Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_2.1283.187ON127391376e-11
YBR016W3.187ON128381166e-08
Smik_2.1353.187ON127361043e-06
Suva_2.1443.187ON119361019e-06
CAGL0I04510g3.187ON11629903e-04
YDL012C3.187ON10739840.002
Skud_4.2413.187ON10639760.033
SAKL0C08008g3.187ON14539760.045
KLTH0E15840g3.187ON11332700.22
KAFR0C008803.187ON12125700.22
ZYRO0A04972g3.187ON12227680.45
Kwal_YGOB_Anc_3.1873.187ON11232670.50
Suva_4.2373.187ON10325650.83
KNAG0K012853.187ON12627597.5
Ecym_52633.187ON12428589.9
NOTE: 9 genes in the same pillar as Skud_2.128 were not hit in these BLAST results
LIST: Kpol_1036.51 CAGL0K01903g Smik_4.222 NCAS0I01900 TBLA0B01680 TBLA0F00730 AER212W TDEL0D04340 Klac_YGOB_Anc_3.187

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_2.128
         (127 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W (...    57   6e-11
YBR016W Chr2 (270247..270633) [387 bp, 128 aa] {ON} Tail-anchore...    49   6e-08
Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W (...    45   3e-06
Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W (...    44   9e-06
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    39   3e-04
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    37   0.002
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    34   0.033
SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438...    34   0.045
KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp, 1...    32   0.22 
KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa...    32   0.22 
ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122 a...    31   0.45 
Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [3...    30   0.50 
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    30   0.83 
KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381...    27   7.5  
Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp...    27   9.9  

>Skud_2.128 Chr2 (243786..244169) [384 bp, 127 aa] {ON} YBR016W
          (REAL)
          Length = 127

 Score = 57.4 bits (137), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/39 (100%), Positives = 39/39 (100%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQERGYA 39
          MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQERGYA
Sbjct: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQERGYA 39

>YBR016W Chr2 (270247..270633) [387 bp, 128 aa] {ON} Tail-anchored
          plasma membrane protein containing a conserved CYSTM
          module; predicted to be palmitoylated; has similarity
          to hydrophilins, which are involved in the adaptive
          response to hyperosmotic conditions
          Length = 128

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/38 (92%), Positives = 36/38 (94%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQERGY 38
          MSANDYYGG AGEKSQYSRPSNPPPSSA Q+KTQERGY
Sbjct: 1  MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGY 38

>Smik_2.135 Chr2 (250473..250856) [384 bp, 127 aa] {ON} YBR016W
          (REAL)
          Length = 127

 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/36 (88%), Positives = 34/36 (94%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQER 36
          MSANDYYGGA GEKSQYSRPSNPPPSSA Q++TQER
Sbjct: 1  MSANDYYGGATGEKSQYSRPSNPPPSSAHQNETQER 36

>Suva_2.144 Chr2 (249704..250063) [360 bp, 119 aa] {ON} YBR016W
          (REAL)
          Length = 119

 Score = 43.5 bits (101), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQER 36
          MSANDYYGG AGEK+QYSRPSNPPPSS  Q  TQER
Sbjct: 1  MSANDYYGGTAGEKAQYSRPSNPPPSSTHQGSTQER 36

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
          bp, 116 aa] {ON} similar to uniprot|P38216
          Saccharomyces cerevisiae YBR016w and similar to
          uniprot|Q12489 Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 20/29 (68%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQ 29
          MSA +YY GA   K QYSRP+ PPPS  Q
Sbjct: 1  MSAQEYYNGAGDSKQQYSRPTAPPPSQGQ 29

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp,
          107 aa] {ON} Tail-anchored plasma membrane protein
          containing a conserved CYSTM module, possibly involved
          in response to stress; may contribute to non-homologous
          end-joining (NHEJ) based on ydl012c htz1 double null
          phenotype
          Length = 107

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 26/39 (66%), Gaps = 5/39 (12%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQERGYA 39
          MSA DYYG +A ++S YSRPS PPP      +T  RGYA
Sbjct: 1  MSAQDYYGNSASKQS-YSRPSAPPPGY----ETASRGYA 34

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321
          bp, 106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 33.9 bits (76), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 5/39 (12%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDKTQERGYA 39
          MSA DYYG +  ++S YSRP+ PPP      +T  RGYA
Sbjct: 1  MSAQDYYGNSTSKQS-YSRPTAPPPGY----ETGARGYA 34

>SAKL0C08008g Chr3 complement(743966..744268,744380..744514) [438
          bp, 145 aa] {ON} similar to uniprot|Q12489
          Saccharomyces cerevisiae YDL012C Plasma membrane
          protein of unknown function
          Length = 145

 Score = 33.9 bits (76), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 23/39 (58%), Gaps = 4/39 (10%)

Query: 1  MSANDYYGGAAGEKSQ-YSRPSNPPPSSAQQDKTQERGY 38
          MSA DYY GAA +  Q Y RP+  PPS    D +  RGY
Sbjct: 29 MSAADYYSGAAADSKQTYQRPTGAPPSG---DFSSSRGY 64

>KLTH0E15840g Chr5 (1406256..1406303,1406400..1406693) [342 bp,
          113 aa] {ON} similar to uniprot|Q12489 Saccharomyces
          cerevisiae YDL012C Plasma membrane protein of unknown
          function
          Length = 113

 Score = 31.6 bits (70), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDK 32
          MSA +YY G +  K QY+ P+ PPP + Q  +
Sbjct: 1  MSAAEYYKGTSESKQQYTSPAGPPPGAYQDSR 32

>KAFR0C00880 Chr3 (178337..178375,178475..178801) [366 bp, 121 aa]
          {ON} Anc_3.187 YDL012C
          Length = 121

 Score = 31.6 bits (70), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 3/25 (12%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPP 25
          MSA +YYG     K+QY+RPS PPP
Sbjct: 1  MSAREYYGDT---KTQYNRPSAPPP 22

>ZYRO0A04972g Chr1 (400197..400235,400324..400653) [369 bp, 122
          aa] {ON} weakly similar to uniprot|P38216 Saccharomyces
          cerevisiae YBR016W
          Length = 122

 Score = 30.8 bits (68), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 3/27 (11%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSS 27
          MSA +YYG +   K+ YSRP  PPPSS
Sbjct: 1  MSAQEYYGDS---KASYSRPQGPPPSS 24

>Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273)
          [339 bp, 112 aa] {ON} ANNOTATED BY YGOB -
          Length = 112

 Score = 30.4 bits (67), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSAQQDK 32
          MSA +YY G +  + QY+ PS PPP   Q  +
Sbjct: 1  MSAAEYYKGTSQPQQQYTSPSGPPPGHQQDSR 32

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312
          bp, 103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 29.6 bits (65), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 1/25 (4%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPP 25
          MSA DYYG +A ++S YS P+ PPP
Sbjct: 1  MSAQDYYGNSAYKQS-YSHPTAPPP 24

>KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381
          bp, 126 aa] {ON}
          Length = 126

 Score = 27.3 bits (59), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 1  MSANDYYGGAAGEKS-QYSRPSNPPPS 26
          MSA DYY GA+ + + QY  PS+P P+
Sbjct: 1  MSAKDYYNGASNQPTQQYHSPSSPAPA 27

>Ecym_5263 Chr5 complement(545614..545943,546179..546223) [375 bp,
          124 aa] {ON} similar to Ashbya gossypii AER212W
          Length = 124

 Score = 26.9 bits (58), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 1/28 (3%)

Query: 1  MSANDYYGGAAGEKSQYSRPSNPPPSSA 28
          MSA DYYG    ++S ++RPS PPP+ +
Sbjct: 1  MSAADYYGTGDNKQS-FNRPSAPPPNQS 27

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.124    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,725,855
Number of extensions: 113334
Number of successful extensions: 342
Number of sequences better than 10.0: 18
Number of HSP's gapped: 334
Number of HSP's successfully gapped: 18
Length of query: 127
Length of database: 53,481,399
Length adjustment: 96
Effective length of query: 31
Effective length of database: 42,473,463
Effective search space: 1316677353
Effective search space used: 1316677353
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 59 (27.3 bits)