPCTVVVPTATK RMVEKIRNTGA+VIVNGA+WKEAD 
Sbjct: 61  HVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
            LK  +M+QID +  EPIYVHPFDNPDIWEGH+++VDEI++ L SQ+I    VKGIVCSV
Sbjct: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E++ LA+KIPIVGVET GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
            IS QTFE A KYNT+SVV++D  VIETCLKYT   NMVAEPACGAALHL Y+ +ILEKA
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPA 340
           LG  L  +D++++IACGGSSNT++DLE+TL  L  + +P+
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  460 bits (1184), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/365 (60%), Positives = 275/365 (75%), Gaps = 7/365 (1%)

Query: 1   MSIVYNKTPLLRQFFP------SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           MS+VYNKTPLLRQFFP      S S  QFFLKYECLQPSGSFKSRGIGNLILK A++I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  DGRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114
            G + P+VF              CQRLSLPCTVVVPTATK+RM+EKI++TGA VI++GA+
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 115 WKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVK 174
           WKEAD +LK ++MN+I+   ++PIYVHPFDNP IWEGHSS+VDEI+  L+ Q++  + +K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
           GIVCSV             ER+ L DKIP+VGVET GCHVFNTSL++G+ V+F+KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHT 294
           TSL TA IS +TFE A KY T+SV+++D DVIETCLKYT   NMV EPACGA++HL Y+ 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 EILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTS 354
           +ILE ALG+KL  DD V++IACGGSSNT+QD+EETL  L+ +   A+   + F+ V K  
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFLKVNK-E 359

Query: 355 TILKS 359
           T LK+
Sbjct: 360 TFLKN 364

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  454 bits (1167), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/336 (63%), Positives = 259/336 (77%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           MS VYNKTPLLR  FP K+  Q FLKYEC QPSGSFKSRGIGNLI   ++ IQK+ ++SP
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
           +VF            T  + LSLPCTVVVPTATK RMVEKI+ TGA VIV G +WKEADT
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           +LK N+++ ID +++EPIYVHPFDN  IWEGH++M+DEIV+    Q I + KVK IVCSV
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E++ LA KIP+VGVET GCHVFNTSL++G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
            ISNQTFEYA KYNTKS+V++D  V+ETCLK+T   NMVAEPACGAALH+GY+ +ILEK+
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQ 336
           LG KLA DDIV+IIACGGSSNTVQ+LE +L +LK +
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNK 336

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  449 bits (1156), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 224/348 (64%), Positives = 268/348 (77%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           MS+VYNKTPLL+ FFP K+  QF+LKYE LQPSGSFKSRGIGNLILKNAIRI+K   + P
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
            VF            T  QRLSLPCTVVVPTATK+RMV+KIR TGA VI+ G +WKEAD 
Sbjct: 61  YVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           FLK NIMN+I+   +EPIYVHPFDNP IWEGHS+MVDEI++    Q+ ++  +K IVCSV
Sbjct: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E+Y+LADKIP+VGVET GCHVFNTSL++ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
            ISNQ F+YA KYNTKSVV+EDKDV+ETCLK+TH  NMV EPACGAA+HLGYHT++LE A
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFI 348
           LG+KL  DD V+I+ACGGSSNTV++LE  L +L  +   A  T  +FI
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  428 bits (1100), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 257/336 (76%), Gaps = 5/336 (1%)

Query: 4   VYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDG-RRSPQV 62
           VYNKTPL+RQ FPS    Q +LK+EC QPSGSFKSRGIG+LI K + RI  +G  + P V
Sbjct: 3   VYNKTPLIRQIFPSI--PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
           F            T  + L+LPCTVV+PTATK+RM +KIR TGA VIV+G +WKEAD +L
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 123 KANIMNQIDS--QVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           K NI+++++   + VEPIYVHPFDNPDIWEGH+SMVDEIV+D K++ I +NK+K IVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E+Y+LADKIPIVGVET GCHVFNTSLR+ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
            IS + F+YA +Y TKSVV+ D+DV++TCL+YTH  NMV EPACGAA+HL YHTEILEK 
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQ 336
           LG+KL ADDIV+++ACGGSSNTV+D+E  L+ L  +
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTE 336

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  425 bits (1092), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 209/358 (58%), Positives = 261/358 (72%), Gaps = 3/358 (0%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDG-RRS 59
           MSIVYNKTPLLRQFF      QFFLKYEC+QPSGSFKSRGIGNLILK+  +I      + 
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 60  PQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEAD 119
           PQVF            T  +RLS+PCTVVVPTATK+RMV KI++TGA+VIVNG +W EAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 120 TFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCS 179
            +L+ +++N+ID   +EPIYVHPFDNP IWEGHS+M+DEI++ L  Q I +  VK I CS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 180 VXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
           +             E+Y+LA KIPI+GVETNGC VFNTSL++ + V+F KI +IATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 240 AVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEK 299
           + IS +TFE A KYNTKSVV+++ DVI+TCL+YT+  N VAEPACGAALHL Y+T ++E 
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 300 ALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTIL 357
           AL + L  DDI+I+IACGGSSNTVQ+LEE L  LK +   ++     +IF E  + IL
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEAL--LKYKLDYSLPQTPEYIFTENHTPIL 356

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  418 bits (1075), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 194/360 (53%), Positives = 261/360 (72%), Gaps = 9/360 (2%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           M  +YNKTPLL+Q F   + AQ F+KYECLQPSGSFKSRGIG+LI K A  IQ DGR+SP
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGRKSP 106

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
            VF               Q+L+LPCTVV+PT TK+RM +KIR  GA V+V G++WKEAD+
Sbjct: 107 HVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADS 166

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
            LK  + NQ++  ++EPIYVHPFDNP IWEGH+S+VDEI+  LK++  ++N+VKGIVCSV
Sbjct: 167 HLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCSV 226

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E+Y+LA+KIP++ VET GCHV NTSL++GQ V+F K+ S+ATSL T+
Sbjct: 227 GGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCTS 286

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
            IS++T +Y  KY +KS+V+EDK+V++TCLKY    NM+ EPACGA+LHLGYH +++E+A
Sbjct: 287 QISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIERA 346

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDL--------KKQGLPAIETADNFIFVEK 352
           LG  L  DD++I+IACGGSSNT+ DLEE+L  L        ++   P++E  +N I+ ++
Sbjct: 347 LGKNLDKDDVIIVIACGGSSNTILDLEESLAKLEEAPHLSIRRNATPSLE-HENIIYPKR 405

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  407 bits (1045), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 189/342 (55%), Positives = 256/342 (74%), Gaps = 6/342 (1%)

Query: 1   MSIVYNKTPLLRQFFP------SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           M IVYNKTPL+ Q FP      S S  Q  +KYE LQPSGSFKSRGIGNL+ + A++IQK
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  DGRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114
           +  ++P+VF               Q+LSLPCTVVVP ATK+RM+EKIR+TGA+V ++G +
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 115 WKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVK 174
           WK AD ++K +++N+I+++ VEPIYVHP D+P IWEG+S +VDE+++ L+ Q+I  +KVK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
            IVCSV             ERY LADKIPIVGVET+G HVFNT L+ G+ ++F+KI+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHT 294
           TSLG+A I+ +TFEYA KY  + V+++D +V+ETCL+YT   NM+ EPACGAA+HL YH 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 EILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQ 336
           +ILEKAL ++L  DD+VIIIACGGSSN++ D+EETL+ +K +
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSE 342

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  403 bits (1035), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 186/340 (54%), Positives = 252/340 (74%), Gaps = 6/340 (1%)

Query: 1   MSIVYNKTPLLRQFF------PSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           M  VYNKTPLLR +F       S S  Q F KYE  QP  SFKSRGIGNLILKNA ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  DGRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114
           +G ++ +VF              C+ LS+PCTVVVP++TK RMVEKIR+TGAQVIV+G +
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 115 WKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVK 174
           WKEAD +L+ +++N++DS  VEP+YVHPFD+P IWEGHS+++DEIV+ L  + +  +KVK
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 175 GIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
           G+VCS+             ER+ LADKIP++ VET GCHVFNT L +G+ V+F+KI+SIA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 235 TSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHT 294
           TSLG+  IS +TFEYA KY++K VV++D DV+ETCL+Y+   NM+ EPAC A++HL Y+ 
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 295 EILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLK 334
           +ILE+AL  KL+ DD++IIIACGGS+ T+QD++++L  LK
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLK 340

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  401 bits (1031), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 250/340 (73%), Gaps = 5/340 (1%)

Query: 1   MSIVYNKTPLLRQFFPSK----SPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDG 56
           MS+VYNKTPLLR+ FP+     S  Q ++KYE LQPSGSFKSRGIG+LI+KNA+R+Q+ G
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  RRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWK 116
            +S  VF            T  Q L LPCTVVVPT+TK RMVEKIRN G +VIV G++WK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 117 EADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGI 176
           EAD+FLK +++  +D ++ EPIYVHPFD+PD+WEGHS+MVDEIV   +SQ +S+NKVK I
Sbjct: 121 EADSFLKNSVIPSVD-RIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATS 236
           VCSV             E+YHLADKIP++ +ET+GC+ FN  L+  + V+  KITS+ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEI 296
           LG   ++ + FE   +Y + SVV++D DV+ TCLKY +  N++ EPACGA+LH+ Y+T++
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQ 336
           +EKALG KL +DDI++IIACGGS+NT++DL+ + + L  +
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAE 339

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  377 bits (968), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 182/344 (52%), Positives = 233/344 (67%), Gaps = 3/344 (0%)

Query: 1   MSIVYNKTPLLRQFFPSK---SPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGR 57
           M+  Y+KTPLLR+ FPS    +  QF +KYE  QPSGSFKSRGIG+LI ++A RI+ +G 
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 58  RSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKE 117
           ++  VF            T C+  SLPCTVVVPT T  RMV KIR TGA VIV+G +W +
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 118 ADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIV 177
           AD +L  ++M  ID+   EP+Y HPFDNP IWEGHS++VDEIV+ L+ QRI  ++VKGIV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 178 CSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSL 237
           CS+             E++ LA  IPI+GVET GC VF+ SL+ G+P+ F KITS+ATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 238 GTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEIL 297
           GTA I  +T E A KYNTKSVV+ D DV+ TCL +    N+V EPACGA+LH GY+  +L
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 298 EKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAI 341
           E  LG  L  +DI+I+IACGGSS TVQDL++    L +   P+ 
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLGRPLTPSF 344

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  366 bits (939), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 177/328 (53%), Positives = 233/328 (71%), Gaps = 2/328 (0%)

Query: 1   MSIVYNKTPLLRQFFPS-KSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRS 59
           MS +YNKTPLLRQ F S K   + FLKYE LQPSGSFKSRGIG LIL++  ++++DG ++
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGNKT 60

Query: 60  PQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEAD 119
             VF            T  + L +PCTVVVP +TK+RMV KIR TGA V++ G +WKEAD
Sbjct: 61  AHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEAD 120

Query: 120 TFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCS 179
            FL+ + M ++D+   +PIYVHPFD+P IWEGHS+++DEIVQ L++++IS+ KVKGI+CS
Sbjct: 121 DFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICS 179

Query: 180 VXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
           V             ER++LA  IP++ VET GC V N SL+ G PVQ  KITS+ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGS 239

Query: 240 AVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEK 299
             IS+  FE A KYN++S+ + DKDV+ETCLKY    +M  EPACGA++HL Y+  I+E 
Sbjct: 240 TYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVES 299

Query: 300 ALGSKLAADDIVIIIACGGSSNTVQDLE 327
           ALG+ L+  DIVI++ CGGSS T+ DLE
Sbjct: 300 ALGTALSNHDIVIVVLCGGSSCTLHDLE 327

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  335 bits (859), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 164/331 (49%), Positives = 220/331 (66%), Gaps = 5/331 (1%)

Query: 1   MSIVYNKTPLLRQFFPSKS-----PAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKD 55
           M   + KTPLL  +F + S       QF LK E LQPSGSFKSRGIG +I K AI+I+ +
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  GRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYW 115
           G + P VF            TT + LS+PC+VVVP +T  RMV+KI N GA+V V G  W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 116 KEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKG 175
           KEAD FLK +I++  +    + IY HPFD+P IWEGHSS+VDEI+  LK Q+I +  +K 
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 176 IVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSV              R+ L  KIPI+GVE+ GC VFN+SL++G+  +F+ ITSIAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 236 SLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTE 295
           S+GT  IS +T E A +Y+TKSVV+ D+++I TCL++  + N++ EPACGAALHLGY+ +
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 296 ILEKALGSKLAADDIVIIIACGGSSNTVQDL 326
           IL +AL S    +D++I+I CGGS+ +  DL
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  333 bits (855), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 219/331 (66%), Gaps = 11/331 (3%)

Query: 1   MSIVYNKTPLLRQFFPSKSPA---QFFLKYECLQPSGSFKSRGIGNLI-LKNAIRIQKDG 56
           M+  Y KTPLLRQ    K+     Q F+KYE LQP GSFKSRGIGNLI LK+     ++G
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55

Query: 57  RRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWK 116
                V                +++ LPCTVVVPT+TK+RMV+KI+N+GA+VI+ G++WK
Sbjct: 56  LVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115

Query: 117 EADTFLKANIMNQI-DSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKG 175
           EAD +L+ N +    +    +P+YVHPFD+P +WEGHS+MV EI+ +L+ Q IS+  V+G
Sbjct: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175

Query: 176 IVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSV             E + LADKIP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235

Query: 236 SLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTE 295
           SLG+  I    FE A +Y  KS+V+EDKDVIETCL+Y      + EPACGA+LH+GYH E
Sbjct: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295

Query: 296 ILEKALGSKLAADDIVIIIACGGSSNTVQDL 326
           +LE  LG   + DDI++IIACGGS+ T +DL
Sbjct: 296 LLENFLGG-FSKDDIIVIIACGGSTTTFKDL 325

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 225/330 (68%), Gaps = 9/330 (2%)

Query: 4   VYNKTPLLR-QFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQ- 61
           +++KTPLL+ QF  SK P Q  LKYE LQPSGSFKSRGIG+LI   + ++++  + SP+ 
Sbjct: 24  LFSKTPLLKHQFKRSKGP-QVLLKYEFLQPSGSFKSRGIGHLI---STKVEEIKKSSPEK 79

Query: 62  ---VFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEA 118
              VF                 L++PCTVVV  AT+ R++EKIR+ GA V+V+G +WKEA
Sbjct: 80  IGHVFASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEA 139

Query: 119 DTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVC 178
           D+F+K ++M ++DS   EPIY HPFDNP IWEGHS MVDEI+  L S +I + K+KGIVC
Sbjct: 140 DSFMKEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVC 199

Query: 179 SVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLG 238
           S              +RY+LADKIPIV VET G  V + SLR+G PV+F+KI+S ATSLG
Sbjct: 200 SFGGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLG 259

Query: 239 TAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILE 298
           TA IS   ++   ++ +KS VI D +VI TCL++++  N+VAEP CGA L+ GY+ + L+
Sbjct: 260 TATISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQ 319

Query: 299 KALGSKLAADDIVIIIACGGSSNTVQDLEE 328
             LGS +  DD VI+I CGGSS +++DL+E
Sbjct: 320 NILGSDIKDDDYVILIGCGGSSTSLEDLKE 349

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  327 bits (838), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 169/339 (49%), Positives = 223/339 (65%), Gaps = 14/339 (4%)

Query: 1   MSIVYNKTPLLRQFFP------SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQK 54
           MS +Y KTPLLR+ F       SK P QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVP-QFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59

Query: 55  DGRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAY 114
           D  + P VF            T  QR+ +PCTVVVPT+T++R++EKI  TGA +I  G Y
Sbjct: 60  DPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119

Query: 115 WKEADTFLK-----ANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRIS 169
           + EAD++LK     A   N  D + V PIYVHPF++P IW GHS +V+EI++ L+++ I 
Sbjct: 120 FAEADSYLKDLMQEAANKNTRDKKNV-PIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178

Query: 170 MNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229
            ++VKGIVCSV             ER+ LA+ IPI+GVET GC V + SL  G+ + FKK
Sbjct: 179 YSRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238

Query: 230 ITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALH 289
             S+ATSL    I+ +T  YA KY TKS+V+ + +V++TCL++T + N+V EPACGA LH
Sbjct: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298

Query: 290 LGYHTEILEKALGSKLAADDIVIIIACGGSSNTVQDLEE 328
           LGYH  IL K LG  L+++DIVI+IACGGS+ T+ DL E
Sbjct: 299 LGYHPAILHKELGP-LSSEDIVILIACGGSATTLADLRE 336

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  325 bits (834), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 208/333 (62%), Gaps = 2/333 (0%)

Query: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60
           M  +YNKTPLL +         F  KYE +QP GSFK RG+ +LI K   +I+ +G++ P
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGKKPP 60

Query: 61  QVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120
            VF            T C  LS+PCTVVVPT TK RMVEKIR   A+VIV G+ WKEAD 
Sbjct: 61  HVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADD 120

Query: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180
           +L+  ++    +  V+PIYV+PFD+P +WEGHS+M+DEI+  L  + I ++ VKGIVCSV
Sbjct: 121 YLRGTVIAS--NNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSV 178

Query: 181 XXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                        E + LA  IP+V VET GC V   SL   +PV+  KI SIATSLG++
Sbjct: 179 GGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSS 238

Query: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300
            +S Q F+ A K+ ++SVV+ D DV+ TC +Y    N + EPACGA +H  YH +ILEKA
Sbjct: 239 YVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKA 298

Query: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDL 333
           LG KL   DI+III CGGS  T+QDLE     L
Sbjct: 299 LGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKL 331

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  325 bits (832), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 215/330 (65%), Gaps = 1/330 (0%)

Query: 5   YNKTPLLRQFFPSKSPA-QFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVF 63
           YNKTPLL +   +   A +FFLKYE LQP GSFKSRGIG L+ K+  + ++DG +S  VF
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKSLAVF 67

Query: 64  XXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLK 123
                          Q  S+ CTVVVP  TK RMVEKIR TGA+V+V G +W  AD +L+
Sbjct: 68  SSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYLR 127

Query: 124 ANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXX 183
             +M ++D   V P+YVHPFDNP IW+GHS++VDE+V  LK + +S++KVK IVCSV   
Sbjct: 128 EVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGGG 187

Query: 184 XXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
                     E + LAD+IPI+ +ET GC V N SL  G PV  + +TS+A+SL +  IS
Sbjct: 188 GLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYIS 247

Query: 244 NQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKALGS 303
            + FE A KY +KS++++D  VIETCL +     +V EPACGA+L+  YH E+L   +G 
Sbjct: 248 EKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIGK 307

Query: 304 KLAADDIVIIIACGGSSNTVQDLEETLEDL 333
           +L  DD++++IACGGS+ T +DLE   ++L
Sbjct: 308 ELTEDDVIVVIACGGSAVTYKDLEYMKKEL 337

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  324 bits (830), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 164/323 (50%), Positives = 213/323 (65%), Gaps = 1/323 (0%)

Query: 5   YNKTPLLRQFFPS-KSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVF 63
           Y KTPL+RQ F + K+   F++K++ LQP GSFKSRGIG+LI K       +G     VF
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKLVVF 65

Query: 64  XXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLK 123
                       T+C+ ++L CTVVVP  TK RMV+KI++ GA+VI++G +W EAD +LK
Sbjct: 66  SSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYLK 125

Query: 124 ANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXX 183
             +M Q      + +YVHPFD+  IWEGHS++VDEI+Q L+ + IS  +VKG+VCSV   
Sbjct: 126 QEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGGG 185

Query: 184 XXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
                     ER  LA KIPIV VET GC V N SL+ G PV  +++TS+ATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYIA 245

Query: 244 NQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKALGS 303
              FE    Y  KSVV+ D+DV++TCL+Y    N + EPACGA+LHL YH EILEKALG 
Sbjct: 246 PFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALGQ 305

Query: 304 KLAADDIVIIIACGGSSNTVQDL 326
           KL+ DD+VIIIACGGS  T +DL
Sbjct: 306 KLSEDDVVIIIACGGSCMTYEDL 328

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  325 bits (834), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 228/364 (62%), Gaps = 11/364 (3%)

Query: 1   MSIVYNKTPLLRQFFPSK-----SPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKD 55
           M+  Y KTPL+R  F  +     +  +  LKYE  QPSGSFKSRGIGNLI K   +I+++
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 56  GRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYW 115
               P VF            T  ++L LPCTVVVP  T++RMVE+IR+TGA VI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 116 KEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKG 175
           KE+D +L++ +M  ++ + V PIY HPFDNP IWEGH++MVDE+V+ L  Q + +  VKG
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 176 IVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSV             E++ LAD IP+V VET GC V + SL +G+ V      S+AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 236 SLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTE 295
           SL T+ +++ T  YA KY TKSVV++   V++TCL +  + N+V EPACGAALHLGYH E
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 296 ILEKALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTST 355
           ILE+ LG  L   D+VI+IACGGS+  + DL+E+ + L+    P I+     I  +  + 
Sbjct: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQ----PKIKDFHTPIGTQHETI 422

Query: 356 ILKS 359
           IL S
Sbjct: 423 ILTS 426

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  315 bits (806), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 210/323 (65%), Gaps = 2/323 (0%)

Query: 5   YNKTPLLRQFFPS-KSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVF 63
           Y KTPL+RQF  + K+ + F++K+E LQP GSFKSRGIG+LI K+      +G     VF
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLK 123
                       T C+ ++L C+VVVP  TK RMV+KI++ GA+VI++G +W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 ANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXX 183
              M Q      + +YVHPFDN  IWEGHS++VDEI++ LK   IS+ +VK +VCSV   
Sbjct: 126 HE-MAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGG 184

Query: 184 XXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
                     +R  LA+KIP+V VET GC V N SL+ G PV  +K+TS+ATSL +  I+
Sbjct: 185 GLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIA 244

Query: 244 NQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKALGS 303
           +  FE  +KY  KSVV+ D+DV+ TCL+Y    N + EPACGA+LHL YH EILE  L  
Sbjct: 245 SFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQ 304

Query: 304 KLAADDIVIIIACGGSSNTVQDL 326
           K+  DDIVIIIACGGS  T +DL
Sbjct: 305 KIYEDDIVIIIACGGSCMTYEDL 327

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  310 bits (795), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 211/326 (64%), Gaps = 1/326 (0%)

Query: 5   YNKTPLLRQFFPS-KSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVF 63
           Y +TPL+ Q F + ++  + ++K+E LQP GSFKSRGIG+LI ++      DG     VF
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLAVF 65

Query: 64  XXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLK 123
                       T C  ++L CTVVVP  TK RM++KI+N GA+VI++G++W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYLR 125

Query: 124 ANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXX 183
             +M Q      + +YVHPFD+  IWEGHS++VDE++Q L+ + IS+ ++K +VCSV   
Sbjct: 126 QELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGGG 185

Query: 184 XXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
                     ER +LA KI ++ VET GC V N SL  G P+  ++++SIATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYIA 245

Query: 244 NQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKALGS 303
              FE  + Y  KSVV+ D+DV+ TCL+Y    N + EPACGA+LHL YH EILE AL  
Sbjct: 246 PFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALEQ 305

Query: 304 KLAADDIVIIIACGGSSNTVQDLEET 329
           KL+ DDIVIIIACGGS  T +DL ET
Sbjct: 306 KLSDDDIVIIIACGGSCMTYEDLVET 331

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  294 bits (753), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 150/324 (46%), Positives = 203/324 (62%), Gaps = 3/324 (0%)

Query: 6   NKTPLLRQFF--PSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVF 63
           +K+PLL + F    K   QFFLKYE LQPSGSFKSRGIG LI   A   +        VF
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVHVF 64

Query: 64  XXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLK 123
                          + L+L CTVVVP  TK+ M+++I+N G+QVIV+G +W  ADT+LK
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 124 ANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXX 183
             +M ++ S V EP+YVHPFD+P +WEGHS M+DEIV+ L+ Q  SM  VKGI+CSV   
Sbjct: 125 EVVMKKVPSNV-EPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 184 XXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
                     ER+  A KIPI+ VET G      SL  G+PV+  ++TSIA+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 244 NQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKALGS 303
             +FE A +Y T+S V  D++ + T L++  + N++ EPAC A++ L YH + L K L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 304 KLAADDIVIIIACGGSSNTVQDLE 327
           KL++ DIVI+I CGGS+ T+ DLE
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  280 bits (715), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 144/321 (44%), Positives = 198/321 (61%), Gaps = 8/321 (2%)

Query: 7   KTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXX 66
           KTPLL    P      F LKYE LQP GSFKSRGI +LI K  +    D      V+   
Sbjct: 7   KTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLI-KTTMDSISDPENELAVYSSS 65

Query: 67  XXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANI 126
                      C  L +PCTV+VP +TK RM++KI + GA+V++ G +WKEADT+L+  +
Sbjct: 66  GGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREYV 125

Query: 127 MNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXX 186
           M Q  S     +YVHPFDNP IW+GHS+M+DEI++ L      +N VKGIVCSV      
Sbjct: 126 MRQ--SSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGGGLY 183

Query: 187 XXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQT 246
                  ER+ LA  IP+  +ET+GC V + SL  G+PV   +I+SIATSLG+  I   +
Sbjct: 184 NGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEICADS 243

Query: 247 FEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKALGSKLA 306
           F+ A K+++KS+V++DK+V++TCL++  + +++ EPACGA+LH  Y  E+L       L 
Sbjct: 244 FQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----GPLG 298

Query: 307 ADDIVIIIACGGSSNTVQDLE 327
            DDIV++I CGGS NT  DL+
Sbjct: 299 PDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  214 bits (544), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 143/221 (64%), Gaps = 2/221 (0%)

Query: 107 QVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQ 166
           +V V+ A  KEAD +L+  +++      V+PIYV+PFD+P IWEGHS+++DEI+  L  +
Sbjct: 4   EVFVHVANLKEADYYLQNVVIDLYKD--VQPIYVNPFDDPLIWEGHSTIIDEILNTLTQE 61

Query: 167 RISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQ 226
            I +  VKGI+CS              E+Y LA  IP+V VET GC V N SL   +PVQ
Sbjct: 62  NIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQ 121

Query: 227 FKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGA 286
              ITSIA SLG++V+S + F+   KY++KS+V+ D D ++TC KY      V EPACGA
Sbjct: 122 LDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGA 181

Query: 287 ALHLGYHTEILEKALGSKLAADDIVIIIACGGSSNTVQDLE 327
           ++H  YH  +LE+AL  KL  DD++IIIACGGS  T QDLE
Sbjct: 182 SVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLE 222

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  210 bits (534), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 102/189 (53%), Positives = 129/189 (68%)

Query: 138 IYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYH 197
           +YVHPFDN  IWEGHS++VDEI++ LK   IS+ +VK +VCSV             +R  
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 198 LADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKS 257
           LA+KIP+V VET GC V N SL+ G PV  +K+TS+ATSL +  I++  FE  +KY  KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 258 VVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKALGSKLAADDIVIIIACG 317
           VV+ D+DV+ TCL+Y    N + EPACGA+LHL YH EILE  L  K+  DDIVIIIACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 318 GSSNTVQDL 326
           GS  T +DL
Sbjct: 192 GSCMTYEDL 200

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  114 bits (285), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 78/120 (65%), Gaps = 1/120 (0%)

Query: 5   YNKTPLLRQFFPS-KSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVF 63
           Y KTPL+RQF  + K+ + F++K+E LQP GSFKSRGIG+LI K+      +G     VF
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLK 123
                       T C+ ++L C+VVVP  TK RMV+KI++ GA+VI++G +W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 113/267 (42%), Gaps = 17/267 (6%)

Query: 17  SKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXT 76
           S+  A   LK E L P  SFK RG  N+I K       + +++  V              
Sbjct: 75  SRLNANVQLKREDLLPVFSFKLRGAYNMIAK-----LDESQKTQGVIACSAGNHAQGVAY 129

Query: 77  TCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVE 136
             + L++P T+V+P +T     + +   G+QV++ G  + EA    KA      + + + 
Sbjct: 130 ASKHLNIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLTEERGLT 185

Query: 137 PIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERY 196
            I   PFD+P +  G  ++  EI++ + +     +K+K + C+V             +R 
Sbjct: 186 NI--PPFDHPYVIAGQGTIAMEILRQVHNA----SKIKAVFCAVGGGGLITGVGAYLKR- 238

Query: 197 HLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTK 256
            +A  I ++GVET      +TSL+ G+ V    + + A      +I  +TF  A     +
Sbjct: 239 -IAPHIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDE 297

Query: 257 SVVIEDKDVIETCLKYTHQCNMVAEPA 283
            V++   ++             + EP+
Sbjct: 298 VVLVNTDEICAAVKDIFEDTRSIVEPS 324

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 105/250 (42%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N+I K       D  R+  V                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAK-----LDDNVRNQGVIACSAGNHAQGVAYAAKKLGIP 154

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLSEERGLTNI--PPFD 208

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ + +     NK+  +   V             +R  +A  I +
Sbjct: 209 HPYVIAGQGTVAMEILRQVHN----ANKINAVFVPVGGGGLIAGVGAYLKR--IAPHIKV 262

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHK-------YNTKS 257
           +GVET      +TSL+ G+  +  K+ + A      +I  +TF  A +        NT  
Sbjct: 263 IGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLVNTDE 322

Query: 258 VVIEDKDVIE 267
           +    KDV E
Sbjct: 323 LCAAIKDVFE 332

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 122/317 (38%), Gaps = 36/317 (11%)

Query: 6   NKTPLL-RQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFX 64
           NKTP+L  +   ++  A+ + K E  Q  G+FK RG  N +LK         +R+  V  
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLK-----LTQEQRAAGVVA 75

Query: 65  XXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKA 124
                       + + L +P T+V+P       V      GA ++    Y ++ +     
Sbjct: 76  FSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTEDRE----- 130

Query: 125 NIMNQIDSQVVEP---IYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVX 181
               QI   + E      V P+D+PD+  G  +   E+++++    +           V 
Sbjct: 131 ----QIGRALAEEKGLTLVPPYDHPDVIAGQGTAAKELIEEVGELDLLF---------VP 177

Query: 182 XXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAV 241
                           L+ +  I+GVE    +    SLR G  V      +IA    T  
Sbjct: 178 LGGGGLLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQH 237

Query: 242 ISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEP-ACGAALHLGYHTEILEKA 300
           +   TFE  H      +   D +++++   +  +  +V EP  C     LG+     +KA
Sbjct: 238 LGQYTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEPTGC-----LGFAAARAQKA 292

Query: 301 LGSKLAADDIVIIIACG 317
              KLA   + II++ G
Sbjct: 293 ---KLAGKRVGIIVSGG 306

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 111/272 (40%), Gaps = 25/272 (9%)

Query: 4   VYNKTPLLRQF-FPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQV 62
           V N++P+ +     S+      LK E L P  SFK RG  N+I K       D +R+  V
Sbjct: 75  VINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGV 129

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
                           + L +P T+V+P  T     + +   G+QV++ G  + EA    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEA---- 185

Query: 123 KANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXX 182
           KA      + + +  I   PFD+P +  G  ++  EI++ +++    +NK+  +   V  
Sbjct: 186 KAECTKLAEERGLTNI--PPFDHPYVIAGQGTVAMEILRQVRT----VNKIGAVFVPVGG 239

Query: 183 XXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I ++GVET      + SL+  Q      + + A      +I
Sbjct: 240 GGLIAGIGAYLKR--IAPHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMI 297

Query: 243 SNQTFEYAHK-------YNTKSVVIEDKDVIE 267
             +TF  A +        NT  +    KDV E
Sbjct: 298 GEETFRVAQQVVDEVVLVNTDEICAAVKDVFE 329

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 107/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +R+  V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAYAAKHLGIP 144

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ + +     NK+  +   V             +R  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEILRQVHN----ANKIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKV 252

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKD 264
           +GVET      +TSL+  +      + + A      VI  +TF  A +   + V++   +
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 265 VIETCLKYTHQCNMVAEPACGAAL 288
           +             + EP+   A+
Sbjct: 313 ICAAVKDIFEDTRSIVEPSGALAV 336

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 113/281 (40%), Gaps = 18/281 (6%)

Query: 4   VYNKTPLLRQF-FPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQV 62
           V N++P+ +     S+      LK E L P  SFK RG  N+I K       D +R+  V
Sbjct: 75  VINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGV 129

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
                           + L +P T+V+P  T     + +   G+QV++ G  + EA    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA---- 185

Query: 123 KANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXX 182
           KA      + + +  I   PFD+P +  G  ++  EI++ +++     NK+  +   V  
Sbjct: 186 KAECAKLAEERGLTNI--PPFDHPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGG 239

Query: 183 XXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I I+GVET      + SL+  Q      + + A      +I
Sbjct: 240 GGLIAGIGAYLKR--VAPHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMI 297

Query: 243 SNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPA 283
             +TF  A +   + V++   ++             + EP+
Sbjct: 298 GEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 338

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 107/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +R+  V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAK-----LDDTQRNQGVIACSAGNHAQGVAYAARHLDIP 146

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 200

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++    Q  + NK+  +   V             +R  +   I I
Sbjct: 201 HPYVIAGQGTVAMEILR----QVYNSNKIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKI 254

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKD 264
           +GVET+     +TSL+  +      + + A      +I  +TF  A +   + V++   +
Sbjct: 255 IGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDE 314

Query: 265 VIETCLKYTHQCNMVAEPACGAAL 288
           +             + EP+   A+
Sbjct: 315 ICAAVKDVFEDTRSIVEPSGALAV 338

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 110/272 (40%), Gaps = 25/272 (9%)

Query: 4   VYNKTPLLRQF-FPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQV 62
           V N++P+ +     S+      LK E L P  SFK RG  N+I K       D +R+  V
Sbjct: 75  VINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGV 129

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
                           + L +P T+V+P  T     + +   G+QV++ G  + EA    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA---- 185

Query: 123 KANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXX 182
           KA      + + +  I   PFD+P +  G  ++  EI++ +++     NK+  +   V  
Sbjct: 186 KAECAKLAEERGLTNI--PPFDHPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGG 239

Query: 183 XXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I ++GVET      + SL+  Q      + S A      +I
Sbjct: 240 GGLIAGIGAYLKR--VAPHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMI 297

Query: 243 SNQTFEYAHK-------YNTKSVVIEDKDVIE 267
             +TF  A +        NT  +    KDV E
Sbjct: 298 GEETFRVAQQVVDEVVLVNTDEICAAVKDVFE 329

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 113/281 (40%), Gaps = 18/281 (6%)

Query: 4   VYNKTPLLRQF-FPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQV 62
           V N++P+ +     S+      LK E L P  SFK RG  N+I K       D +R+  V
Sbjct: 75  VINESPISQGVGLSSRLNTNVILKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGV 129

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
                           + L +P T+V+P  T     + +   G+QV++ G  + EA    
Sbjct: 130 IACSAGNHAQGVAFAAKHLKIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA---- 185

Query: 123 KANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXX 182
           KA      + + +  I   PFD+P +  G  ++  EI++ +++     NK+  +   V  
Sbjct: 186 KAECAKLAEERGLTNI--PPFDHPYVIAGQGTVAMEILRQVRT----ANKIGAVFVPVGG 239

Query: 183 XXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I ++GVET      + SL+  Q      + + A      +I
Sbjct: 240 GGLIAGIGAYLKR--VAPHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMI 297

Query: 243 SNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPA 283
             +TF  A +   + V++   ++             + EP+
Sbjct: 298 GEETFRVAQQVVDEVVLVNTDEICAAVKDIFEDTRSIVEPS 338

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 103/250 (41%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +R+  V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLNIP 145

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 199

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ + +     NK+  +   V             +R  +A  I I
Sbjct: 200 HPYVIAGQGTVAMEILRQVHN----ANKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 253

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHK-------YNTKS 257
           +GVET+      TSL+ G+      +   A      +I  +TF  A +        NT  
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTDE 313

Query: 258 VVIEDKDVIE 267
           +    KDV E
Sbjct: 314 ICAAVKDVFE 323

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 103/250 (41%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N++ K       D +++  V                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAK-----LDDSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 195

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ +       NK+  +   V             +R  +A  I I
Sbjct: 196 HPYVIAGQGTVAMEILRQVHKA----NKIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHK-------YNTKS 257
           +GVET   +   TSL+ G+ V    + + A      +I  +TF    +        NT  
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLVNTDE 309

Query: 258 VVIEDKDVIE 267
           +    KDV E
Sbjct: 310 ICAAVKDVFE 319

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 107/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTRLSEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ +++      K+  +                 +R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVRNS----AKIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKD 264
           +GVET      +TSL+ G+      + + A      +I  +TF  A     + V++   +
Sbjct: 253 IGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDE 312

Query: 265 VIETCLKYTHQCNMVAEPACGAAL 288
           +             + EP+   A+
Sbjct: 313 ICAAIKDIFEDTRGIVEPSGALAV 336

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 116/286 (40%), Gaps = 18/286 (6%)

Query: 4   VYNKTPLLR-QFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQV 62
           + N++P+ R +F  S+      LK E L P  SFK RG  N+I         D ++   V
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMISH-----LDDVQKKCGV 123

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
                         + + L +P T+V+P +T     + +   GA+V++ G      D F 
Sbjct: 124 IACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYG------DNFD 177

Query: 123 KANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXX 182
            A +     S+      + PFD+P +  G  ++  EI++ +++     +K+  + C+V  
Sbjct: 178 AAKVECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVFCAVGG 233

Query: 183 XXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
                      +R   A  I ++GVET      +TS++        ++   A      +I
Sbjct: 234 GGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLI 291

Query: 243 SNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAAL 288
             ++F  A +   + +++   ++             V EP+   A+
Sbjct: 292 GEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 104/250 (41%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +++  V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDENQKNQGVIACSAGNHAQGVAYAARHMNIP 144

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ + +      K+  +   V             +R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVHNSL----KIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHK-------YNTKS 257
           VGVET+     + S++ G+    K + S A      +I  +TF  + +        NT  
Sbjct: 253 VGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTDE 312

Query: 258 VVIEDKDVIE 267
           +    KD+ E
Sbjct: 313 ICAAVKDIFE 322

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 107/264 (40%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK + L P  SFK RG  N++ K       D +++  V                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA      + + +  I   PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 197

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ +       +K+  +   V             +R  +A  I I
Sbjct: 198 HPYVIAGQGTVAMEILRQVHMS----SKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKD 264
           +GVET       TSL+ G+    + + S A      ++  +TF  A +   + V++   +
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDE 311

Query: 265 VIETCLKYTHQCNMVAEPACGAAL 288
           +             + EP+   A+
Sbjct: 312 ICAGIKDIFEDTRSIVEPSGALAV 335

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/286 (20%), Positives = 115/286 (40%), Gaps = 18/286 (6%)

Query: 4   VYNKTPLLRQF-FPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQV 62
           V  +TP+ R     S+      LK E L P  SFK RG  N+I K       + +++  V
Sbjct: 66  VIEETPISRAVSLSSRLNTNVKLKREDLLPVFSFKLRGAYNMIAK-----LDETQKNAGV 120

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
                         +   +++P T+V+P +T     + +   GAQV++ G  + EA   L
Sbjct: 121 IACSAGNHAQGVAFSSNHMNIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAK--L 178

Query: 123 KANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXX 182
           +   + +       P    PFD+P +  G  ++  EI++ +++     + +  + C+V  
Sbjct: 179 ECARLAEERGMTDIP----PFDHPYVIAGQGTIAMEILRQVQNG----SNIGAVFCAVGG 230

Query: 183 XXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
                      +R  +A  I ++GVET      + SL+ G+      + + A      +I
Sbjct: 231 GGLISGIGSYLKR--IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLI 288

Query: 243 SNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAAL 288
             +TF        + +++   ++             + EP+   A+
Sbjct: 289 GEETFRVCQDVVDEVILVNTDEICAAVKDVFEDTRSIVEPSGALAV 334

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 96/254 (37%), Gaps = 36/254 (14%)

Query: 4   VYNKTPLLRQF-FPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQV 62
           V N++P+ +     SK  +Q  LK E L P  SFK RG  N++ K       + +R   V
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAK-----LDETQRKQGV 123

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122
                           + L +P T+V+P +T     E +   G+QV++ G          
Sbjct: 124 IACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYG---------- 173

Query: 123 KANIMNQIDSQVVE---------PIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKV 173
                N  DS   E          + + PFD+P +  G  ++  EI++ +K      N  
Sbjct: 174 -----NDFDSSKGECERLCEERGLVNIPPFDHPYVIAGQGTVAMEILRQVK------NSA 222

Query: 174 KGIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSI 233
           K     V                 +A  I IVGVET       TSL  G+  +   + + 
Sbjct: 223 KIGAVFVPVGGGGLVAGIGAYLKRIAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTF 282

Query: 234 ATSLGTAVISNQTF 247
           A      +I  +TF
Sbjct: 283 ADGTAVKMIGEETF 296

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 121/318 (38%), Gaps = 38/318 (11%)

Query: 6   NKTPLL-RQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFX 64
           NKTP+L  +    +  AQ + K E  Q  G+FK RG       NA+    D +RS  V  
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGA-----MNAVSKLSDEKRSKGVIA 75

Query: 65  XXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKA 124
                       + + L++P T+V+P       V      GA +I    Y ++ +     
Sbjct: 76  FSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTEDRE----- 130

Query: 125 NIMNQIDSQVVEP---IYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVX 181
               QI  Q+        + P+D+PD+  G  +   E+++++                V 
Sbjct: 131 ----QIGRQLAAEHGFALIPPYDHPDVIAGQGTSAKELLEEVGQLD---------ALFVP 177

Query: 182 XXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAV 241
                           L+    I GVE    +    S R G  V      +IA    T  
Sbjct: 178 LGGGGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQH 237

Query: 242 ISNQTFEYAHKYNTKSVVIEDKDVIETCLKY-THQCNMVAEP-ACGAALHLGYHTEILEK 299
           +   TF    +     + + D+++++ C+ +   +  +V EP AC     LG+   +L+K
Sbjct: 238 LGEYTFAIIRENVDDILTVSDQELVK-CMHFLAERMKVVVEPTAC-----LGFAGALLKK 291

Query: 300 ALGSKLAADDIVIIIACG 317
               +L    + II++ G
Sbjct: 292 ---EELVGKKVGIILSGG 306

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 102/250 (40%), Gaps = 24/250 (9%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N+I  N    QK    S  V              + + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMI-SNLDEYQK----SAGVIACSAGNHAQGVAFSARELGIR 136

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
             +V+PT+T       +   GA+V++ G  + EA    KA       +Q+ +   + PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA----KAECARL--AQLHKLTDIPPFD 190

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ + +     +++  + C V             +R  +A  I I
Sbjct: 191 HPYVIAGQGTIATEILRQVHNA----SQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHK-------YNTKS 257
           +GVET+     +T+L+ G+      +   A      ++  +TF  A          NT  
Sbjct: 245 IGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTDE 304

Query: 258 VVIEDKDVIE 267
           +    KD+ E
Sbjct: 305 LCAAIKDIFE 314

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 105/264 (39%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N++ K       D +++  V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA        + +  I   PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLSKERGLTNI--PPFD 206

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI   L+   I+ NK+  +   V             +R  +A  I I
Sbjct: 207 HPYVIAGQGTVAMEI---LRQVHIA-NKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 260

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKD 264
           +GVET       TSL+ G+      + + A      +I  +TF  +     + V++   +
Sbjct: 261 IGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDE 320

Query: 265 VIETCLKYTHQCNMVAEPACGAAL 288
           +             + EP+   A+
Sbjct: 321 ICAAVKDIFEDTRSIVEPSGALAV 344

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 102/264 (38%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N++ K A     +G+ +  V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLA-----EGQGNKGVIACSAGNHAQGVAFASRHLNIP 137

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
             +V+P  T     + +   G QV++ G      + F +A I     S+      + PFD
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYG------NDFDEAKIECARISEERGLTNIPPFD 191

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ + +     +K+  +   V             +R  +A  I I
Sbjct: 192 HPYVIAGQGTVAMEILRQVHNA----SKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 245

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKD 264
           VGVET       TSL  G       + + A      +I  +TF     +  + V++   +
Sbjct: 246 VGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTDE 305

Query: 265 VIETCLKYTHQCNMVAEPACGAAL 288
           +             + EP+   A+
Sbjct: 306 ICAAVKDIFEDTRSIVEPSGALAV 329

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/314 (19%), Positives = 118/314 (37%), Gaps = 30/314 (9%)

Query: 6   NKTPLL-RQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFX 64
           NKTP+L  +    +  A+ + K E  Q  G+FK RG       NA+    D  R   V  
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGA-----MNAVSKLSDKERKKGVIA 75

Query: 65  XXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKA 124
                       + +  ++P T+++P       V      GA +I    Y ++     + 
Sbjct: 76  FSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYNRYTED-----RE 130

Query: 125 NIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXX 184
           +I  Q+ ++    + + P+D+PD+  G  +   E+ +++                V    
Sbjct: 131 HIGRQLAAKHGY-VLIPPYDHPDVIAGQGTSAKELFEEVGELD---------ALFVPLGG 180

Query: 185 XXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISN 244
                        L+    + GVE    +    S + G  V     ++IA    T  +  
Sbjct: 181 GGLLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQHLGE 240

Query: 245 QTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEP-ACGAALHLGYHTEILEKALGS 303
            T+    +     + + D++++E       +  +V EP AC     LG+   +L+K    
Sbjct: 241 YTYAVIRENVDDILTVSDEELVECMHFLAERMKLVVEPTAC-----LGFAGALLKK---R 292

Query: 304 KLAADDIVIIIACG 317
           +L    + II++ G
Sbjct: 293 ELVGKKVGIILSGG 306

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 96/264 (36%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLP 84
           LK E L P  SFK RG  N++ K +     + +++  V                + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLS-----EAQKNQGVIACSAGNHAQGVAFASRHLNIP 148

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFD 144
             +V+P  T     + +   G QV++ G  + EA T  +   +++       P    PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKT--ECTRISEERGLTNIP----PFD 202

Query: 145 NPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPI 204
           +P +  G  ++  EI++ +       N  K     V                 +A  I I
Sbjct: 203 HPYVIAGQGTVAMEILRQVH------NAAKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKI 256

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKD 264
           +GVET       TSL  G       + + A      +I  +TF          +++   +
Sbjct: 257 IGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDE 316

Query: 265 VIETCLKYTHQCNMVAEPACGAAL 288
           +             + EP+   A+
Sbjct: 317 ICAAVKDIFEDTRSIVEPSGALAV 340

>KLLA0A11814g Chr1 (1021526..1022434) [909 bp, 302 aa] {ON} highly
           similar to uniprot|P20459 Saccharomyces cerevisiae
           YJR007W SUI2 Alpha subunit of the translation initiation
           factor eIF2 involved in the identification of the start
           codon phosphorylation of Ser51 is required for
           regulation of translation by inhibiting the exchange of
           GDP for GTP
          Length = 302

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 7/35 (20%)

Query: 139 YVHPFD-------NPDIWEGHSSMVDEIVQDLKSQ 166
           Y H +D       +P++W+G  S+ DEI Q+LK Q
Sbjct: 138 YGHAYDAYKMSIVDPNVWDGIESISDEIFQELKGQ 172

>Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON}
           YKL218C (REAL)
          Length = 269

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 91/254 (35%), Gaps = 23/254 (9%)

Query: 48  NAIRIQKDGRRSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQ 107
           NA+    D  R+  V              + + L++P T+V+P       V      GA 
Sbjct: 2   NAVLKLSDEERNKGVIAFLSGNHAQAFALSAKLLNVPATIVMPEDASTLKVAATTGYGAH 61

Query: 108 VIVNGAYWKEADTFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQR 167
           +     Y ++ D      I  Q+ ++    + + P+D+PD+  G S+   ++++++    
Sbjct: 62  ITKYNRYTEDRD-----KIGRQLAAKHGFAL-IPPYDHPDVIAGQSASAKKLLEEVGQLD 115

Query: 168 ISMNKVKGIVCSVXXXXXXXXXXXXXERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQF 227
                       V                 L+    I GVE    +    S R G  V  
Sbjct: 116 ---------ALFVLLGGGGLLSGSTLASRSLSPDCKIFGVEPEAGNDGQQSFRSGSVVHI 166

Query: 228 KKITSIATSLGTAVISNQTFEYAHKYNTKSVVIEDKDVIETCLKY-THQCNMVAEP-ACG 285
               +IA    T  +   TF    +     + + D  +IE C+ +   +  +V  P AC 
Sbjct: 167 DTPNTIAGEAQTQHLGEYTFAIIRENVDDILTVTDGKLIE-CMHFLAERMKLVVGPTAC- 224

Query: 286 AALHLGYHTEILEK 299
               LG+   +L+K
Sbjct: 225 ----LGHAGAVLKK 234

>TBLA0E01230 Chr5 complement(272660..273859) [1200 bp, 399 aa] {ON}
           Anc_4.148 YGR012W
          Length = 399

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 63/156 (40%), Gaps = 15/156 (9%)

Query: 8   TPLLRQFFPSKSPA-QFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDG---RRSPQ-V 62
           TP++R    SKS + Q + K E   P+GS K R   N+IL      +K+G   R +P  V
Sbjct: 60  TPMVRINSLSKSTSCQIYAKLELNNPAGSAKDRVALNIILT----AEKNGQLTRGNPDWV 115

Query: 63  FXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQV-IVNGAYWKEADTF 121
           F              C  L     + +P  T    +  + + GA V  V  A   + D +
Sbjct: 116 FEGTSGSTGISIAMICNALGYRSHISLPDDTSIEKLSLLESLGAVVNKVKPASIVDPDQY 175

Query: 122 LKA-----NIMNQIDSQVVEPIYVHPFDNPDIWEGH 152
           + A       +N   +   + I+   F+N   W+ H
Sbjct: 176 VNAAKKACEKLNNDTTTNSKGIFADQFENEANWKVH 211

>NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON}
           Anc_3.357 YPR067W
          Length = 159

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 50/108 (46%), Gaps = 13/108 (12%)

Query: 194 ERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFEYAHKY 253
           E Y  ++++  +GVE+ GCH F  +L +    Q ++ T   + +    I+ ++  Y    
Sbjct: 46  EIYKASNEVLKIGVESGGCHGFQYNLDLIPADQSQQETKRTSMMSLLRITIKSVVYVMPP 105

Query: 254 NTKSVVIED---KDVIETCLKYTHQC----------NMVAEPACGAAL 288
           +   V+I++   K + +T L YT +           N+ +   CG++ 
Sbjct: 106 DGGKVIIDENSLKILNDTVLNYTTELIGSQFKIEDGNLKSSCGCGSSF 153

>SAKL0H23144g Chr8 (2005986..2007158) [1173 bp, 390 aa] {ON} highly
           similar to uniprot|P53206 Saccharomyces cerevisiae
           YGR012W Hypothetical ORF
          Length = 390

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 63/161 (39%), Gaps = 16/161 (9%)

Query: 3   IVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSR---GIGNLILKNAI--RIQKDGR 57
           ++ N   +L +     +  Q + K E   P+GS K R    I N   K  +  R QKD  
Sbjct: 48  LIGNTPMVLIRSLSRATGTQIYAKLELANPAGSAKDRIALSIINTAEKQGLLTRGQKD-- 105

Query: 58  RSPQVFXXXXXXXXXXXXTTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQV-IVNGAYWK 116
               VF              C  L     + +P  T    +  + + GA+V  V  A   
Sbjct: 106 ---FVFEGTSGSTGISIAAICNSLGYRAHISLPDDTSPEKLSLLESLGAEVNKVKPASIV 162

Query: 117 EADTFLKA-----NIMNQIDSQVVEPIYVHPFDNPDIWEGH 152
           + + ++ A     + +NQ ++  V+ ++   F+N   W+ H
Sbjct: 163 DPNQYVNASKKACDELNQNETAEVKGVFADQFENEANWKVH 203

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,915,637
Number of extensions: 1307559
Number of successful extensions: 3777
Number of sequences better than 10.0: 62
Number of HSP's gapped: 3775
Number of HSP's successfully gapped: 62
Length of query: 360
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 249
Effective length of database: 40,753,473
Effective search space: 10147614777
Effective search space used: 10147614777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)