Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_2.4001.318ON1051055452e-73
Smik_2.4111.318ON1051054628e-61
YBR268W (MRPL37)1.318ON1051054566e-60
Suva_4.5291.318ON1051054513e-59
SAKL0D06952g1.318ON1071042441e-27
TDEL0D018701.318ON1001042404e-27
Ecym_62891.318ON1031002388e-27
CAGL0I09372g1.318ON1031052362e-26
KLTH0H10714g1.318ON1061022362e-26
Kpol_1035.251.318ON1061112344e-26
NCAS0B074401.318ON1101102311e-25
ZYRO0G20702g1.318ON1401042304e-25
Kwal_14.25861.318ON1061062241e-24
KLLA0F01683g1.318ON981022204e-24
AEL167C1.318ON1011022205e-24
TBLA0F013201.318ON111862153e-23
NDAI0B047701.318ON113842146e-23
TPHA0O014701.318ON100972074e-22
KAFR0C042101.318ON1011011944e-20
KNAG0C017701.318ON1011021893e-19
NCAS0A022304.204ON49456680.47
Smik_11.2022.570ON44938623.6
Skud_11.1832.570ON44938614.0
YKL046C (DCW1)2.570ON44938614.0
Suva_11.1802.570ON45038614.0
NCAS0A127502.570ON44738605.1
TPHA0I024702.570ON45285598.6
NDAI0B015102.570ON44740599.2
Ecym_45772.570ON45038599.2
TDEL0B065802.570ON44738589.2
NCAS0H029002.570ON45338589.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_2.400
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...   214   2e-73
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...   182   8e-61
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...   180   6e-60
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...   178   3e-59
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...    99   1e-27
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...    97   4e-27
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...    96   8e-27
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...    96   2e-26
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...    96   2e-26
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...    95   4e-26
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    94   1e-25
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...    93   4e-25
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...    91   1e-24
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...    89   4e-24
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...    89   5e-24
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    87   3e-23
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...    87   6e-23
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...    84   4e-22
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    79   4e-20
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    77   3e-19
NCAS0A02230 Chr1 (418098..419582) [1485 bp, 494 aa] {ON}               31   0.47 
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...    28   3.6  
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...    28   4.0  
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...    28   4.0  
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...    28   4.0  
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...    28   5.1  
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...    27   8.6  
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...    27   9.2  
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...    27   9.2  
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...    27   9.2  
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570     27   9.4  

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score =  214 bits (545), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60
           MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW
Sbjct: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60

Query: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL
Sbjct: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score =  182 bits (462), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 98/105 (93%)

Query: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60
           MLARS+ YR+ISTSRVL+NK AVK+VVSSCPAGTSLNLNIWKSGKDA+ALE+KEYP+WLW
Sbjct: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60

Query: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
            +L+N+Q VEH  +D EGEALLKRRKNIRKANRQRIKQ+NFLSQL
Sbjct: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score =  180 bits (456), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 96/105 (91%)

Query: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60
           MLARS+ YR ISTSR+LYNK  VK+VVSSCPAGTSLNLNIWKSGKDA+ALE+KEYP+WLW
Sbjct: 1   MLARSLGYRLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60

Query: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           SVLD+   VEHA +D EG+ALLKRRKNIRKANRQRIKQ+NFLSQL
Sbjct: 61  SVLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score =  178 bits (451), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 95/105 (90%)

Query: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60
           MLARSVS RW+STSRV YNKQAVK V SSCPAGTSLNLNIWKSGKDA ALE++EYPSWLW
Sbjct: 1   MLARSVSCRWLSTSRVFYNKQAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLW 60

Query: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           SVLD KQ V+HA +D EGEAL +R+KNIRKANRQ+IKQ+NFLSQL
Sbjct: 61  SVLDAKQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score = 98.6 bits (244), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 70/104 (67%), Gaps = 8/104 (7%)

Query: 6   VSYRWISTSRVLYNKQA----VKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWS 61
            S R++ST+R+   +QA    V  V SSCPAGT LNL I KSGK+ +ALE+ EYP WLW+
Sbjct: 8   ASRRFLSTTRITLQQQAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHEYPEWLWT 67

Query: 62  VLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           VLD K       QD    A LK +K +RK NR++IKQ+NFL+++
Sbjct: 68  VLDEKAQSAKLAQD---PAKLK-KKQLRKMNREKIKQNNFLTKI 107

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score = 97.1 bits (240), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 2   LARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWS 61
           + R V  R  S  RV   +     V SSCPAGT L++N+ KSGKD +ALE+ EYP+WLW 
Sbjct: 1   MFRFVPKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWE 60

Query: 62  VLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           VLD +       +D     +  R+K IRKANR +IKQ+NFL QL
Sbjct: 61  VLDPEARARKLAED----PMKLRKKQIRKANRMQIKQNNFLQQL 100

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score = 96.3 bits (238), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 66/100 (66%), Gaps = 4/100 (4%)

Query: 6   VSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDN 65
           ++ R IST+  L  ++  K ++SSCPAGT LNL I K+GK+ +AL E EYP WLW VLD 
Sbjct: 8   INKRLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDP 67

Query: 66  KQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           + +     +D        R+K +RK NR++IKQ+NFLS++
Sbjct: 68  QVEAAKLNED----PFAARKKQLRKMNREKIKQNNFLSRI 103

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 69/105 (65%), Gaps = 2/105 (1%)

Query: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60
           ML    + R +S+S VL N+   K + SSC AGT L+LN+ K+GKD +ALE+ EYP WLW
Sbjct: 1   MLRLLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58

Query: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           +VLD       A      E+L  R+K IR++NR++IKQ NFL+QL
Sbjct: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 67/102 (65%), Gaps = 6/102 (5%)

Query: 6   VSYRWISTSRVLYNKQAVKT--VVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVL 63
            S R +S SR  +  Q      VVSSCPAGT LNL I KSGK+ +ALE+ EYP WLW+VL
Sbjct: 9   TSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVL 68

Query: 64  DNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           D++  ++   +D     L  R+K +R ANR +IKQ+NFLS++
Sbjct: 69  DSRAQLKKLQED----PLKLRKKQLRSANRNKIKQNNFLSEI 106

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score = 94.7 bits (234), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 74/111 (66%), Gaps = 11/111 (9%)

Query: 1   MLARSVSYRWISTSRVLYNKQAVKT------VVSSCPAGTSLNLNIWKSGKDALALEEKE 54
           ML +    R +S+SR+L+ ++ VKT      + SSCPAG+ L LNI K+GKD +ALE+ E
Sbjct: 1   MLKQIFQKRLLSSSRLLW-QETVKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAE 59

Query: 55  YPSWLWSVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           YP+WLW+VLD +   E   +D     L  R+K +R+ANR+ IKQ+NFL Q+
Sbjct: 60  YPTWLWTVLDKEAQAEALSKD----PLALRKKKLRQANRKNIKQNNFLKQI 106

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 93.6 bits (231), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 73/110 (66%), Gaps = 7/110 (6%)

Query: 2   LARSVSYRWISTS-RVLYNKQAVKT-----VVSSCPAGTSLNLNIWKSGKDALALEEKEY 55
           + R V  R +STS RVL  + A        + SSC AGTSLNLNI K+GKD +ALE+ EY
Sbjct: 1   MLRLVFKRSLSTSFRVLTAEAATTANASTNIKSSCLAGTSLNLNIKKNGKDPIALEDNEY 60

Query: 56  PSWLWSVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           P+WLW VL++K   E A    E E L  R+K +RK NR++IKQ+NFLSQL
Sbjct: 61  PAWLWKVLESKAPKE-ASDLSEQEVLAMRKKQLRKENRKKIKQNNFLSQL 109

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score = 93.2 bits (230), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 9/104 (8%)

Query: 2   LARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWS 61
           L R    R++STS VL   QAVK   SSCPAGT +N+N  KSGKD +ALE+ EYP WLW 
Sbjct: 46  LLRLFPRRFVSTSPVL--GQAVK---SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100

Query: 62  VLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           VLD     E   +  + + +  R+K +RK NR++IKQ+NFL Q+
Sbjct: 101 VLDP----EAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score = 90.9 bits (224), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 6/106 (5%)

Query: 2   LARSVSYRWISTSRVLYNKQ--AVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWL 59
           + R V  +  ST   L   Q  +V  + SSC AGT LNL I KSGK+ +ALE+ EYP WL
Sbjct: 5   IHRLVVKKPFSTFSALLQSQKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEYPEWL 64

Query: 60  WSVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           WSVLD+K  ++   +D     L  R+K +R ANRQ+IKQ+NFLS++
Sbjct: 65  WSVLDDKAQLKKLQED----PLKLRKKQLRSANRQKIKQNNFLSEI 106

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score = 89.4 bits (220), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 65/102 (63%), Gaps = 12/102 (11%)

Query: 11  ISTSRVLYNK-------QAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVL 63
           +  +RVL+N+       QA K +VSSCPAGT LNL I KSGK+ +ALE+ EYP WLW+VL
Sbjct: 2   LRVTRVLFNQVKSEASGQAAK-IVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60

Query: 64  DNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           D     E    D     +  R+K +R ANR  IKQ+NFL+++
Sbjct: 61  DANVQAEKLAAD----PIKLRKKQLRIANRANIKQNNFLAKI 98

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score = 89.4 bits (220), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 64/102 (62%), Gaps = 5/102 (4%)

Query: 4   RSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVL 63
           RS   R  S S  +Y++QA K V SSCPAGT LNL I K GK+ LALE+ +YP WLW VL
Sbjct: 5   RSSFRRLFSVSCRVYDQQAQKAV-SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVL 63

Query: 64  DNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           D +       +D     +  R+K +R+ NR+ IKQ NFL+++
Sbjct: 64  DPEAQAAKLAED----PIKARKKALRRMNREHIKQQNFLAKM 101

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 87.4 bits (215), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 60/86 (69%), Gaps = 7/86 (8%)

Query: 20  KQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQDVEHAGQDQEGE 79
           +QA+K   SSCPAGT L LN++K GKD +ALE+++YP WLWS+L    +   +      E
Sbjct: 32  QQAIK---SSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNNKNPSPM----E 84

Query: 80  ALLKRRKNIRKANRQRIKQSNFLSQL 105
           A+ +R+K +RK NR RIKQ+NFL QL
Sbjct: 85  AIAQRKKVLRKNNRDRIKQNNFLKQL 110

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score = 87.0 bits (214), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 59/84 (70%), Gaps = 5/84 (5%)

Query: 26  VVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQDVEHA----GQDQEGEAL 81
           + SSC AGT LNLNI K+GK+ +ALE+KEYP WLW+VLD K     A    G   E E+L
Sbjct: 31  IKSSCLAGTPLNLNIKKTGKEPIALEDKEYPEWLWTVLDTKTANGRAKSGKGTSVE-ESL 89

Query: 82  LKRRKNIRKANRQRIKQSNFLSQL 105
           L R++ +R   R++IKQ+NFLSQ+
Sbjct: 90  LARKRQLRVETRKKIKQNNFLSQI 113

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score = 84.3 bits (207), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (58%), Gaps = 4/97 (4%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQD 68
           R+ S   +L  +     + SSC AGT L +N+ K+GKD +ALE+ EYP WLW+VLD    
Sbjct: 8   RFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQ 67

Query: 69  VEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
                   E + L  RRK +R+ NR  IKQ+NFL Q+
Sbjct: 68  AARL----ENDPLKLRRKELRRKNRANIKQNNFLKQI 100

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 79.3 bits (194), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 64/101 (63%), Gaps = 4/101 (3%)

Query: 6   VSYRWISTSR-VLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLD 64
           +S R+ S SR VL + + +  +VSSCP GT L L + K  K  LAL+++EYP WLWSVL 
Sbjct: 4   LSRRFFSHSRSVLQSTKCL--LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVL- 60

Query: 65  NKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           N++      +    + L  RRK +RK NR +IKQ NFLS+L
Sbjct: 61  NEESANTQKELSPIQELELRRKQLRKLNRDKIKQKNFLSEL 101

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 77.4 bits (189), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (56%), Gaps = 3/102 (2%)

Query: 4   RSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVL 63
           R V  R     RVL        V SSC AGT L L+I K G+D +A+ ++EYP WLW VL
Sbjct: 3   RFVQRRMWHGGRVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVL 62

Query: 64  DNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105
           +     + + +    + L  RRK +R+ +R  IKQSN+LSQL
Sbjct: 63  EPATGGDASAR---ADPLAARRKELRRKHRNEIKQSNYLSQL 101

>NCAS0A02230 Chr1 (418098..419582) [1485 bp, 494 aa] {ON}
          Length = 494

 Score = 30.8 bits (68), Expect = 0.47,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 17  LYNKQAV-KTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQDVEH 71
           L+NK A+ K +   CP      LN  K   D L +EE +Y  W   +   +++V H
Sbjct: 392 LFNKNAMNKPIDVWCPDLLERQLNFKKKYDDLLTVEEGKYQEWAQGLKKTQEEVNH 447

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score = 28.5 bits (62), Expect = 3.6,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W+  ++ ++N  A++    SC  G    + +W SG D
Sbjct: 143 QWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score = 28.1 bits (61), Expect = 4.0,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W+  ++ ++N  A++    SC  G    + +W SG D
Sbjct: 143 QWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score = 28.1 bits (61), Expect = 4.0,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W+  ++ ++N  A++    SC  G    + +W SG D
Sbjct: 143 QWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score = 28.1 bits (61), Expect = 4.0,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W+  ++ ++N  A++    SC  G    + +W SG D
Sbjct: 144 QWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 181

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score = 27.7 bits (60), Expect = 5.1,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W+  ++ ++N  A++    SC  G    + +W SG D
Sbjct: 141 QWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 178

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score = 27.3 bits (59), Expect = 8.6,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 30/85 (35%), Gaps = 17/85 (20%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD-----------------ALALE 51
           +W+  ++ ++N  A++    SC  G    +  W SG D                 A    
Sbjct: 146 QWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGALFHIAARLARYTG 205

Query: 52  EKEYPSWLWSVLDNKQDVEHAGQDQ 76
              Y  W   V D   DV+   QDQ
Sbjct: 206 NDSYAEWAEKVYDWMVDVDLITQDQ 230

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score = 27.3 bits (59), Expect = 9.2,   Method: Composition-based stats.
 Identities = 10/40 (25%), Positives = 21/40 (52%)

Query: 7   SYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           S +W+  ++ ++N  A++    +C  G    + +W SG D
Sbjct: 139 SPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYD 178

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score = 27.3 bits (59), Expect = 9.2,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W++ ++ ++N  A +   SSC  G    +  W +G D
Sbjct: 143 QWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYD 180

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score = 26.9 bits (58), Expect = 9.2,   Method: Composition-based stats.
 Identities = 9/38 (23%), Positives = 21/38 (55%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W+  ++ ++N  A++   +SC  G    + +W +G D
Sbjct: 141 QWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYD 178

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score = 26.9 bits (58), Expect = 9.4,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 20/38 (52%)

Query: 9   RWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKD 46
           +W+  ++ ++N  A++    +C  G    + IW SG D
Sbjct: 147 QWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYD 184

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.126    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,673,469
Number of extensions: 408663
Number of successful extensions: 1117
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1102
Number of HSP's successfully gapped: 55
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)