Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.76.5ON77377336680.0
YPL270W (MDL2)6.5ON77377333840.0
Smik_6.4786.5ON77377332940.0
Suva_16.356.5ON76777332840.0
CAGL0A01133g6.5ON80161123390.0
Kpol_1045.836.5ON74860222780.0
NCAS0D022106.5ON77359422810.0
ZYRO0F00396g6.5ON73260922740.0
NDAI0I027306.5ON83271522790.0
TDEL0G046606.5ON73965422650.0
TPHA0J002206.5ON74060322180.0
TBLA0A071906.5ON79462221810.0
KNAG0E028006.5ON74177821240.0
SAKL0E00748g6.5ON77468421100.0
Kwal_56.223296.5ON77660221040.0
KLTH0C11616g6.5ON74061020700.0
KLLA0D00748g6.5ON78961520670.0
ACR022W6.5ON75462920570.0
Ecym_30076.5ON76961919920.0
KAFR0B064806.5ON75170119500.0
NDAI0A005601.67ON71461713651e-178
TPHA0B046201.67ON72065213501e-176
YLR188W (MDL1)1.67ON69561413431e-175
Skud_12.2531.67ON69264013431e-175
TDEL0C063501.67ON69363313341e-174
NCAS0B087001.67ON71565813341e-174
KLLA0C01991g1.67ON70659713301e-173
Smik_12.2481.67ON69661213281e-173
Kpol_2000.791.67ON70761013261e-173
Suva_10.2841.67ON69359913201e-172
SAKL0C02244g1.67ON71266913181e-171
Ecym_10721.67ON68359613041e-170
ZYRO0F17050g1.67ON71466012911e-167
KLTH0F02024g1.67ON73469012771e-165
Kwal_33.133081.67ON70660912731e-165
AFR683C1.67ON67759212541e-162
TBLA0A053001.67ON70761812131e-156
CAGL0E00385g1.67ON60859211971e-155
YKL209C (STE6)1.527ON12905255561e-58
SAKL0H00968g5.20ON7004425174e-55
Kwal_26.94805.20ON7194365105e-54
TDEL0F003401.527ON12575275115e-53
KLLA0A10131g5.20ON7204404982e-52
KLTH0B09482g5.20ON6945774972e-52
Suva_11.111.527ON12905254955e-51
Kpol_1018.1851.527ON12765084921e-50
KAFR0I025805.20ON7094384832e-50
Skud_13.4755.20ON6914404803e-50
TPHA0L022705.20ON7115244813e-50
Suva_13.4915.20ON6934384787e-50
Smik_13.5185.20ON6875274777e-50
KNAG0E013205.20ON6953814779e-50
NCAS0D024305.20ON7024454779e-50
Skud_11.111.527ON12955224813e-49
TBLA0B100701.527ON12965194796e-49
YMR301C (ATM1)5.20ON6904404698e-49
Ecym_56495.20ON6963304611e-47
TBLA0C070005.20ON7253314602e-47
KAFR0E002301.527ON12705574663e-47
AGL335W5.20ON6914334556e-47
NDAI0I024405.20ON7305514531e-46
Kpol_513.235.20ON7083284503e-46
ZYRO0G02244g1.527ON12734914555e-46
KNAG0G001901.527ON12755544512e-45
TDEL0G004305.20ON6965464432e-45
SAKL0A10208g1.527ON13105064485e-45
Smik_11.141.527ON13165234467e-45
ZYRO0D07106g5.20ON7095334399e-45
AFR432W1.527ON12845094441e-44
CAGL0K00363g1.527ON12275404422e-44
NCAS0G035101.527ON12885234404e-44
NDAI0D015401.527ON12935234379e-44
CAGL0M13739g5.20ON7274484292e-43
Ecym_36121.527ON13155104343e-43
KLLA0B14256g1.527ON12712414272e-42
TPHA0O001601.527ON12535104201e-41
NCAS0E041605.10ON15065734192e-41
KLTH0B01100g1.527ON12985204058e-40
NCAS0J00160singletonON16545493908e-38
NDAI0B006405.10ON14915643898e-38
Kwal_33.155611.527ON12975103881e-37
NCAS0C059304.6ON16575443835e-37
CAGL0E03982g4.6ON16595003819e-37
TPHA0C009608.303ON15235713782e-36
KAFR0C065105.10ON14575293773e-36
Skud_7.6145.10ON14775633773e-36
Smik_12.484.52ON15575333747e-36
Ecym_42658.303ON15054933739e-36
ZYRO0G07612g4.6ON16955043739e-36
Smik_16.275.10ON14775623721e-35
YGR281W (YOR1)5.10ON14775583711e-35
Suva_7.5775.10ON14785563711e-35
NDAI0J011508.303ON15174853683e-35
Ecym_84184.6ON16785463683e-35
CAGL0G00242g5.10ON14775583683e-35
CAGL0E03355g4.52ON15355453683e-35
TBLA0G007104.6ON16914913675e-35
KLLA0E00529g4.6ON16505193665e-35
KNAG0J027304.52ON15375453631e-34
Kwal_34.157704.6ON14365033632e-34
Suva_10.234.6ON16615453622e-34
Smik_8.64.6ON15855143613e-34
TDEL0E056104.52ON15355403603e-34
SAKL0H26026g4.6ON16535063604e-34
KNAG0E011204.6ON17175573595e-34
KNAG0K001705.10ON14425313585e-34
TDEL0G018504.6ON16424863561e-33
YHL035C (VMR1)4.6ON15925303561e-33
NDAI0H001904.6ON16825123551e-33
TPHA0F001804.6ON16465763551e-33
Kpol_311.34.6ON16575103542e-33
TPHA0A056205.10ON14775743532e-33
KLTH0H16038g4.6ON16495033532e-33
YLL048C (YBT1)4.6ON16615603532e-33
Skud_12.524.52ON15615383523e-33
TPHA0K023104.6ON16495043514e-33
Smik_12.114.6ON16615503481e-32
KLTH0C09240gna 1ON15465503452e-32
NCAS0B034708.303ON15124833434e-32
Kpol_1060.75.10ON14605623434e-32
Skud_12.224.6ON16615513409e-32
Zrou_YGOB_Anc_5.105.10ON9925883371e-31
SAKL0H00704g5.10ON14395723381e-31
TBLA0A06840singletonON10585493353e-31
Suva_10.594.52ON15615483363e-31
Skud_4.3958.303ON15164863363e-31
Suva_10.60singletonON9905493334e-31
YLL015W (BPT1)4.52ON15595453345e-31
Kpol_1033.288.303ON15315463336e-31
KAFR0L001904.6ON16535103327e-31
KLTH0B09724g5.10ON14865563328e-31
Kwal_56.22747na 1ON15383213329e-31
KAFR0B056308.303ON15154853319e-31
ACL072C4.6ON16275053311e-30
KLLA0C14234g5.10ON14545403273e-30
KLTH0G12716g8.303ON15002493273e-30
Kwal_56.238448.303ON14944853274e-30
CAGL0C03289g4.6ON16484933264e-30
KAFR0I013004.52ON15365413264e-30
YDR135C (YCF1)8.303ON15154873264e-30
Suva_8.164.6ON15995183247e-30
YKR104WsingletonON3062913057e-30
SAKL0H16016g8.303ON14995283248e-30
Smik_4.3808.303ON15164793231e-29
TBLA0C071005.10ON14855733231e-29
Suva_2.2978.303ON15164863212e-29
Kwal_26.95325.10ON14715403212e-29
ZYRO0G22176g4.52ON15705303202e-29
ZYRO0D06160g8.303ON15252913175e-29
TDEL0G003305.10ON14655883175e-29
KNAG0I009908.303ON15354893166e-29
KLTH0B00396gsingletonON15072453158e-29
TBLA0C06400singletonON13775573131e-28
KLLA0F20075g8.303ON15164793122e-28
TPHA0F004104.52ON15705593122e-28
Skud_8.94.6ON15875323095e-28
CAGL0L06402g8.303ON15352683023e-27
AGR047W8.303ON14925282962e-26
Skud_18.2singletonON15802592962e-26
TDEL0F043008.303ON15145042952e-26
SAKL0H23958g4.52ON15582892952e-26
TBLA0A038008.303ON15465552943e-26
Smik_11.367na 2ON15955442926e-26
Kpol_1041.45singletonOFF15965502901e-25
Kpol_YGOB_1041.454.52ON15685502891e-25
KLLA0D04059g4.52ON15682792882e-25
AGL346W5.10ON14005052578e-22
Ecym_56605.10ON15362082032e-15
YKR103W (NFT1)na 2ON12182301952e-14
YPL147W (PXA1)8.661ON8702321816e-13
ACR128C8.661ON8271871816e-13
Kpol_175.1singletonON13772051801e-12
Smik_6.3448.661ON8702321782e-12
Suva_16.1638.661ON8702061772e-12
TBLA0D043501.427ON11192531763e-12
SAKL0D10208g1.366ON7522371727e-12
Skud_16.1358.661ON8702321711e-11
Ecym_24108.661ON8281911701e-11
KLTH0D10890g8.661ON8302091701e-11
ZYRO0B05588g3.133ON12702231692e-11
Kwal_26.87308.661ON8312101682e-11
SAKL0H21010gsingletonON14472391692e-11
NDAI0H035701.366ON7552081673e-11
TDEL0B057601.427ON10362451673e-11
CAGL0K10472g1.366ON7522121664e-11
AER190W1.427ON10112681656e-11
ZYRO0E08800g3.534ON6102421637e-11
KNAG0I005301.427ON10472441647e-11
Suva_5.1343.534ON6101881611e-10
AEL032W1.366ON7532411611e-10
SAKL0D09394g1.427ON10272771621e-10
ZYRO0D11880g5.500ON14982371622e-10
Ecym_11943.534ON6092851602e-10
KLTH0H12760g1.427ON10202641602e-10
NDAI0E012408.661ON8972081602e-10
ZYRO0E04092g1.427ON10622461602e-10
Kwal_23.51613.220ON14892391612e-10
TPHA0D011708.661ON9152091602e-10
YER036C (ARB1)3.534ON6102421593e-10
YOL075C3.133ON12942361593e-10
KLLA0F11484g8.661ON8452081593e-10
Kwal_0.3271.427ON10192641593e-10
Skud_5.1453.534ON6102721583e-10
Smik_5.1593.534ON6101881583e-10
Suva_15.913.133ON13022361594e-10
KNAG0C019601.366ON7522391584e-10
Skud_4.2623.220ON15012401594e-10
TPHA0O010001.427ON10112751584e-10
SAKL0F01606g3.534ON6081781574e-10
KAFR0C045401.366ON7522391565e-10
KLTH0H13442g1.366ON7522411567e-10
KLTH0A01914g3.220ON14992361567e-10
TBLA0I033303.534ON6102471557e-10
NCAS0A085701.427ON10602551558e-10
Kpol_1043.431.366ON7522331559e-10
ZYRO0F07018g8.661ON8612171541e-09
SAKL0C11616g3.220ON14842331551e-09
KNAG0A029808.661ON8712051541e-09
KLLA0D04554g1.427ON10222191541e-09
ZYRO0B14762gsingletonON15152401541e-09
KLLA0A10857g1.366ON7522261531e-09
ZYRO0G01144g1.366ON7522351532e-09
NDAI0G050201.427ON10972571532e-09
TDEL0A060708.661ON8721931522e-09
TBLA0C012201.366ON7512271522e-09
TBLA0D01820singletonON15512131532e-09
KAFR0C052205.500ON14992501522e-09
TPHA0A008403.133ON13122341522e-09
YDR011W (SNQ2)3.220ON15012401522e-09
TBLA0D017805.500ON15952131522e-09
KAFR0A037908.661ON8762061512e-09
ZYRO0D11836gna 3ON14622371522e-09
NCAS0B053003.133ON12732291522e-09
TDEL0D040403.220ON15002371523e-09
NCAS0A120605.500ON15432761513e-09
KNAG0B038705.500ON15132361513e-09
CAGL0C02343g3.534ON7201881503e-09
AGL142CsingletonON14972331513e-09
Smik_15.843.133ON12952231513e-09
KNAG0K009503.133ON12842741513e-09
TPHA0A023101.366ON7522271503e-09
Smik_7.3131.366ON7522121503e-09
Kwal_27.9666singletonON14743231503e-09
YFR009W (GCN20)1.366ON7522121494e-09
CAGL0I04862g3.220ON15072361504e-09
Skud_14.404na 4ON14242361504e-09
SAKL0H06908g8.661ON8361861494e-09
KLLA0A01452g3.534ON6073441485e-09
Kwal_34.162401.366ON7522411485e-09
NCAS0F00410singletonON15312741486e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.7
         (773 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)  1417   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...  1308   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...  1273   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...  1269   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   905   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   882   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      883   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   880   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   882   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   877   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   858   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   844   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   822   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   817   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   815   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   801   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   800   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   796   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   771   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   755   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   530   e-178
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   524   e-176
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   521   e-175
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   521   e-175
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   518   e-174
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   518   e-174
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   516   e-173
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   516   e-173
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   515   e-173
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   513   e-172
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   512   e-171
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   506   e-170
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   501   e-167
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   496   e-165
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   494   e-165
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   487   e-162
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   471   e-156
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   465   e-155
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   218   1e-58
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   203   4e-55
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   201   5e-54
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   201   5e-53
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   196   2e-52
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   196   2e-52
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   195   5e-51
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   194   1e-50
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   190   2e-50
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   189   3e-50
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   189   3e-50
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   188   7e-50
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   188   7e-50
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   188   9e-50
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     188   9e-50
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   189   3e-49
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   189   6e-49
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   185   8e-49
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   182   1e-47
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   181   2e-47
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   184   3e-47
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   179   6e-47
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   179   1e-46
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   177   3e-46
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   179   5e-46
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   178   2e-45
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   175   2e-45
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   177   5e-45
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   176   7e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   173   9e-45
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   175   1e-44
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   174   2e-44
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   174   4e-44
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   172   9e-44
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   169   2e-43
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   171   3e-43
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   169   2e-42
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   166   1e-41
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    166   2e-41
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   160   8e-40
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   154   8e-38
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    154   8e-38
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   154   1e-37
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   152   5e-37
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   151   9e-37
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   150   2e-36
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   149   3e-36
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   149   3e-36
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   148   7e-36
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   148   9e-36
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   148   9e-36
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   147   1e-35
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   147   1e-35
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   147   1e-35
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   146   3e-35
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   146   3e-35
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   146   3e-35
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   146   3e-35
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   145   5e-35
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   145   5e-35
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   144   1e-34
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   144   2e-34
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   144   2e-34
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   143   3e-34
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   143   3e-34
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   143   4e-34
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   142   5e-34
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   142   5e-34
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   141   1e-33
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   141   1e-33
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   141   1e-33
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   141   1e-33
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   140   2e-33
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   140   2e-33
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   140   2e-33
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   140   2e-33
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   140   3e-33
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   139   4e-33
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   138   1e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   137   2e-32
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   136   4e-32
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   136   4e-32
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   135   9e-32
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   134   1e-31
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   134   1e-31
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   133   3e-31
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   134   3e-31
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   134   3e-31
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   132   4e-31
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   133   5e-31
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   132   6e-31
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   132   7e-31
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   132   8e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   132   9e-31
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   132   9e-31
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   132   1e-30
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   130   3e-30
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   130   3e-30
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   130   4e-30
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   130   4e-30
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   130   4e-30
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   130   4e-30
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   129   7e-30
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   122   7e-30
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   129   8e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   129   1e-29
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           129   1e-29
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   128   2e-29
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   128   2e-29
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   127   2e-29
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   126   5e-29
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   126   5e-29
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   126   6e-29
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   125   8e-29
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   125   1e-28
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   124   2e-28
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   124   2e-28
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   123   5e-28
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   120   3e-27
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   118   2e-26
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   118   2e-26
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   118   2e-26
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   118   2e-26
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   117   3e-26
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   117   6e-26
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   116   1e-25
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   115   1e-25
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   115   2e-25
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   103   8e-22
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    83   2e-15
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    80   2e-14
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    74   6e-13
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    74   6e-13
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    74   1e-12
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    73   2e-12
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    73   2e-12
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    72   3e-12
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    71   7e-12
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    70   1e-11
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    70   1e-11
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    70   1e-11
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    70   2e-11
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    69   2e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    70   2e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    69   3e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    69   3e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    69   4e-11
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    68   6e-11
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    67   7e-11
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    68   7e-11
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    67   1e-10
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    67   1e-10
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    67   1e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    67   2e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    66   2e-10
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    66   2e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     66   2e-10
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    66   2e-10
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    67   2e-10
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    66   2e-10
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    66   3e-10
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    66   3e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    66   3e-10
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    66   3e-10
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    65   3e-10
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    65   3e-10
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    66   4e-10
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    65   4e-10
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    66   4e-10
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    65   4e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   4e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    65   5e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    65   7e-10
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    65   7e-10
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    64   7e-10
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    64   8e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    64   9e-10
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    64   1e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    64   1e-09
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    64   1e-09
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    64   1e-09
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    64   1e-09
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    64   1e-09
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    64   2e-09
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    64   2e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    63   2e-09
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    63   2e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              64   2e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    63   2e-09
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    63   2e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    63   2e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    63   2e-09
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    63   2e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    63   2e-09
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    63   2e-09
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    63   3e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    63   3e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    63   3e-09
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    62   3e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    63   3e-09
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    63   3e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    63   3e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    62   3e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    62   3e-09
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    62   3e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    62   4e-09
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    62   4e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    62   4e-09
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    62   4e-09
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    62   5e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    62   5e-09
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                62   6e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    62   7e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            61   8e-09
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    61   8e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    61   8e-09
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    61   9e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    61   9e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    61   9e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    61   9e-09
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 61   9e-09
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    61   1e-08
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    61   1e-08
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    61   1e-08
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    61   1e-08
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    60   1e-08
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    60   1e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    60   1e-08
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              60   1e-08
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    60   2e-08
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    60   2e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    60   2e-08
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    60   2e-08
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    60   2e-08
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    60   2e-08
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       60   2e-08
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    60   2e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    60   2e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    60   2e-08
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    60   2e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    60   2e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    60   2e-08
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             60   2e-08
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    60   2e-08
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    59   2e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    60   3e-08
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    60   3e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    60   3e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    59   3e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    59   3e-08
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    59   3e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    59   3e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    59   3e-08
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    59   3e-08
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    59   3e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    59   3e-08
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    59   3e-08
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    59   4e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    59   4e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    59   4e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    59   4e-08
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    59   4e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    59   5e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    59   6e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    59   6e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    58   6e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    58   7e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    58   7e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    58   7e-08
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    58   7e-08
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    58   8e-08
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    58   9e-08
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    58   9e-08
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    57   1e-07
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    57   1e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    58   1e-07
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    57   1e-07
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    56   1e-07
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    57   1e-07
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    52   2e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    57   2e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    57   2e-07
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    57   2e-07
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    57   2e-07
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    57   2e-07
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    57   2e-07
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    57   2e-07
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    57   2e-07
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    56   2e-07
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    57   2e-07
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            57   2e-07
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    57   3e-07
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    56   3e-07
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    56   3e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    56   3e-07
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    56   3e-07
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    56   3e-07
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    56   3e-07
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    56   3e-07
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    56   3e-07
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    56   3e-07
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    55   4e-07
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    56   4e-07
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    56   4e-07
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    55   5e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    55   6e-07
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    55   6e-07
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    55   7e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    55   7e-07
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    55   8e-07
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    55   8e-07
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    55   9e-07
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    54   9e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    55   1e-06
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    54   1e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    54   1e-06
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    54   2e-06
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    54   2e-06
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    54   2e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    54   2e-06
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    54   2e-06
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    54   2e-06
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    53   2e-06
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    53   2e-06
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    52   3e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    53   4e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    53   4e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    52   4e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    52   6e-06
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    52   6e-06
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    51   6e-06
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    52   7e-06
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    52   7e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    52   7e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    52   7e-06
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    50   7e-06
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    52   8e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    52   8e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    52   9e-06
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    51   1e-05
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    51   1e-05
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    51   1e-05
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    51   1e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    51   1e-05
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    49   2e-05
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     50   2e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    50   2e-05
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    50   2e-05
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    50   2e-05
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    49   2e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    50   2e-05
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    49   3e-05
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    50   3e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    50   3e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    49   4e-05
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    48   4e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    49   4e-05
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    49   4e-05
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    49   5e-05
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    49   6e-05
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    48   8e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    48   9e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    48   9e-05
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    48   1e-04
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    47   1e-04
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    47   1e-04
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              47   2e-04
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    46   2e-04
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    47   2e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    47   2e-04
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    47   2e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    47   2e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    47   2e-04
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    46   2e-04
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    47   2e-04
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    47   3e-04
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    46   3e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    46   4e-04
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    46   4e-04
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    45   4e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    46   5e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    46   5e-04
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    45   5e-04
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    45   6e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    45   7e-04
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    45   7e-04
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    45   8e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    45   8e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    45   0.001
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    45   0.001
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    44   0.001
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    45   0.001
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    45   0.001
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    44   0.001
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.001
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    44   0.001
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    44   0.001
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    43   0.001
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    44   0.001
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    44   0.001
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.001
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    44   0.001
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    44   0.002
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    44   0.002
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    44   0.002
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    44   0.002
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    44   0.002
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    44   0.002
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    44   0.002
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.002
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    44   0.002
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    43   0.002
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    44   0.003
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    42   0.003
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    42   0.003
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    43   0.003
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    43   0.003
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    43   0.003
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    43   0.003
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    43   0.003
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    43   0.003
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    43   0.003
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    42   0.005
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.005
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    42   0.005
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    42   0.006
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    42   0.006
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    41   0.006
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    42   0.007
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    42   0.007
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    41   0.008
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    42   0.008
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    41   0.008
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.008
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    41   0.010
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    41   0.010
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    41   0.011
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    41   0.012
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    41   0.015
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    41   0.015
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    41   0.016
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    40   0.016
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    40   0.017
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    40   0.017
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    40   0.019
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    40   0.024
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     40   0.024
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    40   0.033
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    40   0.034
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    40   0.035
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    39   0.041
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    39   0.047
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    39   0.070
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    39   0.071
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    38   0.079
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    37   0.099
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    38   0.12 
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    37   0.15 
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    37   0.18 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    37   0.23 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    36   0.44 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    36   0.49 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.55 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    35   0.63 
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    35   0.71 
Suva_43.1 Chr43 (2..1099) [1098 bp, 366 aa] {ON} YDR011W (REAL)        35   0.87 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.97 
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    35   1.1  
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    34   1.3  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    34   1.5  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    34   1.5  
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    34   1.8  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    33   2.6  
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    33   2.7  
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    33   3.0  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    33   4.6  

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score = 1417 bits (3668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/773 (91%), Positives = 704/773 (91%)

Query: 1   MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL 60
           MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL
Sbjct: 1   MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL 60

Query: 61  LQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKXXX 120
           LQFSRYNSSKTEPV          KDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWK   
Sbjct: 61  LQFSRYNSSKTEPVALLSSSSSASKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKLLL 120

Query: 121 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI 180
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI
Sbjct: 121 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI 180

Query: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ
Sbjct: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 421 LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV
Sbjct: 421 LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480

Query: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660
           IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660

Query: 661 DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIXXXXXXXXXXXXXAPXXXXX 720
           DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQI             AP     
Sbjct: 661 DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIEKDNENEESTEEKAPDHSNK 720

Query: 721 XXXXXXXXXXXXXXXXQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773
                           QSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP
Sbjct: 721 NDNDDNDNNHDNDSNKQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score = 1308 bits (3384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/773 (84%), Positives = 676/773 (87%)

Query: 1   MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL 60
           MLNGRLPLLRLG+CRN++SRPRLAKLPSI+FRSLVTPSSS LIP++RLC+RSP VGKSL+
Sbjct: 1   MLNGRLPLLRLGICRNMLSRPRLAKLPSIRFRSLVTPSSSQLIPLSRLCLRSPAVGKSLI 60

Query: 61  LQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKXXX 120
           LQ  R NSSKT P           K S + A   ++SKTDDYKDIIRLFMLAKRDWK   
Sbjct: 61  LQSFRCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLL 120

Query: 121 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI 180
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFF+LKIPIFSLPLYEFLSFFTVALLI
Sbjct: 121 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 180

Query: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GCAANFGRFILLRILSERVVARLRA+VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ
Sbjct: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 421 LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTDRKPSISPT GHKYKP RGV+EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV
Sbjct: 421 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480

Query: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSGRGKSTIALLLLRYYNP+TGTI ID+QDI+K+NCKSLRRHIGIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG  GTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660
           IKKPTILILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIVLGH
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660

Query: 661 DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIXXXXXXXXXXXXXAPXXXXX 720
           DGSVVEMGKFK+LYANPTSALSQLLNE+AAPGPSDQQ QI                    
Sbjct: 661 DGSVVEMGKFKELYANPTSALSQLLNEKAAPGPSDQQLQIEKVIEKEDLNESKEHDDQKK 720

Query: 721 XXXXXXXXXXXXXXXXQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773
                           QS E    NSDDIE+SVEHLL+DAAKEA PIK+TPQP
Sbjct: 721 DDNDDNDNNHDNDSNNQSPETKDNNSDDIEKSVEHLLKDAAKEANPIKITPQP 773

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score = 1273 bits (3294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/773 (83%), Positives = 667/773 (86%)

Query: 1   MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL 60
           MLN RLPLLRLG+ RN++SRPR+ KLP ++FRSLVT SSS LI IN L  RSP +GK+L+
Sbjct: 1   MLNSRLPLLRLGLYRNMLSRPRMTKLPFMRFRSLVTHSSSQLILINPLHTRSPIIGKTLI 60

Query: 61  LQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKXXX 120
           L   RY SSKT+            K S K A   ++SKTDDYKDIIRLFMLAKRDWK   
Sbjct: 61  LSSFRYISSKTKLQAPLPSVSSTSKGSSKSAHSTEQSKTDDYKDIIRLFMLAKRDWKLLL 120

Query: 121 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI 180
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFF+LKIPIFSLPLYEFLSFFTVALLI
Sbjct: 121 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 180

Query: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           SMTQKVSDGVKALICG+VGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ
Sbjct: 241 SMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 421 LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTDRKPSISPT GHKY+P RGV+EFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCIV
Sbjct: 421 LFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 480

Query: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSGRGKSTIALLLLRYYNP+TGTIMID+QDITK+NCKSLRR IGIVQQEPVLMSGTIRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRD 540

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG  GTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660
           IKKPTILILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIVLGH
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660

Query: 661 DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIXXXXXXXXXXXXXAPXXXXX 720
           DGSVVEMGKFK+LYAN TSALSQLLNERAAPGPSDQQ QI                    
Sbjct: 661 DGSVVEMGKFKELYANSTSALSQLLNERAAPGPSDQQLQIEKVEEKEDTNEGEKHDQQNK 720

Query: 721 XXXXXXXXXXXXXXXXQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773
                           QS EV  KNS++IEESVEHLL+DAAKEA PIKLTPQP
Sbjct: 721 QDDDNSHNNHDNDSNNQSLEVKDKNSENIEESVEHLLKDAAKEANPIKLTPQP 773

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score = 1269 bits (3284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/773 (82%), Positives = 666/773 (86%), Gaps = 6/773 (0%)

Query: 1   MLNGRLPLLRLGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLL 60
           MLNGRLPL RLG+ RN++SR RL KLP I+FRSL T SSSHLIPI+ LC R   + KSLL
Sbjct: 1   MLNGRLPLFRLGVYRNVLSRSRLVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPISKSLL 60

Query: 61  LQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKXXX 120
            QF R+NS+KT+            K   +PA+P  +SK+DDYKDIIRLFMLAKRDWK   
Sbjct: 61  SQFVRFNSTKTQQDIPPLPSTSASK---QPAKPAYQSKSDDYKDIIRLFMLAKRDWKLLL 117

Query: 121 XXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLI 180
                   SCSIGMSIPKVIGIVLDTLKTSSGSDFF+LKIPIFSLPLYEFLSFFTVALLI
Sbjct: 118 TAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDLKIPIFSLPLYEFLSFFTVALLI 177

Query: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           GC ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR
Sbjct: 178 GCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 237

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           SMTQKVSDGVKALICGVVGVGMMCSLSPQLS+LLLFFTPPVLFSASVFGKQIRNTSKDLQ
Sbjct: 238 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQ 297

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
           EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG              SL
Sbjct: 298 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 357

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR
Sbjct: 358 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 417

Query: 421 LFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           LFELTDRKPSISPT GHKYKP RGV+EFKDVSFSYPTRPSVQIFK+LNFKIAPGSSVCIV
Sbjct: 418 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIV 477

Query: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
           GPSGRGKSTIALLLLRYYNP+TGTIMID+QDITKMNCKSLRRHIGIVQQEPVLMSGTIRD
Sbjct: 478 GPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 537

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
           NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG  GTLLSGGQKQRIAIARAL
Sbjct: 538 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARAL 597

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660
           IKKPT+LILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIVLGH
Sbjct: 598 IKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 657

Query: 661 DGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIXXXXXXXXXXXXXAPXXXXX 720
           DGSVVEMGKFK+LY+NPTSALSQLLNER AP PS+QQQQ+                    
Sbjct: 658 DGSVVEMGKFKELYSNPTSALSQLLNERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNE 717

Query: 721 XXXXXXXXXXXXXXXXQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQP 773
                           +S++   K SDDIEESVEH+L+DAAKEA PIKL+P P
Sbjct: 718 GDDGSNHDNDSNNKPLESKD---KKSDDIEESVEHVLKDAAKEANPIKLSPPP 767

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/611 (72%), Positives = 502/611 (82%), Gaps = 8/611 (1%)

Query: 89  KPARPPQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK 148
           K  +   +    +++DI+RL +L +RDWK           SCSIGM+IPKVIG++LD LK
Sbjct: 104 KEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLK 163

Query: 149 TSSGSDFFE------LKIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVV 200
            +  ++  +       K+P  +F L  YEFL  F +ALL+G AAN+GR ILLR+LSER+V
Sbjct: 164 NALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLV 223

Query: 201 ARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 260
           ARLRA VIKKT+HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+
Sbjct: 224 ARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGI 283

Query: 261 GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
           GMM +LSPQLS LLL FTPPV+ SASVFGKQI  TS++LQEATG LT+VAEEQLSGIKTV
Sbjct: 284 GMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTV 343

Query: 321 QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 380
           QSFVAE  E++RYN AIRDIF +G              S +GDLSFLTVL +GSYLVLQ+
Sbjct: 344 QSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQN 403

Query: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYK 440
            L+IGDLTAFM+YTEYTGN++FGLSTFYSEIMQGAGAASRLFELTDR PSIS T G KYK
Sbjct: 404 SLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK 463

Query: 441 PHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           P  G +EFK+VSF+YPTRPS  IFKNLNFKI  GS+VCIVGPSGRGKST+ALLL +YY P
Sbjct: 464 PGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKP 523

Query: 501 STGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
           S+G I+ID Q+I  +N KSLRRHIG+VQQEP+LMSGTIRDNI YGLT  PTK+EIR VAK
Sbjct: 524 SSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAK 583

Query: 561 QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           QCFCHNFIT+F ++YDTVIG  GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVES
Sbjct: 584 QCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES 643

Query: 621 EGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSA 680
           EGAINYTFG LMK K MTI+SIAHRLSTIRRSENVIVLGHDGSVVEMGKFK+L+ +PTS 
Sbjct: 644 EGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSE 703

Query: 681 LSQLLNERAAP 691
           LSQLLNE++ P
Sbjct: 704 LSQLLNEKSTP 714

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/602 (72%), Positives = 498/602 (82%), Gaps = 5/602 (0%)

Query: 101 DYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT-SSGSDFFELK 159
           +  D+ RL  LAKRDWK           SC IGMS+PK+IGIVLD LK   S  DF    
Sbjct: 98  ELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVDD 157

Query: 160 IP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAE 217
           +P   F L LYEF+S   V+LL+G AAN+GR ILLR+LSERVVARLRA+VIKKT+HQDAE
Sbjct: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217

Query: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFF 277
           FFDN+KVGDLISRL SDAYVVSRS+TQKVSDG KA++CG VG+GMM S+SPQLS  LLF 
Sbjct: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277

Query: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337
           TPPV+ SAS FG+ IRN S+DLQEATG LT+VAEEQ SGIKTVQSFVAE  E+ RYN AI
Sbjct: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337

Query: 338 RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397
           R IF VG              ++LGD+SFL VLAYGSYLVL   LSIGDLTA+M+YTEYT
Sbjct: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397

Query: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPT 457
           G+++FGLSTFYSEIMQGAGAASRLFELTDR PSISPT G K+ P++G +EFK+VSFSYPT
Sbjct: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           R S QIFKNL+FKI  GS+VCIVGPSGRGKSTIA LLLRYYNP+TG I +D QDI+K++ 
Sbjct: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
           KSLRRH+ IVQQEPVLMSGTIRDNITYGL   PT++E+RS+ K+CFCHNFITKFPN+YDT
Sbjct: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSM 637
           ++G  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG LMKSKS+
Sbjct: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637

Query: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQ 697
           TIISIAHRLSTIRRSENVIVLG+DGSV E+GKFK+LYA+P S LS+LL+E+A    S++Q
Sbjct: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKAT--RSERQ 695

Query: 698 QQ 699
           Q 
Sbjct: 696 QN 697

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/594 (73%), Positives = 497/594 (83%), Gaps = 4/594 (0%)

Query: 101 DYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK--TSSGSDFFEL 158
           ++ D+IRLF+L K DWK           SC IGM IPKVIGI+LD+LK  T++ S+  E 
Sbjct: 123 NFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTATQSEGEEA 182

Query: 159 KIPI--FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDA 216
             PI  F L +YEFL  F++ALL GC ANFGR ILLRILSER+VARLR+ VIK+T+HQDA
Sbjct: 183 PPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIKRTIHQDA 242

Query: 217 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276
           +F+D HK GDLISRLG+DAY+VSRS+TQK+SDG K+LICG VGVGMMCSLS  LS +L  
Sbjct: 243 QFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGV 302

Query: 277 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
              PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G+KTVQSFVAE  E+ R+N A
Sbjct: 303 LIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEA 362

Query: 337 IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
           IR+IF VG              SL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEY
Sbjct: 363 IRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEY 422

Query: 397 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYP 456
           TGN++FGLSTFYSEIMQGAGAASRLFELTD  P I PT G  Y P +G +EFK+VSFSYP
Sbjct: 423 TGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYP 482

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
           TRP  QIFKNLNFKI PGS+VCIVGPSG+GKSTIALLLL YYNP++G I+ID QDITKMN
Sbjct: 483 TRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMN 542

Query: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
            KSLRR +GIVQQEPVLMSG+IRDNITYGLTYTPTKEEIR VAKQCFCHNFITKFP+TYD
Sbjct: 543 SKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYD 602

Query: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKS 636
           T IG  GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG LMK+KS
Sbjct: 603 TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKS 662

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAA 690
           MTI+SIAHRLSTIRRSENVIVLG+DGSV+EMGKFK+L+++P+S LS+LLNE+++
Sbjct: 663 MTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKSS 716

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/609 (70%), Positives = 498/609 (81%), Gaps = 6/609 (0%)

Query: 88  VKPARPPQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTL 147
           VK    P + K   YKD +RLF LAKRDW+           SC IGMSIPKVIG+VLD L
Sbjct: 63  VKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVL 122

Query: 148 KTS-SGSDFFELKI----PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVA 201
           +    G D   + +    PI F L +Y+FL  F   LL+G AANF R ++LRILSERVVA
Sbjct: 123 RKGIEGKDLQNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVA 182

Query: 202 RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
           RLR+ V+ KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+G
Sbjct: 183 RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242

Query: 262 MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           MM S+SP+LS +LLFF PP+L+SASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQ
Sbjct: 243 MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQ 302

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ 381
           SFVAE  EL RYN AIR I+ VG              ++LGD+SF+ VL YGSYLVLQ  
Sbjct: 303 SFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGS 362

Query: 382 LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKP 441
           L+IGDLTAFMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P
Sbjct: 363 LTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP 422

Query: 442 HRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
            +G +EFK+VSFSYPTRP  QIFK++N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNP+
Sbjct: 423 GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482

Query: 502 TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
            G I++D QDI+K+NCK+LRRHIG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQ
Sbjct: 483 NGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQ 542

Query: 562 CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           CFCHNFITKFP+ YDT+IG++G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESE
Sbjct: 543 CFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESE 602

Query: 622 GAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
           GAINYTFG LMKS SMTI+SIAHRLSTI+RSENVIVLG DGSV+E GKFK+L+ANP S L
Sbjct: 603 GAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662

Query: 682 SQLLNERAA 690
            +LL E+++
Sbjct: 663 CKLLTEKSS 671

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/715 (62%), Positives = 535/715 (74%), Gaps = 13/715 (1%)

Query: 65  RYNSSK--TEPVXXXXXXXXXXKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKXXXXX 122
           R+NS+   T+ +          K S +P          ++KD+ RLF+L K+D+K     
Sbjct: 121 RFNSTTNTTDTIPPHTESTESTKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVS 180

Query: 123 XXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIP---IFSLPLYEFLSFFTVALL 179
                 SC+IGM IPK+IG++LD LK+ + +       P   +F L LYEFL  F+VAL 
Sbjct: 181 LTLLTISCTIGMMIPKIIGLILDALKSVATTPDGGSSPPPTIMFGLTLYEFLGGFSVALF 240

Query: 180 IGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 239
           IGCAAN+GR ILLRILSER+VARLR+ V+K TLHQD+EFFD HKVGDLISRLG+D+Y+VS
Sbjct: 241 IGCAANYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVS 300

Query: 240 RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
           RS+TQK+SDGVK+LICG VG+GMM  LS  LS +L+ F  PV+ SAS+FGKQIR  S++L
Sbjct: 301 RSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSREL 360

Query: 300 QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
           Q+ATGQLTRV+EEQL+G++TVQSFVAE  E+ R+N +IR+IF VG              S
Sbjct: 361 QDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTS 420

Query: 360 LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
           L+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYTGNA+FGLSTFYSEIMQGAGAAS
Sbjct: 421 LVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAAS 480

Query: 420 RLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
           RLFELTDR P+I PT G  Y P +G +EFK+VSF+YPTRPS QIFK+LNFKI PGS+VCI
Sbjct: 481 RLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCI 540

Query: 480 VGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 539
           VGPSG+GKSTIALLLL YYNP++G I+ID QDITK+N KSLRR I +VQQEPVLMSGTIR
Sbjct: 541 VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIR 600

Query: 540 DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARA 599
           DNITYGLT  PTKEEIR+VAKQCFCHNFI KFP TYDT IG  GTLLSGGQKQRIAIARA
Sbjct: 601 DNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARA 660

Query: 600 LIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLG 659
           LIKKP ILILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSEN+IVLG
Sbjct: 661 LIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLG 720

Query: 660 HDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQIXXXXXXXXXXXXXAPXXXX 719
           +DGSVVEMGKFK+L+A+PTS LS+LLNE+++      ++++             +     
Sbjct: 721 NDGSVVEMGKFKELFADPTSELSKLLNEKSS------RKKVVTKTVPPVSSTSVSSANGS 774

Query: 720 XXXXXXXXXXXXXXXXXQSQEV--THKNSDDIEESVEHLLRDAAKEATPIKLTPQ 772
                               E   T   +  +E+S+E +L D + E+ PIKL+P+
Sbjct: 775 SIHHEGTILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPIKLSPK 829

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/654 (67%), Positives = 512/654 (78%), Gaps = 11/654 (1%)

Query: 43  IPINRLCIRSPTVGKSLLLQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKTDDY 102
           +PI +  +RS    +  L   S+     T P+            +  P    Q+S     
Sbjct: 35  LPIVQPSVRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPKEAEQKS---GL 91

Query: 103 KDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKT----SSGSD---F 155
           KD++RL MLAK DWK           SC IGM+IPKVIG++LD LKT    + G D    
Sbjct: 92  KDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGKDGPIS 151

Query: 156 FELKIPIF-SLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214
                PIF    +YEFL  F   ++ G  AN+GR +LLRILSERVVARLRA+VIKKT+HQ
Sbjct: 152 MADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIKKTIHQ 211

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274
           D+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VGVGMM S+SPQLS LL
Sbjct: 212 DSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSISPQLSGLL 271

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           L FTPPVLFSAS+FG++IR+TS DLQEATGQLTRV+EEQLSG++TVQSFVAE  E+ RY+
Sbjct: 272 LLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKEIHRYS 331

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
            AIRDIF VG              S LGD+SFL VLAYGSYLVLQ  L+IGDLTAFMLYT
Sbjct: 332 HAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTAFMLYT 391

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFS 454
           EYTG++VFGL++FYSE+MQG GAA+RLFELTDR PSI PT G K+ P +G + FKDV+FS
Sbjct: 392 EYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFKDVTFS 451

Query: 455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITK 514
           YPTRP   IF++++ KI  GS+VC+VGPSGRGKSTIALLLLR+YNPS+G I ID QDI+K
Sbjct: 452 YPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDGQDISK 511

Query: 515 MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574
           +N KSLRRHIG+VQQEPVLMSGT+RDNITYGLT TP+KEEIR VAKQCFCHNFI KFP+ 
Sbjct: 512 LNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIVKFPHG 571

Query: 575 YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS 634
           YDTVIG +G LLSGGQKQRIAIARALIKKPTIL+LDEATSALDVESEGAINYTFG LMKS
Sbjct: 572 YDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFGQLMKS 631

Query: 635 KSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNER 688
           KS+TI+SIAHRLSTIRRSEN+IVLG+DGSVVE GKFK+L+A+P+S LS+LLNE+
Sbjct: 632 KSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLLNEK 685

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/603 (70%), Positives = 484/603 (80%), Gaps = 13/603 (2%)

Query: 100 DDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTS-SGSDFFEL 158
           +D  DI RL  LAK+DWK           SC+IGMS+PKVIG+VLD LK + S S+  EL
Sbjct: 72  NDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAEL 131

Query: 159 ----------KIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206
                     ++P   F L LYEFL     ALLIG AANFGR +LLR+LSERVVARLR+ 
Sbjct: 132 GSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQ 191

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
           VIKKT+HQDAEFFDN+KVGDLISRLGSDAYVVSRSMTQKVSDG KAL+CG VGVGMM S+
Sbjct: 192 VIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSI 251

Query: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
           SP+LS  LLFFTPPV+ S+  FG+ IR+ S+ LQEATGQLTRV+EEQ SG+KTVQ+FVAE
Sbjct: 252 SPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAE 311

Query: 327 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E+ RYN  I+D++ VG              S LGD+SFL VLAYGSYLVL   LSIGD
Sbjct: 312 QREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGD 371

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVV 446
           LTA+M+YTE TG+AVFGLS+FYSEIMQG GAASRLFELTDR P ISPT G KY P +G +
Sbjct: 372 LTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEI 431

Query: 447 EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIM 506
           EFK+VSF+YPTRP  QIFK+LNFKI PGS+VCIVGPSGRGKSTIA LLL+YY P+ GTI 
Sbjct: 432 EFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTIT 491

Query: 507 IDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
           +D QDI+K+N KSLRRHIGIVQQEP+LMSG+IRDNITYGLTY  T EEIR V KQCFCHN
Sbjct: 492 VDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHN 551

Query: 567 FITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           FITKFP+ Y T++G  GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVESE AINY
Sbjct: 552 FITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINY 611

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
           TFG LMK K +TIISIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ NP S LSQLLN
Sbjct: 612 TFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLN 671

Query: 687 ERA 689
           E++
Sbjct: 672 EKS 674

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/622 (67%), Positives = 493/622 (79%), Gaps = 17/622 (2%)

Query: 86  DSVKPAR----PPQRS----KTDDYK----DIIRLFMLAKRDWKXXXXXXXXXXXSCSIG 133
           D + P+     PP ++    + +D K    ++ RL ++  RDWK           SCSIG
Sbjct: 117 DKINPSSIRSPPPNKTNYSPRAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIG 176

Query: 134 MSIPKVIGIVLDTLK---TSSGSDFFELKIP--IFSLPLYEFLSFFTVALLIGCAANFGR 188
           M+IPKVIG+VLD LK   T S S      +P   F L LY FL  F  AL+IG   N+GR
Sbjct: 177 MAIPKVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGR 236

Query: 189 FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSD 248
           +ILLR+LSERVVARLR+HVIKKTLHQDAEFFD +KVGDLISRLGSDAYVVSRS+TQKVSD
Sbjct: 237 YILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSD 296

Query: 249 GVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           G KA++CG  G+GMM S+SPQLS  L+ F P V+ SAS+FGK+IR+ S  LQEATGQLTR
Sbjct: 297 GFKAILCGGAGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTR 356

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           V+EEQL+G+KTVQSFVAE  E+ RYN AIRDI+ +G              S++GD+SFL 
Sbjct: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLV 416

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           VLAYGSYLVL   L+IGDLTAFMLYT+YT N++FGLS FYSEIMQG GAA RLF+LTDR 
Sbjct: 417 VLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRI 476

Query: 429 PSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKS 488
           P+I PT G K+ P  G +EF+++ F+YPTRP  Q+FKNLNFKI PG+SVCIVGPSGRGKS
Sbjct: 477 PAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKS 536

Query: 489 TIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
           TIALLLLRYYNPS+G I+ID+QDI K+N KSLR+++GIVQQEPVLMSG+IRDNITYGL  
Sbjct: 537 TIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKR 596

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI 608
             T +EIR V+KQCFCHNFITKFP+ Y+T+IG  GTLLSGGQKQRIAIARALIKKP ILI
Sbjct: 597 EATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI 656

Query: 609 LDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           LDEATSALDVESEGAINYTFG LMKSKS+TI+SIAHRLSTIRRSE +IVLG+DGSVVE G
Sbjct: 657 LDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETG 716

Query: 669 KFKKLYANPTSALSQLLNERAA 690
           KFK+LYA+PTS LS+LLNE+ +
Sbjct: 717 KFKELYADPTSELSKLLNEKQS 738

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/778 (57%), Positives = 544/778 (69%), Gaps = 59/778 (7%)

Query: 9   LRLGMCRNIMSRPRLAKLPSIKFRSLVTP-----SSSHLIPINRLCIRSPT--VGKSLLL 61
           LRLG+ ++          PS+  R+ V+P     + SHL  +NR  +R+P   V +S L+
Sbjct: 7   LRLGLLKHTG--------PSLYKRTFVSPIWRFRAGSHL-NVNR--VRTPLHFVKRSPLI 55

Query: 62  QFSRYNSSKTEPVXXXXXXXXXXKDSVKPAR--PPQRSKTDDYKDIIRLFMLAKRDWKXX 119
                 S+   P           +   +PA    P+      YKDI RLF+L K DWK  
Sbjct: 56  PRRVLYSTDVTP----------KEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLL 105

Query: 120 XXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALL 179
                    SC IGM IPKVIG VLD+LK   G +F EL I  + + L  F    +  LL
Sbjct: 106 MSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFSELMI--WDMSLKHFFYGLSGLLL 163

Query: 180 IGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS 239
           +GC AN+ R ILLRILSE +VA+LRA+VIK  +HQDA+FFD +KVGDLISR+G+DA++VS
Sbjct: 164 LGCGANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVS 223

Query: 240 RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSI-LLLFFTPPVLFSASVFGKQIRNTSKD 298
           RS+TQK+SDGVKA+  G  GVGMM S+S  LS  +L+    P+L SA VFGKQIR+ SK 
Sbjct: 224 RSITQKISDGVKAVFIGSAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKK 283

Query: 299 LQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXX 358
           LQE T  LTRV+EEQ +GIKT+QSFVAE +E+ ++N +IR IF VG              
Sbjct: 284 LQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTA 343

Query: 359 SLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
           S++GDLSFL VL+YGS+LV Q QLS+GDLTAFMLYTEYTGNA+F LS F+SEIMQGAGAA
Sbjct: 344 SIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAA 403

Query: 419 SRLFELTDRKPSISPTAGHKYKPHRG-VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSV 477
           SR+FELTD KP I+PT G K+ P +G  +EFK+VSF+YPTRP+V IF+NLNFKI  GS+V
Sbjct: 404 SRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNV 463

Query: 478 CIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGT 537
           CIVGPSG+GKSTIA LLL YYNPS G I+ID QDI+ ++ KSLRRHIGIVQQEP+LMSGT
Sbjct: 464 CIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGT 523

Query: 538 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIA 597
           IRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT+FP+TYDT IG  GTLLSGGQKQRIAIA
Sbjct: 524 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIA 583

Query: 598 RALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIV 657
           RALIKKPT+LILDEATSALDVESEGAINYTFG LMKSKSMTI+SIAHRLSTIRRSENVIV
Sbjct: 584 RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 643

Query: 658 LGHDGSVVEMGKFKKLYANPTSALSQLLNERAA---PGPSDQQQQIXXXXXXXXXXXXXA 714
           LG+DGSVVE GKFK+L+ANP S LS+LL E+++     P  Q Q+I             A
Sbjct: 644 LGNDGSVVEQGKFKELFANPASELSKLLREKSSGNNAAPEIQPQEISQTIEEDPSFSGEA 703

Query: 715 PXXXXXXXXXXXXXXXXXXXXXQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTPQ 772
                                  +  VT   ++   E++  +L+D + E  P+K+ PQ
Sbjct: 704 ---------------------TPASSVTGFKAETEAETINEVLKDISTEGKPLKI-PQ 739

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/684 (60%), Positives = 502/684 (73%), Gaps = 12/684 (1%)

Query: 11  LGMCRNIMSRPRLAKLPSIKFRSLVTPSSSHLIPINRLCIRSPTVGKSLLLQFSRYNSSK 70
           L  CRN        +L + K   L  PS       N+LC +       +   F R + S 
Sbjct: 40  LSHCRNAYKPLPTLRLFTTKRTLLGYPSQ------NKLCDQQCFTKSPISYNFKR-SYST 92

Query: 71  TEPVXXXXXXXXXXKDSVKPARPPQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSC 130
           TE             +  K       +    YK+I RLF LA+ DWK           SC
Sbjct: 93  TEEKSTATTTSTPTPEQKKEQESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISC 152

Query: 131 SIGMSIPKVIGIVLDTLKTSSGSD-----FFELKIPIFSLPLYEFLSFFTVALLIGCAAN 185
           SIGM++PKVIG+VLD  K +  SD       +L   ++ L LY+FL+ F  AL++   AN
Sbjct: 153 SIGMAVPKVIGMVLDVAKNAITSDEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFAN 212

Query: 186 FGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQK 245
           FGR +LLRIL E++VARLR++VIKKT+HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ 
Sbjct: 213 FGRVVLLRILGEKLVARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQN 272

Query: 246 VSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQ 305
           +SDG KA+ICG VG+GMM  +S  L+  L  F PP+L  A+++G++IR+ S+DLQ++TG 
Sbjct: 273 ISDGFKAIICGGVGIGMMFHISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGN 332

Query: 306 LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS 365
           LT+VAEEQLSG+KTVQSFVAE  E+ RYN AIR +F VG              S+LGD S
Sbjct: 333 LTKVAEEQLSGVKTVQSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFS 392

Query: 366 FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
           FL VLAYGS+LVLQ  LSIGDLTAFMLYTEY+G+AVFGLS FYSE+M+GAGAASRLFELT
Sbjct: 393 FLIVLAYGSHLVLQGSLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELT 452

Query: 426 DRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGR 485
           D +PSI  T G  Y P +G ++F++VSFSYPTR + QIF NLNF I  GS+VC+VGPSGR
Sbjct: 453 DHQPSIYATKGVPYVPGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGR 512

Query: 486 GKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 545
           GKSTIA LLL+YYNP++G I ID QDI+K++ KSLRRH+G+VQQEP+LMSG+IRDNITYG
Sbjct: 513 GKSTIASLLLKYYNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYG 572

Query: 546 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPT 605
           + YTPT +EIRSV+K+CFCHNFITKF + Y+TVIG +G LLSGGQKQRIAIARALIKKP 
Sbjct: 573 VPYTPTIDEIRSVSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPN 632

Query: 606 ILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVV 665
           ILILDEATSALDVESEGAINYT G LMKS+ +TIISIAHRLSTIRRSENVIVLG DGSVV
Sbjct: 633 ILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVV 692

Query: 666 EMGKFKKLYANPTSALSQLLNERA 689
           EMGKFK+LYA+  S L +LLNE+A
Sbjct: 693 EMGKFKELYASKESKLYKLLNEKA 716

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/602 (66%), Positives = 471/602 (78%), Gaps = 5/602 (0%)

Query: 102 YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS-----DFF 156
           YK++IRLF LA  DWK           S  IGMSIPKVIG+VLD +K +  S        
Sbjct: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLD 198

Query: 157 ELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDA 216
           +L   +  L +YEFL  F  AL+IG  ANFGR +LLR+L E++VARLR++VI+K +HQDA
Sbjct: 199 DLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDA 258

Query: 217 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276
           EFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA+ICG VG+GMM ++S  L+  LL 
Sbjct: 259 EFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLM 318

Query: 277 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
           F PP+L  A ++GK+IR  S+DLQE+TG LTRV+EEQLSG+KT+QSFVAEG EL RYN A
Sbjct: 319 FAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378

Query: 337 IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
           IR +F  G              ++LGDLSFL VLAYGS+LVLQ  L++GDLTAFMLYTEY
Sbjct: 379 IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438

Query: 397 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYP 456
           TG+AVFGLS FYSE+M+GAGAASRLFE+TD  PSI PTAG  Y P  G + FKDVSFSYP
Sbjct: 439 TGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYP 498

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
           TRP  QIF  LNF I PGS+VCIVGPSGRGKSTI  LLLRYYNPS+G I IDDQDI++++
Sbjct: 499 TRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS 558

Query: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
           CKSLRRH+G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVAK+CFCH F+TKFPN YD
Sbjct: 559 CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYD 618

Query: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKS 636
           T+IG RG  LSGGQKQRIAIARAL+KKP ILILDEATSALDVESEGAINYT G LMKSK 
Sbjct: 619 TIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKE 678

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQ 696
           +TIISIAHRLSTIRRSENVIVLG+DGSVVE+GKFK LYA+  S L +LLN++    P+ +
Sbjct: 679 LTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPR 738

Query: 697 QQ 698
            Q
Sbjct: 739 VQ 740

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/610 (64%), Positives = 477/610 (78%), Gaps = 9/610 (1%)

Query: 95  QRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS- 153
           ++SKT+ Y++I+RL  LA+ DWK           S ++GM+IPKVIGIVLD +K +SG  
Sbjct: 100 EKSKTN-YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGF 158

Query: 154 ----DFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209
                  +L   I+ L +++FL+ F   L+ G  ANFGR +LLR+L E++VARLR++VIK
Sbjct: 159 SGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIK 218

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
           K +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA+ICG VG+GMM ++S  
Sbjct: 219 KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISAS 278

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
           L+  L  F PP+L  A ++GK+IR  S++LQE+TG LT+V+EEQLSG+KT+Q+FVAEG E
Sbjct: 279 LTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKE 338

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
           L RYN AIR +F  G               +LGDLSFL VLAYGS+LVLQ  LS+GDLTA
Sbjct: 339 LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTA 398

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFK 449
           FMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD    I P++G  Y P  G ++F+
Sbjct: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFE 458

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDD 509
           DVSFSYPTRP  QIF  LNF I PGS+VC+VGPSGRGKSTIA LLLRYY+P++G IMID 
Sbjct: 459 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518

Query: 510 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569
           Q+I+K++CKSLRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH FIT
Sbjct: 519 QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFIT 578

Query: 570 KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
           KFP  Y+TVIG RG  LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT G
Sbjct: 579 KFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 638

Query: 630 HLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERA 689
            LM+S+ +TIISIAHRLSTIRRSENVIVLG+DGSVVEMGKFK+LYAN  S L +LLN++ 
Sbjct: 639 RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKK 698

Query: 690 APGPSDQQQQ 699
              P+  Q Q
Sbjct: 699 ---PTQLQSQ 705

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/615 (64%), Positives = 470/615 (76%), Gaps = 16/615 (2%)

Query: 89  KPARPPQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT-- 146
           K    P  + +    D+ RLF LA+ DWK           SC+IGM++PKVIG+VLD   
Sbjct: 99  KKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATK 158

Query: 147 --------------LKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILL 192
                         L+ S      +L   +  + LY+F   F  ALLIG  ANFGR +LL
Sbjct: 159 NALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLL 218

Query: 193 RILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA 252
           +IL ER+VARLR++VIKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDG KA
Sbjct: 219 KILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKA 278

Query: 253 LICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEE 312
           LICG VG+GMM  +S  L+ +L  F PP+L  A+++G +IR  S++LQ+A+G LT+VAEE
Sbjct: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338

Query: 313 QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAY 372
           QLSGIKTVQSFVAEG E+ RYN A+R +F VG              ++LGD SFL VLAY
Sbjct: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAY 398

Query: 373 GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS 432
           GS+LVLQ  L+IGDLTAFMLYTEYTG+AVFGLSTFYSE+M+GAGAA+RLFEL D KP+I 
Sbjct: 399 GSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIK 458

Query: 433 PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
            T G  +KP  G VEF+ VSFSYPTR + QIFK+LNF I PGS+VCIVGPSGRGKSTIA 
Sbjct: 459 STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518

Query: 493 LLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
           LLLRYYNP++G I++D QDITK++ KSLRR +G+VQQEP+LMSGTIR+NITYG++  P+ 
Sbjct: 519 LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578

Query: 553 EEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEA 612
           EEIRSVAK+CFCH FI+KFPN Y+T+IG RG LLSGGQKQRIAIARAL+ KP ILILDEA
Sbjct: 579 EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638

Query: 613 TSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKK 672
           TSALDVESEGAINYT G LMKSK +TIISIAHRLSTIRRSENVIVLG DGSVVEMGKFK 
Sbjct: 639 TSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698

Query: 673 LYANPTSALSQLLNE 687
           LYAN  SAL +LL E
Sbjct: 699 LYANHDSALHKLLTE 713

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/629 (62%), Positives = 482/629 (76%), Gaps = 20/629 (3%)

Query: 89  KPARP--PQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT 146
           +PA P   Q +K   + ++ RL  L K DWK           SCSIGM++PKVIG+VLD 
Sbjct: 88  RPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDA 147

Query: 147 LKTS--------SGSDFFELKIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILS 196
            K +        +G+    L +P  I +  L + L+ F  ALL+G AANFGR  LL++L 
Sbjct: 148 TKDAVAQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLG 207

Query: 197 ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
           ER+VARLRA VIKKTLH DAEFFD +KVGDLISRLGSDAY+VSRSMT  +SDGVKA +CG
Sbjct: 208 ERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCG 267

Query: 257 VVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316
            VGVGMM  +S  L+  ++ F PP+L +A+++GK+IR  S++LQ++TG LTRV+EEQ +G
Sbjct: 268 GVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNG 327

Query: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL 376
           IKT++SFVAEG E+ RYN A+R +F V               ++LGD+SFL VLAYGS+L
Sbjct: 328 IKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHL 387

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAG 436
           VLQ +LS+G LTAFMLYTEYTG++VFGLS FYSE+M+GAGAASRLFELTD K S+  T G
Sbjct: 388 VLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVG 447

Query: 437 HKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
             + P  G +EFKDVSFSYPTRP+ QIFK L   I PGS+VCIVGPSGRGKSTIA LLLR
Sbjct: 448 QTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507

Query: 497 YYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
           +Y+ ++GTI+ID QDI+K++ KSLR+H+G+VQQEPVLMSGTIRDNITYGL+YTP+ +EIR
Sbjct: 508 FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR 567

Query: 557 SVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
           +VAK+CFCHNFITKFP+ YDTVIG RG LLSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 568 AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSAL 627

Query: 617 DVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN++VLG+DGSV+E GKF  LY +
Sbjct: 628 DVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687

Query: 677 PTSALSQLLNE--------RAAPGPSDQQ 697
             S L +LLNE         A+P P+ ++
Sbjct: 688 EDSELFKLLNEHASEPAKPEASPAPAQEE 716

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/619 (61%), Positives = 470/619 (75%), Gaps = 25/619 (4%)

Query: 95  QRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD----TLKTS 150
           Q+  +  +++++RL  LAK DWK           SC+IGM++PKVIG+VLD    TLK+S
Sbjct: 90  QKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSS 149

Query: 151 --SGSDFFE---------LKIPIFSL----------PLYEFLSFFTVALLIGCAANFGRF 189
              GS   E         +  PI SL           + +F+  F  AL++G  ANFGR 
Sbjct: 150 YEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRV 209

Query: 190 ILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDG 249
           +LL+I+ ER+V+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDG
Sbjct: 210 VLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDG 269

Query: 250 VKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRV 309
            KA+ICG VG+GMM  +S  L+ ++L F PP+L  A ++GK+I   S+ LQ+++G LTRV
Sbjct: 270 FKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRV 329

Query: 310 AEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
           AEEQL+GI+T++SFVAE  E+ RYN AIR +F VG              ++LGD+SF+ V
Sbjct: 330 AEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIV 389

Query: 370 LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
           L YG+ LVLQ  LSIGDLTAFMLYTEYTG++VFGLSTFYSE+M+GAGAASRLFEL D K 
Sbjct: 390 LLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKN 449

Query: 430 SISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489
           S+     H   P +G +EF+DVSFSYPTRPS QIFK+++F I PGS+VCIVGPSG+GKST
Sbjct: 450 SVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKST 509

Query: 490 IALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
           I  LLLR+Y+P+ G+I+ID+ DI+K   KSLRRH+G+VQQEP LMSGTIRDNITYGL+YT
Sbjct: 510 ITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYT 569

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILIL 609
           PT +EIR V+KQCFCH FITKFP+ YDTVIG RG  LSGGQ+QRIAIARALIKKP ILIL
Sbjct: 570 PTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILIL 629

Query: 610 DEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
           DEATSALDVESEGAINYT G LM+SK +TIISIAHRLSTIRRSEN+IV+G+DGSVVE+GK
Sbjct: 630 DEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGK 689

Query: 670 FKKLYANPTSALSQLLNER 688
           F KLY N  S L +LLNE+
Sbjct: 690 FDKLYRNEESELFKLLNEK 708

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/701 (57%), Positives = 494/701 (70%), Gaps = 35/701 (4%)

Query: 90  PARPPQRSKTDD---YKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT 146
           P R  + + TD+   ++D+ RL +L K+D K           SCSIGM+IPK+IG +LDT
Sbjct: 68  PHRTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDT 127

Query: 147 LKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206
           L+ +  +     +I I ++PL  FL    + L+ GC ANFGR ++LRI+SER+V+RLR+ 
Sbjct: 128 LRNNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQ 187

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
           V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T KV+DGV++   G+ G+G+M +L
Sbjct: 188 VVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTL 247

Query: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
           S +L+  L    PP+++  SVFGKQIR  SK LQ+ TG LTRV EEQ +GI+TVQ FVAE
Sbjct: 248 SRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAE 307

Query: 327 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
            NE+ R+N  +R+IFQVG              SL+GDL FL VL YGSYLV+   +SIGD
Sbjct: 308 RNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGD 367

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGH-KYKPHRGV 445
           LTAFMLYTEYTGNA+FGLS+FYSE+MQG GAASR+FE+ D++P I  T G  K+KP   V
Sbjct: 368 LTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEV 427

Query: 446 ----VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
               +EFK+VSF YPTRP+ QIFKNLNFK+  GS+VCIVGPSGRGKSTIA LLL +YN  
Sbjct: 428 GGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAV 487

Query: 502 TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
           +G I+ID QDI  +N KSLRR IGIVQQEP+LMSGTIRDNITYGLT  P+KEEIR VAKQ
Sbjct: 488 SGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQ 547

Query: 562 CFCHNFITKFPNTYD--TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           CFCHNFITKFP+TYD     GS GT LSGGQKQRIAIARALIKKP ILILDEATSALDVE
Sbjct: 548 CFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVE 607

Query: 620 SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
           SEGAINYTFG +MKSKSMTI+SIAHRLSTIRR E+VIVLG+DGSVVEMGKFK+LY NPTS
Sbjct: 608 SEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTS 667

Query: 680 ALSQLLNERAAPGPSDQQQQIXXXXXXXXXXXXXAPXXXXXXXXXXXXXXXXXXXXXQSQ 739
            LS+LLNE+++   +  Q                 P                      S+
Sbjct: 668 ELSKLLNEKSSTKEATPQ-----------------PVNPPPFIDLQTNPEEKKEADNASE 710

Query: 740 EVTHKNSDDIEE--------SVEHLLRDAAKEATPIKLTPQ 772
           E   K  D  E+        S +  L++A  E  PIK+TP+
Sbjct: 711 ENGAKLDDSKEDVSVPDNMTSSDDSLKEAVNEGGPIKITPR 751

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  530 bits (1365), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 284/617 (46%), Positives = 394/617 (63%), Gaps = 15/617 (2%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF 156
           SK+  +KDI RLF LA+ + +           S S+ M++P +IG +LD  K     +  
Sbjct: 89  SKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEE 148

Query: 157 ELK------IPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKK 210
           E        I  F L   +F +   V  L+G  AN GR I+L++  ER+VARLR   +K 
Sbjct: 149 EDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKA 208

Query: 211 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQL 270
            L QDA F D ++VGDLISRL SDA +VS+++TQ VSDG +A+I G VG GMM  LS +L
Sbjct: 209 ALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKL 268

Query: 271 SILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNEL 330
           + +++   PP+   A V+G++IRN SK LQE+ G L++VAEEQL+  KT+Q++V E  E+
Sbjct: 269 TGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEI 328

Query: 331 SRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAF 390
            RY   +R++F++G               L+G+++ +++L  G+ ++    L++G+L++F
Sbjct: 329 HRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSF 388

Query: 391 MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRG-VVEFK 449
           M+Y  YTG+++FGLS+FYSE+M+GAGAASR+FEL DRKP I  T G   K   G  ++F+
Sbjct: 389 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFE 448

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDD 509
           +VSF+YP+RP+ +IF NLN +I PG  VCIVG SG GKSTIA LLLRYY+ + G+I I D
Sbjct: 449 NVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGD 508

Query: 510 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG----LTYTPTKEEIRSVAKQCFCH 565
            DI   + +  RR IG VQQEP L +G+I DNI Y     LT     E ++   KQ  C+
Sbjct: 509 NDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCN 568

Query: 566 NFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN 625
            F+ KFP+   T++G RG  LSGGQKQRIA+ARA +  PT+LILDE+TSALD  SE  + 
Sbjct: 569 IFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVA 628

Query: 626 YTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLL 685
            T      ++ +T ISIAHRLSTI+ S  VIV+G  GSVVE G F +L  NP S L+ LL
Sbjct: 629 KTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLL 687

Query: 686 ---NERAAPGPSDQQQQ 699
              NE     PS ++Q+
Sbjct: 688 SQQNEHIDEDPSQEKQE 704

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  524 bits (1350), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 276/652 (42%), Positives = 404/652 (61%), Gaps = 19/652 (2%)

Query: 54  TVGKSLLLQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKTDDYKDIIRLFMLAK 113
           +V KS++LQ +R+NS+               +   K +   + S    +KD+ RLF LAK
Sbjct: 47  SVSKSMILQQTRFNSTNESSKGINTKLTETQQKLEKLS--SEESTNTGFKDVKRLFTLAK 104

Query: 114 RDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKIP------------ 161
            +             S ++ M +P VIG +LD    +S  D  + K              
Sbjct: 105 PETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDNN 164

Query: 162 -IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD 220
            I+     +F +   +  +IG  AN GR ++L++  E++VARLR   +K  L QDA F D
Sbjct: 165 TIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLD 224

Query: 221 NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPP 280
           +++VGDLISRL SDA +V++S+T  VSDG +A++ G VG  MM  +S +L+ +++   PP
Sbjct: 225 SNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPP 284

Query: 281 VLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
           +   A V+GK+IRN S+ LQ A G LT+VAEEQL+  KT+Q++  E  E+ RY   +RD+
Sbjct: 285 LGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDV 344

Query: 341 FQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNA 400
           F VG               L+G+ + L++L  G+ ++    L++GDL++FM+Y  YTG++
Sbjct: 345 FDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSS 404

Query: 401 VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRG-VVEFKDVSFSYPTRP 459
           +FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G      +G  + F+DVSF YPTRP
Sbjct: 405 LFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRP 464

Query: 460 SVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKS 519
           + ++F  ++FKI PG  +C VGPSG GKST++ LLLRYY+ + G I+I + +I  ++ + 
Sbjct: 465 NHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRK 524

Query: 520 LRRHIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
            R+ +G+VQQEP+L +GTI DNI Y +       K ++    K+  C  F+  FP+  +T
Sbjct: 525 YRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNT 584

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSM 637
           ++G RGT LSGGQKQRIAIAR+ +  P+IL+LDEATSALD +SE  I  T     +++ +
Sbjct: 585 IVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGL 643

Query: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERA 689
           T ISIAHRLSTI+ S  V+VL  +GSVVE GKF +L ANPTS L+ LL++  
Sbjct: 644 TTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKEG 695

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  521 bits (1343), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 280/614 (45%), Positives = 385/614 (62%), Gaps = 15/614 (2%)

Query: 85  KDSVKPARP--PQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGI 142
           K S KP        SK+  +KDI RLF+L+K + K           S S+ M++P VIG 
Sbjct: 67  KKSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGK 126

Query: 143 VLDTLKTSSGSDFFELKI-PIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVA 201
           +LD    S G D    K   ++     +F +      +IG  AN  R I+L++  ER+VA
Sbjct: 127 LLDLASESDGEDEEGSKSNKLYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVA 186

Query: 202 RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
           RLR   +K  L QDA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG G
Sbjct: 187 RLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFG 246

Query: 262 MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           MM  LS +L+ +++   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q
Sbjct: 247 MMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQ 306

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ 381
           ++  E NE+ RY   +R++F +G               L+G+ + L++L  G+ ++    
Sbjct: 307 AYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGS 366

Query: 382 LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK--- 438
           +++G+L++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G     
Sbjct: 367 MTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVS 426

Query: 439 --YKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
              KP    + FK+VSF+YPTRP  QIFK+LN  I PG  VC VGPSG GKSTIA LLLR
Sbjct: 427 LAQKP----IVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLR 482

Query: 497 YYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEE 554
           YY+ ++G+I   D+DI   N +  RR IG VQQEP+L +GTI DNI Y +        + 
Sbjct: 483 YYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDR 542

Query: 555 IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
           IR    +  C  F+  FP+   T++G+RG  LSGGQKQRIA+ARA +  P +LILDEATS
Sbjct: 543 IRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATS 602

Query: 615 ALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
           ALD +SE  +       ++ +  T ISIAHRLSTI+ S  VIVLG  GSVVE G F+ L 
Sbjct: 603 ALDSQSEEIVAKNLQRRVE-RGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLI 661

Query: 675 ANPTSALSQLLNER 688
           A P S L+ LL E+
Sbjct: 662 AIPNSELNALLAEQ 675

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  521 bits (1343), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 290/640 (45%), Positives = 398/640 (62%), Gaps = 21/640 (3%)

Query: 57  KSLLLQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARP--PQRSKTDDYKDIIRLFMLAKR 114
           K+LL Q  R  SS  E            K S KP        SK+  +KDI RLF+L++ 
Sbjct: 50  KALLSQSIRLQSSIAE-----------GKASTKPTLKLSDANSKSSGFKDIKRLFVLSRP 98

Query: 115 DWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF--ELKIPIFSLPLYEFLS 172
           + K           S S+ M++P VIG +LD    S   +         ++ L   +F +
Sbjct: 99  ESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDEEDEEKARDSKLYGLTKKQFFT 158

Query: 173 FFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLG 232
              +  +IG  AN  R I+L+I  ER+VARLR   +K  L QDA F D ++VGDLISRL 
Sbjct: 159 ALGLVFVIGAVANASRIIILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLS 218

Query: 233 SDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQI 292
           SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ +++   PP+   A V+GK+I
Sbjct: 219 SDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKI 278

Query: 293 RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXX 352
           RN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY   +R++F +G        
Sbjct: 279 RNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSG 338

Query: 353 XXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                  L+G+ + L++L  G+ ++    ++IG+L++FM+Y  YTG+++FGLS+FYSE+M
Sbjct: 339 LFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELM 398

Query: 413 QGAGAASRLFELTDRKPSISPTAGHK--YKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFK 470
           +GAGAA+R+FEL DRKP I PT G       H+ VV FK+VSF+YPTRP  QIFK+LN  
Sbjct: 399 KGAGAAARVFELNDRKPLIHPTIGKDPISLAHKPVV-FKNVSFTYPTRPKHQIFKDLNIT 457

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQE 530
           I PG  VC VGPSG GKSTIA LLLRYY+ ++G+I  DD+D+   N +  RR IG VQQE
Sbjct: 458 IKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQE 517

Query: 531 PVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTVIGSRGTLLSG 588
           P+L +GTI DNI Y +     + E R     +Q  C  F+  FP+   T++G+RG  LSG
Sbjct: 518 PLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCTKFLANFPDGLQTMVGARGAQLSG 577

Query: 589 GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLST 648
           GQKQRIA+ARA +  P +LILDEATSALD +SE  +       ++ + +T ISIAHRLST
Sbjct: 578 GQKQRIALARAFLLDPALLILDEATSALDSQSEEIVAKNLQKRVE-RGLTTISIAHRLST 636

Query: 649 IRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNER 688
           I+ S  +IVLG  GSVVE G F+ L A P S L+ LL E+
Sbjct: 637 IKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNALLAEQ 676

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  518 bits (1334), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 279/633 (44%), Positives = 390/633 (61%), Gaps = 15/633 (2%)

Query: 65  RYNSSKTEPVXXXXXXXXXXKDSVKPAR-PPQRSKTDDYKDIIRLFMLAKRDWKXXXXXX 123
           R+NS++  PV            +VK A+  P       +KDI RLF LAK +        
Sbjct: 55  RWNSTQRAPVNVNSNASVT---AVKEAKLSPSDLNGSGFKDIKRLFRLAKPETLQIALAL 111

Query: 124 XXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFELKI---PIFSLPLYEFLSFFTVALLI 180
                S ++ M+IP ++G +LD  K    +D          IF +   +F +      L+
Sbjct: 112 VLILISSAVSMTIPTIVGKLLDIAKDRKDADDTTEDDEGPKIFGMTTKQFCTALLAVFLV 171

Query: 181 GCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240
           G AAN GR ++L+I  ER+VARLR   +K  L QDA F D ++VGDLIS L SDA +V++
Sbjct: 172 GAAANAGRIVILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSDASIVAK 231

Query: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
           S+TQ VSDG +A+I G VG GMM  +S QL+ +++   PP+   A V+G++IRN S+ LQ
Sbjct: 232 SVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQ 291

Query: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
            + G LT+V+EEQL  +KT+QS+V E  E+ RY   +R++F +G               L
Sbjct: 292 TSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTGL 351

Query: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420
           +G++S L +L  G+ ++    +++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R
Sbjct: 352 VGNISLLALLMVGTNMIQNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAAR 411

Query: 421 LFELTDRKPSISPTAGHK-YKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
           +FEL DRKP I PT G          + F++VSF+YPTR + +IF  L+  + PG  VCI
Sbjct: 412 VFELKDRKPLIPPTIGQDPVTLANKTIRFENVSFTYPTRLNQKIFDGLDITVEPGEHVCI 471

Query: 480 VGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 539
           VGPSG GKST+A LLLRYY+ + G IMI D +I   N +  RR +GIVQQEP L +GTI 
Sbjct: 472 VGPSGSGKSTVASLLLRYYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGTIL 531

Query: 540 DNITYGLTYTPTKEE----IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIA 595
           DNI Y  T  P + +    I +   Q  C  F+  FP+   T++G RG  LSGGQKQRIA
Sbjct: 532 DNILY--TVPPERADNDDLISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIA 589

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENV 655
           +ARA +  P++LILDEATSALD +SE  +  T   +   + +T ISIAHRLSTI+    V
Sbjct: 590 LARAFLLDPSLLILDEATSALDSQSEEIVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRV 648

Query: 656 IVLGHDGSVVEMGKFKKLYANPTSALSQLLNER 688
           +VLG  G VVE G F++L  NP S LS LL+++
Sbjct: 649 VVLGKCGQVVESGPFEELLRNPLSELSILLSQQ 681

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  518 bits (1334), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 283/658 (43%), Positives = 405/658 (61%), Gaps = 24/658 (3%)

Query: 50  IRSPTVGKSLLLQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQR-----SKTDDYKD 104
           +R P   +   L+  R+NSS  +            + S  P+   Q+     SK++  KD
Sbjct: 44  VRQPLGIRRKTLEIRRWNSSIVD--------VKKKRSSPPPSIEVQKLSNEVSKSNGMKD 95

Query: 105 IIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFEL-----K 159
           I RLF LAK + K           S S+ M+IP +IG +LD  K  +  +  +      K
Sbjct: 96  IKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNAKKEK 155

Query: 160 IPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF 219
           + IF L   +F +      L G  AN  R ++L++  ER+VARLR   +K  L+QDA F 
Sbjct: 156 LMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDASFL 215

Query: 220 DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTP 279
           D ++VGDLISRL SDA +V++++TQ VSDG +A+I G VG GMM  +S +L+ +++   P
Sbjct: 216 DTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMIMVP 275

Query: 280 PVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           P+   A V+G++IR  S+ LQ + G LT+VAEEQL+  +T+Q++  E  E+ RY   +R 
Sbjct: 276 PLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATEVRK 335

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
           +F VG               L+G+++ +++L  G+ ++    L++GDL++FM+Y  YTG+
Sbjct: 336 VFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVYTGS 395

Query: 400 AVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRG-VVEFKDVSFSYPTR 458
           ++FGLS FYSE+M+GAGAA+R+FEL DRKP I PT G+  K   G  +EF++VSF+YPTR
Sbjct: 396 SLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSIEFQNVSFAYPTR 455

Query: 459 PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCK 518
           P+  I  NL+  I PG  VCIVGPSG GKST++ LLLRYY+ STG+I ID Q+I + N +
Sbjct: 456 PTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEFNLR 515

Query: 519 SLRRHIGIVQQEPVLMSGTIRDNITYGL----TYTPTKEEIRSVAKQCFCHNFITKFPNT 574
             RR +G+VQQEP+L +GTI DNI Y +    T T    +++   +Q  C  F+  FP  
Sbjct: 516 KYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNFPEG 575

Query: 575 YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS 634
            +T++G RGT LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +       ++ 
Sbjct: 576 VNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVE- 634

Query: 635 KSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPG 692
             +T ISIAHRLSTI+ S  VIVL   GSVVE G F++L     S L+ LL+++   G
Sbjct: 635 LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQQHKKG 692

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  516 bits (1330), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 269/597 (45%), Positives = 377/597 (63%), Gaps = 4/597 (0%)

Query: 94  PQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS 153
           P  SK   ++DI RLF+LAK + +           S ++ M++P VIG +LD  +     
Sbjct: 75  PHDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQ 134

Query: 154 DFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
              E +  IF L   +F +      ++G  AN GR ++L++  ER+VARLR   +K  L 
Sbjct: 135 PETEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALE 194

Query: 214 QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
           QDA F D+++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GMM  +S +L+ +
Sbjct: 195 QDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCV 254

Query: 274 LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRY 333
           ++   PP+   A V+GK+IRN S+ LQ + G+LT+V+EEQLS  KT+Q++  E  E+ RY
Sbjct: 255 MMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRY 314

Query: 334 NVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              +R +F VG                +G+++ L +L  G+ ++    +++GDL++FM+Y
Sbjct: 315 ADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMY 374

Query: 394 TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK-YKPHRGVVEFKDVS 452
             YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G          + F  V 
Sbjct: 375 AVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVK 434

Query: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDI 512
           FSYPTRP   IF++LNF + PG  VCIVGPSG GKST+A LLLRYY+  +G I + + +I
Sbjct: 435 FSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNI 494

Query: 513 TKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITK 570
              N +  RR +G+VQQEP+L SGTI DNITY +      +E R      Q  C  F+  
Sbjct: 495 RDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLAN 554

Query: 571 FPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGH 630
           FP+   T +G RGT LSGGQKQRIA+ARA +  P+ILILDEATSALD +SE  +  +   
Sbjct: 555 FPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ 614

Query: 631 LMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
              ++  T ISIAHR+STI+ S  VIVL   G+V E G F KL A P S+L++LL++
Sbjct: 615 -RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLSK 670

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  516 bits (1328), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 275/612 (44%), Positives = 387/612 (63%), Gaps = 19/612 (3%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD--TLKTSSGSD 154
           SK+  +KDI RLF+L+K + K           S S+ M++P VIG +LD  +       +
Sbjct: 81  SKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEEKE 140

Query: 155 FFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214
                  ++ L   +F +   +  +IG  AN  R I+L++  ER+VARLR   +K  L Q
Sbjct: 141 EKAKSNKLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQ 200

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ ++
Sbjct: 201 DATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVM 260

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           +   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY 
Sbjct: 261 MVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYA 320

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R++F +G               L+G+ + L++L  G+ ++    +++G+L++FM+Y 
Sbjct: 321 KEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYA 380

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK-----YKPHRGVVEFK 449
            YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G        KP    + FK
Sbjct: 381 VYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKP----IVFK 436

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDD 509
           +VSF+YPTRP  QIFK+LN  I PG  VC VGPSG GKSTIA LLLRYY+ ++G+I   D
Sbjct: 437 NVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGD 496

Query: 510 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNF 567
           +DI   N +  RR IG VQQEP+L +GTI DNI Y +     ++E R      Q  C  F
Sbjct: 497 EDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKF 556

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           +  FP+   T +G+RG  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +   
Sbjct: 557 LANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKN 616

Query: 628 FGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
               ++ + +T ISIAHRLSTI+ S  V+VLG  GSVVE G F+ L A P S L+ LL E
Sbjct: 617 LQRRVE-RGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLAE 675

Query: 688 RAAPGPSDQQQQ 699
           +      D++Q+
Sbjct: 676 Q-----QDEEQK 682

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  515 bits (1326), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 267/610 (43%), Positives = 381/610 (62%), Gaps = 16/610 (2%)

Query: 94  PQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGS 153
           P  S    +KD+ RLF LA+ +             S ++ M +P VIG +LD  K  S  
Sbjct: 89  PDESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSAD 148

Query: 154 DFFELKIP------------IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVA 201
           +     +             I+ L   +F +   V   +G  AN GR I+L++  ER+VA
Sbjct: 149 EENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVA 208

Query: 202 RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
           RLR   +K  L Q+A F D++KVGDLISRL +DA +V++S+TQ VSDG +A++ G VG G
Sbjct: 209 RLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFG 268

Query: 262 MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           MM  +S QL+ ++L   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q
Sbjct: 269 MMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQ 328

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ 381
           ++  E  E+ RY   +R++F +G               L+G+ + L++L  G+ ++    
Sbjct: 329 AYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGA 388

Query: 382 LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKP 441
           L++G+L++FM+Y  YTG+++FGLSTFYSE+M+GAGAA+R+FEL+DRKP+I PT G     
Sbjct: 389 LTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPIT 448

Query: 442 HRG-VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
             G  VEFK+VSF YPTRP  QIF++ + KI PG  VC VGPSG GKST++ LLLRYY+ 
Sbjct: 449 LFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDV 508

Query: 501 STGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE--EIRSV 558
           + G+I++  +DI   + +  RR +G+VQQEP+L +GTI +NI Y +      E   I   
Sbjct: 509 AKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERA 568

Query: 559 AKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +   C  F+  FP+  +T++G RGT LSGGQKQRIA+AR  +  P+ILILDEATSALD 
Sbjct: 569 IESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDS 628

Query: 619 ESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT 678
           +SE  I          K  T ISIAHRLSTI+ S  V+VLG +G VVE G F++L +NP+
Sbjct: 629 QSEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPS 687

Query: 679 SALSQLLNER 688
           S L+ LL + 
Sbjct: 688 SGLNILLTQE 697

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  513 bits (1320), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 278/599 (46%), Positives = 384/599 (64%), Gaps = 10/599 (1%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF 156
           SK+  +KDI RLF+L++ +             S S+ M++P VIG +LD        +  
Sbjct: 80  SKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDA 139

Query: 157 EL--KIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214
           +      ++ L   +F +      LIG  AN  R I+L++  ER+VARLR   +K  L Q
Sbjct: 140 KETKDNKLYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKAALDQ 199

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  LS +L+ ++
Sbjct: 200 DATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVM 259

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           +   PP+   A ++G++IRN S+ LQ + G LT+VAEEQL+  +T+Q++  E NE+ RY 
Sbjct: 260 MVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYA 319

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R++F VG               L+G+ + L++L  G+ ++    +++G+LT+FM+Y 
Sbjct: 320 KEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSFMMYA 379

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK--YKPHRGVVEFKDVS 452
            YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G       H+ +V FKDVS
Sbjct: 380 VYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKPIV-FKDVS 438

Query: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDI 512
           F+YPTRP  QIFK+LN  I PG  VC VGPSG GKSTIA LLLRYY+ S G+I   D+DI
Sbjct: 439 FTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDFGDEDI 498

Query: 513 TKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK---QCFCHNFIT 569
              N +  RR +G VQQEP+L +GTI DNI Y +     ++E R VA+   Q  C  F+ 
Sbjct: 499 KNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQANCTKFLA 557

Query: 570 KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629
            FP+   T++G+RG  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     
Sbjct: 558 NFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAKNLQ 617

Query: 630 HLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNER 688
             +K + +T ISIAHRLSTI+ S  VIVLG  GSVVE G F+ L + P S L+ LL E+
Sbjct: 618 RRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNALLAEQ 675

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  512 bits (1318), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 290/669 (43%), Positives = 402/669 (60%), Gaps = 35/669 (5%)

Query: 40  SHLIPINRLCIRSPTVGKSLLLQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKT 99
           S+  PI R+  R P +   LL Q  R N+S TE            K S      P  SK 
Sbjct: 48  SYRPPIPRIQTRPPALSHQLL-QARRLNTS-TEQDQKTLQTLKTLKLS------PHDSKA 99

Query: 100 DDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLK----------- 148
             +KDI RLF+LAK +             S ++ M+IP VIG +LD  K           
Sbjct: 100 SGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASG 159

Query: 149 ----TSSGSDFFELKIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVAR 202
               +S  SD  E      I+ L   +F +      ++G  AN GR +LL++  E++VAR
Sbjct: 160 EGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKLVAR 219

Query: 203 LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGM 262
           LR   +K  L QDA F DN++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GM
Sbjct: 220 LRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVGFGM 279

Query: 263 MCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           M  +S +L+ ++    PP+   A V+GK+IRN S+ LQ + G LT+VAEEQLS  +TVQ+
Sbjct: 280 MSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAARTVQA 339

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           +  E  E+ RY   +R++F +G                +G+++ L +L  G+ ++    +
Sbjct: 340 YGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRSGAI 399

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPH 442
           ++GDL++FM+Y  YTG+++FGLS+FYSE+M+GAGAA+R+FEL DRKP I PT G      
Sbjct: 400 TVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDPVTL 459

Query: 443 RG-VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
           +G  +EF++V+F+YPTR   +IF  L+  I PG  VCIVGPSG GKSTIA LLLRYY+  
Sbjct: 460 QGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYYDVD 519

Query: 502 TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVA 559
            G I I  QDI + N +  RR +G+VQQEP+L +GTI DNITY +      ++ R     
Sbjct: 520 AGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRVSRAI 579

Query: 560 KQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
            Q  C  F+  FP+  +T++G RG  +SGGQKQRIA+ARA +  P +LILDEATSALD +
Sbjct: 580 GQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSALDSQ 639

Query: 620 SEGAINYTFGHLMKSKS---MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676
           SE  +  +    ++S+S    T +SIAHRLSTI+ S  VIVL   G V E G F++L ++
Sbjct: 640 SEEVVAQS----LRSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELISD 695

Query: 677 PTSALSQLL 685
           P S L+QLL
Sbjct: 696 PDSHLTQLL 704

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  506 bits (1304), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 270/596 (45%), Positives = 376/596 (63%), Gaps = 6/596 (1%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLD--TLKTSSGSD 154
           SK   +K++ RLF LA+ + K           S ++ M+IP VIG +LD    K + G  
Sbjct: 75  SKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDG 134

Query: 155 FFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQ 214
             E +  I+ L   +F +      +IG  AN GR ++L++  E++VARLR   +K  L Q
Sbjct: 135 DEEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAALQQ 194

Query: 215 DAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILL 274
           DA F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I G+VG GMM  +S QL+ ++
Sbjct: 195 DAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTGVM 254

Query: 275 LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           L   PP++  A V+G++IRN +++LQ   G LT+VAEEQL+  +T+QS+  E  E+ RY 
Sbjct: 255 LLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRRYA 314

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
             +R +F+VG               L+G+++ L +L  G+ ++    +++G+L++FM+Y 
Sbjct: 315 EEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMMYA 374

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK-YKPHRGVVEFKDVSF 453
            YTG+++FGLS+FYSE+M+GAGAASR+FEL DR P I PT G          +EFK+V F
Sbjct: 375 VYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNVKF 434

Query: 454 SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDIT 513
           SYP+R +  +F  LN KI PG  VC+VGPSG GKSTI+ LLLR+Y+  +G I I  Q+I 
Sbjct: 435 SYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQNIK 494

Query: 514 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--TYTPTKEEIRSVAKQCFCHNFITKF 571
             N +  RR +GIVQQEP+L +G+I+DNI Y L       K  +    +   C  FI+ F
Sbjct: 495 DFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFISNF 554

Query: 572 PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHL 631
           P+  DT++G RGT LSGGQKQRIAIARA I  P+ILILDEATSALD +SE  I       
Sbjct: 555 PDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALRAR 614

Query: 632 MKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
            +S  +T ISIAHR+STI  S  VIVL  +G V E G F  L   P S L++LL++
Sbjct: 615 SESGKIT-ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSK 669

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  501 bits (1291), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 277/660 (41%), Positives = 394/660 (59%), Gaps = 24/660 (3%)

Query: 45  INRLCIRSPTVGKSL--LLQFSRYNSSKTEPVXXXXXXXXXXKDSVKPARPPQRSKTDDY 102
           + +L IR+P   K L  L+Q +R+NSS  +            K             +  +
Sbjct: 36  LRKLAIRTPMPSKPLGSLMQ-ARWNSSNAK----QPNTTNTDKTGQIAELSSNEKNSSGF 90

Query: 103 KDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSD-------- 154
           +DI RL  LA+ +             S ++ M +P VIG +LD  K+SS S+        
Sbjct: 91  RDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQESGD 150

Query: 155 -----FFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209
                  + +  I+     +F        + G  AN GR I+L++  ER+VARLR   +K
Sbjct: 151 GDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLRTRTMK 210

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
             L QD+ F D ++VGDLISRL SD+ +V++S+TQ VSDG +A+I G VG GMM  +S Q
Sbjct: 211 AALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQ 270

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
           L+ ++    PP+   A ++GK+IRN SK LQ + G LT+VAEEQL   KT+QS+V E  E
Sbjct: 271 LTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKE 330

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
           + RY   +R +F +G                +G++S L +L  G+ ++    +++GDL++
Sbjct: 331 IRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITVGDLSS 390

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGV-VEF 448
           FM+Y  YTG ++FGLS FYSE+M+GAGAA+R+FEL DRKP+I+PT G      R + + F
Sbjct: 391 FMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRNLPISF 450

Query: 449 KDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           KDVSF+YPTR + +IF +LN  I PG  +CI GPSG GKSTIA LL+RYY+   G I I 
Sbjct: 451 KDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIG 510

Query: 509 DQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK--QCFCHN 566
           D D+   N +  RR IG+V QEPVL +GTI +NI Y +  +  ++E R  A   +  C  
Sbjct: 511 DTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVSAAIGKANCSK 570

Query: 567 FITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           F++ FP+  +T++G RG  LSGGQKQR+A+ARA +  P +L+LDEATSALD +SE  +  
Sbjct: 571 FLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALDSQSEEIVAR 630

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
           T    ++ + +T ISIAHR+STI  S  V+VLG DG VVE G F++L   P S L+ LL+
Sbjct: 631 TLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRPNSELNYLLS 689

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  496 bits (1277), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 289/690 (41%), Positives = 405/690 (58%), Gaps = 40/690 (5%)

Query: 40  SHLIPINRLCIRSPTVGK-SLLLQFSRYNSSKT----------EPVXXXXXXXXXXKDSV 88
           S LI   RL I    +G+ SLLLQ    ++ KT          +             ++ 
Sbjct: 9   SGLIGNARLPILRAGIGRPSLLLQVRSLHNGKTSFERQLAAMLQNRTIMRQVRWQHSNAS 68

Query: 89  KPARP--PQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT 146
           KP+     +   +  +KDI RLF LA+ + K           S S+ M +P VIG ++D 
Sbjct: 69  KPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDV 128

Query: 147 LKT---------------------SSGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAAN 185
            K                      S+ +D    K+ I  L L +F        ++G AAN
Sbjct: 129 AKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKL-ILGLTLPQFYGGLFSLFVVGAAAN 187

Query: 186 FGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQK 245
            GR ++L++  E++VARLR   +K  L QDA F DN+KVGDLISRL SDA +VS+S+TQ 
Sbjct: 188 MGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQN 247

Query: 246 VSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQ 305
           +SDG ++LI G VG GMM  +S +L+ +++   PP+   A V+G++IRN S+ LQ + G 
Sbjct: 248 MSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGG 307

Query: 306 LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS 365
           LT+ AEEQLS  +T+Q++  E   +  Y   +R ++QVG               L+G+ +
Sbjct: 308 LTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSA 367

Query: 366 FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
            L +L  G+ ++    +++GDL++FM+Y  YTG+++FG+S+FYSE+M+GAGAA+R+FEL 
Sbjct: 368 VLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELN 427

Query: 426 DRKPSISPTAGHK-YKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSG 484
           DRKP+I PT G       R  VEFK V F+YPTR    IF++L+ +I PG  VCIVGPSG
Sbjct: 428 DRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSG 487

Query: 485 RGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
            GKST+A LLLR+Y+   G I+I  Q+I   N +  RR +GIVQQEP+L +GTI +NI Y
Sbjct: 488 GGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILY 547

Query: 545 GLTYTPTKEEIRSVAK---QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALI 601
            +      EE   VA+   Q  C  F++ FP+   T++G RGT LSGGQKQRIA+ARA +
Sbjct: 548 TVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFL 607

Query: 602 KKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHD 661
             P +LILDEATSALD  SE  I  T  H   ++  T ISIAHR+STI+ S  VIVLG +
Sbjct: 608 LDPDLLILDEATSALDSRSEEVIARTL-HSRTTRGKTTISIAHRVSTIQHSTRVIVLGRN 666

Query: 662 GSVVEMGKFKKLYANPTSALSQLLNERAAP 691
           G VVE G F +L +N  S L++LL +   P
Sbjct: 667 GGVVETGTFDELASNTDSQLNKLLRKEEEP 696

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  494 bits (1273), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 268/609 (44%), Positives = 381/609 (62%), Gaps = 17/609 (2%)

Query: 94  PQRSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSS-G 152
           P+   +  +KDI RLF LA+ + +           S S+ M +P VIG ++D  K     
Sbjct: 76  PEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQA 135

Query: 153 SDFFELKI----------PIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVAR 202
           S   E              IF L + +F        ++G AAN GR ++L++  E++VAR
Sbjct: 136 SKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVAR 195

Query: 203 LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGM 262
           LR   +K +L QDA F DN+KVGDLISRL SDA +VS+S+TQ +SDG ++LI G VG GM
Sbjct: 196 LRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGM 255

Query: 263 MCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           M  +S +L+ +++   PP+   A ++GK+IRN S+ LQ + G LT+ AEEQLS  +T+Q+
Sbjct: 256 MSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQA 315

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           +  E + + +Y   +R ++QVG               L+G+++ L +L  G+ ++    +
Sbjct: 316 YGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAM 375

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPH 442
           ++GDL++FM+Y  YTG+++FG+S+FYSE+M+GAGAA+R+FEL DR+P+I PT G      
Sbjct: 376 TLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSL 435

Query: 443 RGV-VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
            G  VEF++V F+YPTR    IF+NL F+I  G  VCIVGPSG GKST+A LLLR+Y+  
Sbjct: 436 AGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVD 495

Query: 502 TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK- 560
           TG I I  Q I   N +  RR +G+VQQEP+L +GTI DNI Y +  +   +E R VA+ 
Sbjct: 496 TGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENR-VARA 554

Query: 561 --QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
             Q  C  F++ FP+   T++G RGT LSGGQKQRIA+ARA +  P +LILDEATSALD 
Sbjct: 555 IGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDS 614

Query: 619 ESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT 678
            SE  +     +   ++  T ISIAHR+STI+ S  VIVLG  G VVE G F +L ++P 
Sbjct: 615 RSEEVVARAL-YSRSTRGKTTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDPD 673

Query: 679 SALSQLLNE 687
           S L+ LL +
Sbjct: 674 SQLNLLLRK 682

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  487 bits (1254), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 260/592 (43%), Positives = 368/592 (62%), Gaps = 11/592 (1%)

Query: 103 KDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDT----LKTSSGSDFFEL 158
           KD+ RLF LA+ + K           S ++ M+IP VIG +LD     ++  SG    E 
Sbjct: 83  KDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQESGD---EE 139

Query: 159 KIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 218
           +  ++ LP  +F    +    +G  AN GR ++L+   ER+VARLR   +K  L Q+  F
Sbjct: 140 EAVLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAF 199

Query: 219 FDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFT 278
            D+++VGDLISRL SDA +VS+S+TQ  SDG +A+I G VG GMM  +S QL+ ++    
Sbjct: 200 LDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLA 259

Query: 279 PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
           PP++  A+ +G+++RN S++LQ   G LT+VAEEQL+  +TVQ++  E  E+ RY   +R
Sbjct: 260 PPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVR 319

Query: 339 DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
           ++F VG                +G+ + L +L  G+ ++    +S+G+L++FM+Y  YTG
Sbjct: 320 NVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTG 379

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRG-VVEFKDVSFSYPT 457
           +++F LS+FYSE+M+GAGAA R+FEL DRKP I PT G       G  + F  V+F+YPT
Sbjct: 380 SSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPT 439

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           RP  Q+F  ++  I PG  VCIVGPSG GKST+A LLLR+Y+P +G+I I  +DI   N 
Sbjct: 440 RPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNL 499

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTY 575
              RR +GIVQQEPVL + +I +NITY L    TK+  R     +   C  F+  FP   
Sbjct: 500 SKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGL 559

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
            T +G RGT LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  +  T     +  
Sbjct: 560 QTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEA 619

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
            +T ISIAHR STI+ S  VIVL   G V+E G +++L  +P S+LS LL++
Sbjct: 620 KIT-ISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGLLSK 670

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  471 bits (1213), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/618 (42%), Positives = 374/618 (60%), Gaps = 37/618 (5%)

Query: 97  SKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFF 156
           +K    +DI  LF LAK +             + ++ M +P VIG +LD    S+G +F 
Sbjct: 91  TKGKTREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDI---STGIEFA 147

Query: 157 ELK----------------------IPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRI 194
             K                        I+      F S   V  ++G  AN GR I+L++
Sbjct: 148 SNKDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKL 207

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI 254
             ER+VARLR   +K  L QD +F D++KVGDLISRL SD+ +VS ++T+ VSDG +A+I
Sbjct: 208 TGERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVI 267

Query: 255 CGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
            G VGVGMM  +S +LS ++LF  PP+   A ++G++IRN SK LQE+ G LT+++EEQL
Sbjct: 268 QGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQL 327

Query: 315 SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
           +G +T+QS+V E  E+ +Y   +R ++ VG               L+G+ + L++L  G 
Sbjct: 328 NGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGC 387

Query: 375 YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT 434
            ++    LSIG L++FM+Y  YTG+++FGLS+FYSEIM+G+GAASR+FE+    P I+ T
Sbjct: 388 NMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINAT 447

Query: 435 AG-----HKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489
            G      + KP    +EF+ + F+YPTR    IF++LN KI PG  VCI+GPSG GKST
Sbjct: 448 KGIDPISFQDKP----IEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKST 503

Query: 490 IALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL--T 547
           I+ LLLRYY+P  GTI I  +DI + + +  R+ +G+V QEPVL +GTI +NI Y +   
Sbjct: 504 ISSLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEE 563

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTIL 607
               KE + +  +   C+ F+   P   +T +G RGT LSGGQKQR+A+ARA + +PT+L
Sbjct: 564 IANDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLL 623

Query: 608 ILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
           +LDEATSALD  SE  +  T      +K  T ISIAHR+STI+ S  V+VL   G VVE 
Sbjct: 624 VLDEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVET 682

Query: 668 GKFKKLYANPTSALSQLL 685
           G +++L     SAL++LL
Sbjct: 683 GPYEELLGIKDSALNKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  465 bits (1197), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 256/592 (43%), Positives = 360/592 (60%), Gaps = 18/592 (3%)

Query: 98  KTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDFFE 157
           KT  +  + +L  LAK + K           S ++ MS+P VIG ++D   T        
Sbjct: 27  KTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHASTPDA----- 81

Query: 158 LKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAE 217
              PI+ L   +FL       ++G  AN GR I+L+I  E++VARLR   +K  L QDA 
Sbjct: 82  ---PIYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLSQDAT 138

Query: 218 FFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFF 277
           F D H+VGDLISRL SDA +VS+S+T  +SDG +A + GVVG+GMM  +S +L+ ++   
Sbjct: 139 FLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTVMTMM 198

Query: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337
            PP+   A ++G +I+  S+ LQ+  GQL++ +EEQL+ +KTVQ++  E  EL RY+  +
Sbjct: 199 VPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEV 258

Query: 338 RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT 397
           R +F +G               L+G+++ + +L  G+     S +++G+L++FM+Y  YT
Sbjct: 259 RSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMYGVYT 315

Query: 398 GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAG-HKYKPHRGV-VEFKDVSFSY 455
           G++VFGL+ FYSE+M+G GAA R+ EL + K  ISPT G    K  +G+ + F +VSF+Y
Sbjct: 316 GSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNVSFAY 375

Query: 456 PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKM 515
               SV     +NF+I PG  VC VG SG GKSTI+ LLLRYY   +G I I + DI+  
Sbjct: 376 SNGKSV--LSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAF 433

Query: 516 NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 575
           N +  RR +G+VQQEP+L +GTI DNITYGL +  +  ++    K   C  FI +     
Sbjct: 434 NLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKAANCDQFIKESHMGL 492

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
           DT++G RG  LSGGQ+QRIA+AR  ++ P ILILDEATSALD +SE  IN       +  
Sbjct: 493 DTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKEL-QRRQEA 551

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
            MT ISIAHRLSTIR S  VIV+  DG VVE G F +L +   S L++LL E
Sbjct: 552 GMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLKE 602

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  218 bits (556), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 159/525 (30%), Positives = 271/525 (51%), Gaps = 38/525 (7%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR 230
            L++G AA     NF +  LL   SE  V  LR  V++K   ++ ++F  +N+K  ++ + 
Sbjct: 765  LVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISAL 824

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     V  +G++ +L    +LS++ +   P ++  ++
Sbjct: 825  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSA 880

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN-ELSRYNVAIRDIFQVGX 345
            ++G  ++    D + +  QL     + ++ IKT++   AE + +L+ +++ I+ + Q+  
Sbjct: 881  IYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIK-MQQIAS 939

Query: 346  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
                         +++       +  YG  LV+  + +  ++        +T  +   L 
Sbjct: 940  KRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLV 999

Query: 406  TFYSEIMQGAGAASRLFELTDRKPSISPT----------AGHKY--KPHRGVVEFKDVSF 453
            +   +I +G  AAS ++ + D K +              AGH Y  K  + +V  ++++F
Sbjct: 1000 SQIPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTF 1059

Query: 454  SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDIT 513
            +YP+ P+  ++KN+NF +  G ++ I+G SG GKST+ LLL + YN   G I ID  D+ 
Sbjct: 1060 AYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVN 1119

Query: 514  KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
              N  SLR+ I +V+Q+P+L +GTIRDN+TYGL     + E+    K    H+F+   P 
Sbjct: 1120 DWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQ 1179

Query: 574  TYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMK 633
              DT I +  TLLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN     ++K
Sbjct: 1180 GLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIVK 1233

Query: 634  SK--SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676
                ++  + I H    +R   ++ VL  DG VVE G F  LY N
Sbjct: 1234 KGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  179 bits (455), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 141/513 (27%), Positives = 240/513 (46%), Gaps = 37/513 (7%)

Query: 195 LSERVVARLRAHVIKKTLHQD-AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA- 252
           + ER   R+R+ +++  L +   E++DN++      +L  D   ++R + +  S   +A 
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNE------KLLGDFTQINRCVEELRSSSAEAS 152

Query: 253 --------LICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG 304
                    IC ++G     S S  L++++L  +P + F A VF + I   S+     T 
Sbjct: 153 AITFQNLVAICALLGTSFYYSWS--LTLIILCSSPIITFFAVVFSRMIHVYSEKENSETS 210

Query: 305 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 364
           +  ++    ++  + V+ +  +  E  ++   I +                     L   
Sbjct: 211 KAAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLT 270

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +GS ++ + +L+I D+          G+ +         + +G  A  ++  L
Sbjct: 271 MFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTL 330

Query: 425 ----TDRKPSISPTAGHKYKPHRGV--VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
               + R P ++ T  H++        + F +VSFSYP+RPS  + KN++   + G    
Sbjct: 331 LKDGSKRNP-LNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTF 389

Query: 479 IVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTI 538
           IVG SG GKST++ LLLR+Y+   G+I I+  +I  ++ K L  +I +V+Q   L + T+
Sbjct: 390 IVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTL 449

Query: 539 RDNITYGLT---------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGG 589
           R NI  G T             +  I+   +      FI   P+  +T+IG+ G  LSGG
Sbjct: 450 RKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGG 509

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI 649
           Q+QR+AIARA I+   IL LDEA SALD+     +     H  K K  T I + H LS I
Sbjct: 510 QQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQI 567

Query: 650 RRSENVIVLGHDGSVVEMGKFKKLYANPTSALS 682
             S++ + L  +G VVE G   +L A+PT+  S
Sbjct: 568 -ESDDYLYLMKEGEVVESGTQSELLADPTTTFS 599

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  203 bits (517), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 141/442 (31%), Positives = 221/442 (50%), Gaps = 20/442 (4%)

Query: 252 ALICGVVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CG++      S +    + +LL+  FT    F  + +  + R ++     A  +   
Sbjct: 251 SVVCGILTYQFGTSFAAVTFATMLLYSIFT----FKTTAWRTEFRRSA---NRADNKAAS 303

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E     +Y+ ++ +                   +L+   +   
Sbjct: 304 VALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNSGQNLIFTSALTA 363

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G   V+   LS+GDL             +  L + Y E+ Q       LF+L   K
Sbjct: 364 MMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNK 423

Query: 429 PSI----SPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSG 484
            +I    +P    K KP    ++F++V+F Y   P  +I +N NF +  G    IVGPSG
Sbjct: 424 VNIQNSKTPLMLPKDKPCE--IKFENVTFGY--HPDRKILENANFTLPAGWKTAIVGPSG 479

Query: 485 RGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
            GKSTI  L+ R+Y+P  G I+ID +DI +++ KSLRR IG+V Q+  L + TI +N+ +
Sbjct: 480 SGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFNDTIWENVKF 539

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKP 604
           G   T T ++IR    +      I   P   +T++G RG ++SGG+KQR+AIAR L+K  
Sbjct: 540 G-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQRLAIARVLLKDT 598

Query: 605 TILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSV 664
            I+  DEATSALD  +E A+  T        S T I IAHRL TI  ++ ++VL  +G V
Sbjct: 599 PIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKIVVL-ENGRV 657

Query: 665 VEMGKFKKLYANPTSALSQLLN 686
            E GK  +L + PTS  S+L N
Sbjct: 658 KEEGKHAELLSKPTSLYSELWN 679

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  201 bits (510), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 143/436 (32%), Positives = 214/436 (49%), Gaps = 11/436 (2%)

Query: 258 VGVGMMCS-LSPQL--SILLLFFTPPVLFSASVFGKQIRNTS--KDLQEATGQLTRVAEE 312
           V +G +C  L+ Q   S   + F+  +L+S   F      T   K   +A  +   VA +
Sbjct: 268 VEIGAVCGILTYQFGGSFAAMTFSTMLLYSIFTFKTTAWRTEFRKSANKADNKAASVAVD 327

Query: 313 QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAY 372
            L   + V+ F  E    ++Y+ ++                     +L+   +   ++  
Sbjct: 328 SLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTAMMYM 387

Query: 373 GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS 432
           G   V+  +LS+GDL             +  L + Y E+ Q       LF+L   K SI 
Sbjct: 388 GCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVSIQ 447

Query: 433 PTAGHKYKPHR--GVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI 490
            +      P      + FK+VSF Y   P   I KN +F I  GS   IVGPSG GKSTI
Sbjct: 448 NSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPSGSGKSTI 505

Query: 491 ALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
             L+ R+Y+P  G I++D +D+ +++ +SLRR IG+V Q+  L + +I DN+ +G     
Sbjct: 506 LKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKFG-RIDA 564

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
           T +EI     +      I + P   DT++G RG ++SGG+KQR+AIAR L+K   I+  D
Sbjct: 565 TDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFD 624

Query: 611 EATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
           EATSALD  +E A+  T      + S T + IAHRL TI  ++ +IVL H G V E GK 
Sbjct: 625 EATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLEH-GRVKEEGKH 683

Query: 671 KKLYANPTSALSQLLN 686
            +L A P S  ++L N
Sbjct: 684 AELLATPKSLYAELWN 699

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  201 bits (511), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 151/527 (28%), Positives = 251/527 (47%), Gaps = 72/527 (13%)

Query: 185  NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR----------LG 232
            NF ++ L    SE  + +LR  V+++   ++ ++F  + HK  ++ +           L 
Sbjct: 750  NFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALA 809

Query: 233  SDAYVVSRSMTQKVSDGV-KALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQ 291
            SD  +   S     S G+  ALI G            +LS++ +   P ++  ++V+G  
Sbjct: 810  SDFLIAVSSFAVVSSVGIIWALIIGW-----------KLSLVCISMFPLIVIFSAVYGMA 858

Query: 292  IRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN--------VAIRDIFQV 343
            ++      + A   L  +  E  +GIKT++    E N L +Y         +A R     
Sbjct: 859  LQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAITT 918

Query: 344  GXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLYTEYTGNA 400
            G              ++L          Y   LV+  Q +   +      +L+T  T N 
Sbjct: 919  GLGVAVIEALAMSIQAIL--------FYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNI 970

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHR--------------GVV 446
               L +   +I +G  AA+R+ ++ D K         + KPH+               V+
Sbjct: 971  ---LISQVPDISRGQRAANRILQMLDEKL-------EREKPHQEKKQTTSGSVSESSAVI 1020

Query: 447  EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIM 506
              ++V+F+YP+ PS+ IF +L  ++  G +  +VG SG GKST+  LL + Y P++GT++
Sbjct: 1021 SLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVL 1080

Query: 507  IDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            ++++D+ + N + LRR + +V+Q P + SGT+R+N+ YGL + P + E+  V +    H+
Sbjct: 1081 VENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHD 1140

Query: 567  FITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
            FI+K P   DT I     LLSGGQ QR+ IARA++K+P ILILDE TSALD  S   IN 
Sbjct: 1141 FISKLPLGLDTTIDI--DLLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINN 1198

Query: 627  TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
                     +   ISI H +  ++  + +I L  +G V   G F  L
Sbjct: 1199 IVRR--GCPAPLTISITHNVDMMKACDEIIFL-KNGRVAGTGSFDAL 1242

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 125/496 (25%), Positives = 239/496 (48%), Gaps = 15/496 (3%)

Query: 194 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVV--SRSMTQKVSDGV- 250
           +L ER    +R  ++ K L    E++D  K  D+          V  +R+   + S  + 
Sbjct: 84  LLGERCGFGIRRRLLYKYLENPFEWYD--KTEDICGNFTQQNRCVEEARASCAEASAVIT 141

Query: 251 KALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA 310
           ++L+  +  +G     S  L+++ L   P ++     F ++++  +    E T + +++ 
Sbjct: 142 RSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLL 201

Query: 311 EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
           +  ++  + ++    E  E+  +   +++                     L    F+   
Sbjct: 202 DWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAMFVQAF 261

Query: 371 AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE-LTDRKP 429
            +GS ++ + +++IGD+          G+ + G       I +G+ A + + + L D K 
Sbjct: 262 WFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKT 321

Query: 430 SISPTAGHKYKPH---RGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRG 486
           + +     +  P    +G + F++V FSYP+RP   + ++++     G +  ++G SG G
Sbjct: 322 ATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSG 381

Query: 487 KSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL 546
           KS+++ LLL++Y   TG I +D ++I  ++   L ++I +V+Q   + +GT+++NI  G+
Sbjct: 382 KSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGI 441

Query: 547 TYTPTKE---EIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKK 603
                +E   +++ V +     NFI    +  +T+IGS G  LSGGQ+Q++AIARAL+K 
Sbjct: 442 DGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIARALMKD 501

Query: 604 PTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGS 663
           P ILILDE+ SALDV   G I        K K  T I + H L+ I  S +   L   G 
Sbjct: 502 PQILILDESLSALDVLQRGLILRAIRTHRKEK--TTIILTHELNQI-GSNDFCYLIESGQ 558

Query: 664 VVEMGKFKKLYANPTS 679
            +E G  + L  +P++
Sbjct: 559 CIEHGLEETLVNDPST 574

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  196 bits (498), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 133/440 (30%), Positives = 215/440 (48%), Gaps = 16/440 (3%)

Query: 252 ALICGVVGVGMMCSLSPQLSILLL---FFTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CG++      S +    + +L   FFT    F  + +  + R ++     A  +   
Sbjct: 264 SVVCGILTYQFGSSFAAMTFVTMLLYSFFT----FKTTAWRTEFRRSA---NRADNKAAS 316

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E    ++Y+ ++                     + +   +   
Sbjct: 317 VALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTA 376

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G+  V++  L++GDL             +  L + Y E+ Q       LF+L    
Sbjct: 377 MMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNP 436

Query: 429 PSISPTAGHKYKPHR--GVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRG 486
             I  T      P      ++F++V+F Y  +P   I KN  F IAPG    IVGPSG G
Sbjct: 437 ILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRNILKNATFTIAPGKKTAIVGPSGSG 494

Query: 487 KSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL 546
           KSTI  L+ R+Y+P  G I++D +DI +++   LRR +G+V Q+  L + TI +N+ +G 
Sbjct: 495 KSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFG- 553

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTI 606
               T  EI +  ++    + I K P   +T++G RG ++SGG+KQR+AIAR L+K   I
Sbjct: 554 RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDTPI 613

Query: 607 LILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVE 666
           +  DEATSALD  +E ++  T        + T + IAHRL TI  ++ +IVL  +G+V E
Sbjct: 614 MFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVL-ENGAVRE 672

Query: 667 MGKFKKLYANPTSALSQLLN 686
            G    L ANP S  S+L N
Sbjct: 673 EGTHNALLANPNSLYSELWN 692

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  196 bits (497), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 166/577 (28%), Positives = 267/577 (46%), Gaps = 38/577 (6%)

Query: 138 KVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSF------------FTVALLIGCAAN 185
           KV   VL  L    GS    +++P F   + + ++              T  +L   AA 
Sbjct: 105 KVKARVLIALSLLVGSKVLNVQVPFFFKQIVDSMNIEWADPTAVLPIAVTAMILSYGAAR 164

Query: 186 FGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM--- 242
           FG  +L   L   + A +    I +   Q  +      +G  +SR       ++R+M   
Sbjct: 165 FGS-VLFGELRNAIFASVAQSAITRVSLQTFQHLMKLDLGWHLSRQTGG---LTRAMDRG 220

Query: 243 TQKVSDGVKALICGV----VGVGMMCS-LSPQL--SILLLFFTPPVLFSASVFGKQIRNT 295
           T+ +S  + A++  +    V +G +C  L+ Q   S   + FT  +L+S   F      T
Sbjct: 221 TKGISYVLSAMVFHIIPITVEIGAVCGILTYQFGASFAAMTFTTMLLYSIFTFKTTAWRT 280

Query: 296 S--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 353
              K   +A  +   VA + L   + V+ F  E    ++Y+ ++                
Sbjct: 281 EFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAF 340

Query: 354 XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ 413
                + +   +   ++  G   V+   LS+GDL             +  L + Y E+ Q
Sbjct: 341 LNAGQNFIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 400

Query: 414 GAGAASRLFELTDRKPSIS----PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNF 469
                  LF+L   K  I     P      +P + V  F++VSF Y   P   I KN +F
Sbjct: 401 SLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSKIV--FENVSFGYD--PDRMILKNSSF 456

Query: 470 KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQ 529
            +  G    IVGPSG GKSTI  L+ R+Y+P  G I++D +D+ +++ +SLRR IG+V Q
Sbjct: 457 TMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQ 516

Query: 530 EPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGG 589
           +  L + +I +N+ +G   + + EEIR   ++    + + + P   DT++G RG ++SGG
Sbjct: 517 DTPLFNDSIWENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGG 575

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI 649
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T + IAHRL TI
Sbjct: 576 EKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTI 635

Query: 650 RRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
             ++ +IV+   G V E GK  +L A P S  ++L N
Sbjct: 636 ADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELWN 671

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  195 bits (495), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 260/525 (49%), Gaps = 42/525 (8%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR 230
            +++G AA     NF +  LL   SE  +  LR  ++ K   ++  +F  +++K  ++ + 
Sbjct: 766  IVLGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITAL 825

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     V  +G++ +L    +LS++ +   P ++  ++
Sbjct: 826  VLNDL----RDLRSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSA 881

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
            ++G  ++    D + +  QL     + ++ IKT++   AE +    Y+   + + Q+   
Sbjct: 882  IYGGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYK 941

Query: 347  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFG 403
                        +++       +  YG  LVL  + +   + +    +L+T  +  ++ G
Sbjct: 942  RAIATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVG 1001

Query: 404  LSTFYSEIMQGAGAASRLFELTDRKPSISPT----------AGHKYKPHRGV--VEFKDV 451
                  +I +G  AAS ++ + D +                +G +Y   R +  +  +++
Sbjct: 1002 Q---IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPIISIRNL 1058

Query: 452  SFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQD 511
            SF+YP+ P+V IFK+++  +    ++ IVG SG GKST+ALLL R YN    +I+ID  D
Sbjct: 1059 SFAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTD 1118

Query: 512  ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
            +   N  SLR+ I +V+Q+P    G+IRDN+TYG      + EI  V K    ++F+   
Sbjct: 1119 VNDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASL 1178

Query: 572  PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHL 631
            P   DT + +   LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN     +
Sbjct: 1179 PQGLDTRVDT--NLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DI 1232

Query: 632  MKSK--SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
            ++     +  + I H    +R   ++ VL H G VVE G F  LY
Sbjct: 1233 VRKGPPGLLTLVITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLY 1276

 Score =  139 bits (350), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 124/460 (26%), Positives = 206/460 (44%), Gaps = 51/460 (11%)

Query: 254 ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           IC ++G     S S  L++++L  +P +   A +F + I   ++     T    ++    
Sbjct: 163 ICALIGTSFYYSWS--LTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWS 220

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           ++  + V+ +  +  E  ++   I                       L    F+    +G
Sbjct: 221 MNAAQLVRLYCTQPLERQKFQEIILSCNTFFIKSCLYVAANAGILRFLTLTMFVQGFWFG 280

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--------- 424
           S ++ + +L+I D+                ++ F+S IM G+   S L ++         
Sbjct: 281 STMIRKGKLNINDV----------------ITCFHSCIMLGSTLNSTLHQIVVLQKGEVA 324

Query: 425 ---------TDRKPSISPTAGHKYKPHRGVVE---FKDVSFSYPTRPSVQIFKNLNFKIA 472
                    +  K + S T  H   P         F++VSF+YP+RPS  + +N+N K  
Sbjct: 325 LQKIMALLESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFP 384

Query: 473 PGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPV 532
            G    IVG SG GKSTI+ LLL +Y+   G+I+I+ ++   +  K L  +I +V+Q   
Sbjct: 385 SGQFTFIVGKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCT 444

Query: 533 LMSGTIRDNITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
           L + T++ NI  G T +    +         I+   +       I   P+  +T+IGS G
Sbjct: 445 LFNDTLKKNILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGG 504

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIA 643
             LSGGQ+QR+AIARA I+   IL LDEA SALD+     +     H  K K  T I + 
Sbjct: 505 VSLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGK--TTIILT 562

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
           H LS I   +++ V+  +G VVE G   +L A+  +  S+
Sbjct: 563 HELSQIESDDHLYVM-QEGRVVESGIQSELLADSATTFSK 601

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  194 bits (492), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 140/508 (27%), Positives = 244/508 (48%), Gaps = 24/508 (4%)

Query: 183  AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 240
             +NF +  +L   SE  +  LR   +++   +  E+F  + +K  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 241  SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
             ++Q +S     L   +VG+    +   +LS++ +   P ++  + ++G  ++N     +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 301  EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
                 L  +  E ++G+KT++    + +    Y+    ++ Q+               + 
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 361  LGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSEIMQGAGA 417
            +       +  YG  LV+  + S   +      +L+T  T N+   L +   +I +G  A
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRA 999

Query: 418  ASRLFELTDRKPSISPT-----------AGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKN 466
            AS ++ + +                    G K    + +V   ++ F+YPT   V I+ N
Sbjct: 1000 ASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDN 1059

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGI 526
            L+  +  G +V IVG SG GKST+  LL + Y  +   I ID  D+ + + ++LRR I +
Sbjct: 1060 LSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISV 1119

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLL 586
            V+Q+PVL  GT+R+N+ YGL ++P + +I  + K    ++FI   P   +T + +  +L+
Sbjct: 1120 VEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLI 1177

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRL 646
            SGGQ QR+ IARAL++KP ILILDE TSALD  S   IN          S+  ISI H  
Sbjct: 1178 SGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNE 1235

Query: 647  STIRRSENVIVLGHDGSVVEMGKFKKLY 674
              +R    V VL  DG + E G F KL+
Sbjct: 1236 QMMRSCNTVAVL-KDGKICETGPFNKLF 1262

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 155/628 (24%), Positives = 270/628 (42%), Gaps = 76/628 (12%)

Query: 96  RSKTDDYKDIIRLFMLAKRDWKXXXXXXXXXXXSCSIGMSIPKVIGIVLDTLKTSSGSDF 155
           + K   +K+ I +++  KRDW            +  +      + G V D LK     DF
Sbjct: 3   KKKVSVWKENIYMYVQFKRDWLLIATMVLTTIANGLVPAVTSILTGKVFDLLK-----DF 57

Query: 156 FELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRI-----LSERVVARLRAHVIKK 210
            +  IP     LY  L   +++L+   A  F   I   I       E     +R  ++  
Sbjct: 58  ADPNIPK-DHNLYHQLVLRSMSLMALAACAFP-LIWTSISTWMSFGEGQGFTVRYRMLNS 115

Query: 211 TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL---- 266
            L +  E++D  +       L  D   ++R + +  +   +A    +  +  M SL    
Sbjct: 116 YLDKSMEWYDKKE------NLSGDFTQLNRCVEELRASSAEASAITLQNISSMLSLIGVS 169

Query: 267 ---SPQLSILLLFFTPPVLFSASVFGKQIR------NTSKDLQE-------ATGQLTRVA 310
              S  L++++L  TP ++  A +F + I+      NT   L          + Q+ +++
Sbjct: 170 FYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLS 229

Query: 311 EEQLSGIKTVQSFVAEGNE----LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSF 366
             QL  I++ +    + N+    LS Y  A                        L    F
Sbjct: 230 CTQLKEIESFEELTLKCNDYFIKLSLYVAA-----------------NISTLRFLSLAMF 272

Query: 367 LTVLAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           +    +G+  + +  L+I D +T F   L    T N   G   F    +Q    A R  +
Sbjct: 273 VQGFWFGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIF----LQKGQVALRKIQ 328

Query: 424 --LTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVG 481
             L D K  I  +A  +    +  + F+ VSFSYP+RP+  +  +++     G +  IVG
Sbjct: 329 SFLNDNKVEIDESALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVG 388

Query: 482 PSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 541
            SG GKST++ LLL+ Y+   G I I    I +++ + L ++I +V+Q   L + T+ +N
Sbjct: 389 RSGSGKSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNN 448

Query: 542 ITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAI 596
           I  G      +    +++++   K     + I    N  DT++G+ G  LSGGQ+QR+A+
Sbjct: 449 ILLGSQDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVAL 508

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVI 656
           ARA ++   +LILDEA SALD+     +        + +  T I + H LS I   + + 
Sbjct: 509 ARAYMRDTEVLILDEAVSALDIVHREQLMSNITKWRQGR--TTIILTHELSQISIQDYLY 566

Query: 657 VLGHDGSVVEMGKFKKLYANPTSALSQL 684
           V+  +G ++E G   +L  +P SA  ++
Sbjct: 567 VV-EEGRIIESGFQGQLMYDPDSAFCRM 593

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 134/438 (30%), Positives = 214/438 (48%), Gaps = 11/438 (2%)

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
           +++CG++      S + +++ + +          + +  Q R   +D  +A  +   +A 
Sbjct: 261 SVVCGILTHQFGASFA-EITFMTMLLYSIFTIKTTAWRTQFR---RDANKADNKGASIAL 316

Query: 312 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLA 371
           + L   + V+ F  E    S+YN A+ D                   +L+   +   ++ 
Sbjct: 317 DSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNSGQNLIFTTALTGMMY 376

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 431
            G   V+   L++GDL             +  L + Y E+ Q       LF+L   +  I
Sbjct: 377 LGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNEVKI 436

Query: 432 SPTAGHKY-KPHRGVVE--FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKS 488
                 K      G  E  F++V+F Y      +I KN +F I  G    IVGPSG GKS
Sbjct: 437 HNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTIPAGWKTAIVGPSGSGKS 494

Query: 489 TIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
           TI  L+ R+Y+P  G I+I+  D+ ++   SLR+ IG+V Q+  L + +I +N+ +G   
Sbjct: 495 TILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDTPLFNDSIWENVKFG-RI 553

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI 608
                EI  V ++    + I K P +Y+T++G RG ++SGG+KQR+AIAR L+K  +++ 
Sbjct: 554 DALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGEKQRLAIARVLLKDASVMF 613

Query: 609 LDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            DEATSALD  +E A+  T     K+ S T I IAHRL TI  ++ +IVL  DG+V E G
Sbjct: 614 FDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIADADKIIVL-EDGTVREEG 672

Query: 669 KFKKLYANPTSALSQLLN 686
              +L A  TS   +L N
Sbjct: 673 THNELLAKSTSLYKELWN 690

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  189 bits (480), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 135/440 (30%), Positives = 218/440 (49%), Gaps = 20/440 (4%)

Query: 252 ALICGVVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CG++      S +    S +LL+  FT       + +    R   +D   A  +   
Sbjct: 245 SVVCGILTYQFGASFAAITFSTMLLYSIFT----IKTTAWRTHFR---RDANRADNKAAS 297

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E    S+YN ++ +                   +L+   +   
Sbjct: 298 VALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTA 357

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G   V+   L++GDL             +  L + Y ++ Q       LF+L   +
Sbjct: 358 MMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNE 417

Query: 429 PSIS----PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSG 484
             I     P    ++ P+   + F++V+F Y   P  +I KN +F I  G    IVG SG
Sbjct: 418 VKIKSVERPLMLPEHVPYE--ITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSG 473

Query: 485 RGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
            GKSTI  L+ R+Y+P +G I+I+ +DI + +  +LRR IG+V Q+  L + TI +N+ +
Sbjct: 474 SGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLFNDTIWENVKF 533

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKP 604
           G     T EE+++  ++      I K P  ++T++G RG ++SGG+KQR+AIAR L+K  
Sbjct: 534 G-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRLAIARVLLKNA 592

Query: 605 TILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSV 664
            I+  DEATSALD  +E A+  T      S S T + IAHRL TI  ++ +IVL  +G+V
Sbjct: 593 RIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVL-DNGTV 651

Query: 665 VEMGKFKKLYANPTSALSQL 684
            E GK  +L A P S   +L
Sbjct: 652 KEDGKHIELLATPGSLYREL 671

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  189 bits (481), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 151/524 (28%), Positives = 247/524 (47%), Gaps = 33/524 (6%)

Query: 183 AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSM 242
           AA FG  +L   L   + A++  + IK    Q    FD+    DL   L      ++R+M
Sbjct: 180 AARFGA-VLFGELRNAIFAKVAQNTIKTISLQT---FDHLMKLDLGWHLSRQTGGLTRAM 235

Query: 243 ---TQKVSDGVKALICGVV----GVGMMCS-LSPQL--SILLLFFTPPVLFSASVFGKQI 292
              T+ +S  + A+I  ++     + ++C  L+ Q   S   + FT  +L+         
Sbjct: 236 DRGTKGISYVLTAMIFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYGIFTLRTTA 295

Query: 293 RNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXX 350
             T   +   +A  +   +A + L   + V+ F  E    S+YN +++   +        
Sbjct: 296 WRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQS 355

Query: 351 XXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSE 410
                   +L+   +   ++  G   +L   LS+GDL             +  L + Y +
Sbjct: 356 LAFLNSGQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRD 415

Query: 411 IMQGAGAASRLFEL--------TDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQ 462
           + Q       LF+L         ++ P+I       +      +EFK+V+F Y   P+ +
Sbjct: 416 LKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPFN-----IEFKNVTFGYD--PNRK 468

Query: 463 IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRR 522
           I +N +F I  G    +VGPSG GKSTI  L+ R+Y+P  G ++++  D+   +  SLRR
Sbjct: 469 ILRNASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRR 528

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSR 582
            IG+V Q+  L + TI +N+ +G   T T E+I +  ++      I K P  Y+T++G R
Sbjct: 529 AIGVVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGER 587

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISI 642
           G ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E  +  T  +     S T + I
Sbjct: 588 GLMISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYI 647

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
           AHRL T+  S+ +IVL  +GS+ E G    L + P S    L N
Sbjct: 648 AHRLRTVADSDKIIVL-KEGSIFEEGTHLGLLSKPNSLYKDLWN 690

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  188 bits (478), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 134/438 (30%), Positives = 216/438 (49%), Gaps = 16/438 (3%)

Query: 252 ALICGVVGVGMMCSLSP-QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA 310
           +++CG++      S +    S +LL+     +F+      +  N  +D   A  +   VA
Sbjct: 247 SVVCGILTYQFGASFAAITFSTMLLY----SMFTIKTTAWRT-NFRRDANRADNKAASVA 301

Query: 311 EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
            + L   + V+ F  E     +YN ++ +                   +L+   +   ++
Sbjct: 302 LDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNSGQNLIFTSALTAMM 361

Query: 371 AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS 430
             G   V+   L++GDL             +  L + Y E+ Q       LF+L   +  
Sbjct: 362 YMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEALFKLRKNEIK 421

Query: 431 IS----PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRG 486
           I     P    ++ P+   + F++V+F Y   P  +I KN +F I  GS   IVG SG G
Sbjct: 422 IKNAERPLMLPEHVPYD--ITFQNVTFGY--HPDRKILKNASFTIPAGSKTAIVGSSGSG 477

Query: 487 KSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL 546
           KSTI  L+ R+Y+P +G I+I+ +DI + +  +LR+ IG+V Q+  L + TI +N+ +G 
Sbjct: 478 KSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFG- 536

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTI 606
               T EE+ +V ++      I K P  ++T++G RG ++SGG+KQR+AIAR L+K   I
Sbjct: 537 RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEKQRLAIARVLLKNARI 596

Query: 607 LILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVE 666
           +  DEATSALD  +E A+  T      S S T + IAHRL TI  ++ +IV   +G V E
Sbjct: 597 MFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVF-DNGKVRE 655

Query: 667 MGKFKKLYANPTSALSQL 684
            GK  +L A P S   +L
Sbjct: 656 EGKHLELLATPGSLYREL 673

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  188 bits (477), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 155/527 (29%), Positives = 252/527 (47%), Gaps = 28/527 (5%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L I C   A FG  +L   L   V AR+  + I+    Q  +      +G  +SR   
Sbjct: 154 IGLTILCYGVARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTG 212

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVV----GVGMMCS-LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  ++     + ++C  L+ Q   S   + F+  +L+
Sbjct: 213 G---LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLY 269

Query: 284 SASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           S          T   +D  +A  +   VA + L   + V+ F  E     +YN ++    
Sbjct: 270 SMFTIKTTAWRTKFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYR 329

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
                            +L+   +   ++  G   V+   L++GDL             +
Sbjct: 330 DSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPL 389

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDRKPSIS----PTAGHKYKPHRGVVEFKDVSFSYPT 457
             L + Y ++ Q       LF+L   +  I     P    ++ P+   + F++V+F Y  
Sbjct: 390 NFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYD--ITFENVTFGY-- 445

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
            P  +I KN +F I  G    IVG SG GKSTI  L+ R+Y+P +G I+I+ +DI + + 
Sbjct: 446 HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDI 505

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
            +LR+ IG+V Q+  L + TI +N+ +G     T EE+ +V ++      I K P  +DT
Sbjct: 506 NALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDT 564

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSM 637
           ++G RG ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      S S 
Sbjct: 565 IVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSR 624

Query: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
           T + IAHRL TI  ++ +IVL  +G V E GK  +L A P S   +L
Sbjct: 625 TSVYIAHRLRTIADADKIIVL-DNGRVREEGKHLELLATPNSLYREL 670

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  188 bits (477), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 127/381 (33%), Positives = 189/381 (49%), Gaps = 7/381 (1%)

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           +A + L   + V+ F  E    S+YN A+                     +L+   +   
Sbjct: 287 IALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNSGQNLIFTSALTA 346

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G   +L   L++GDL             +  L + Y E+ Q       LF+L   +
Sbjct: 347 MMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRRNE 406

Query: 429 PSISPTAGHKYKPHRG---VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGR 485
             I      K  P  G    + F++V+F Y   P   I KN +F IA G  + IVGPSG 
Sbjct: 407 VVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIVGPSGS 464

Query: 486 GKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 545
           GKSTI  L+ R+Y+P  G I+I+  D+ +++  SLR+ IG+V Q+  L + TI +N+ +G
Sbjct: 465 GKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWENVRFG 524

Query: 546 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPT 605
                T EE+ +  ++      I+K     DT++G RG ++SGG+KQR+AIAR L+K   
Sbjct: 525 -RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVLLKNAD 583

Query: 606 ILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVV 665
           I+  DEATSALD  +E  +  T     K+ S T I IAHRL TI  ++ +IVL  DGSV 
Sbjct: 584 IMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-EDGSVK 642

Query: 666 EMGKFKKLYANPTSALSQLLN 686
           E G   +L A   S    L +
Sbjct: 643 EEGTHTELLARDHSLYKDLWD 663

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  188 bits (477), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 138/445 (31%), Positives = 216/445 (48%), Gaps = 25/445 (5%)

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS-----ASVFGKQIRNTSKDLQEATGQL 306
           +++CG++      S +       + FT  +L+S      + +  Q R   +D  +A  + 
Sbjct: 243 SVVCGILTYQFGASFAA------ITFTTMILYSIFTIRTTAWRTQFR---RDANKADNKG 293

Query: 307 TRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSF 366
             VA + L   + V+ F  E     +Y+ ++                     +L+   + 
Sbjct: 294 ASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNSGQNLIFTSAL 353

Query: 367 LTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
             ++  G   V+   L++GDL             +  L + Y E+ Q       LF+L  
Sbjct: 354 TAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQL-- 411

Query: 427 RKPSISPTAGHK---YKPHRGVVE--FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVG 481
           RK  I    G      K   G  E  F++V+F Y ++   +I  N +F I  G    +VG
Sbjct: 412 RKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSKR--KILNNASFTIPGGLKTAVVG 469

Query: 482 PSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 541
           PSG GKSTI  L+ R+Y+P  G I+I+  D+ + +  SLRR +G+V Q+  L + TI +N
Sbjct: 470 PSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWEN 529

Query: 542 ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALI 601
           + +G     T EE+ +V ++      I K P  Y+T++G RG ++SGG+KQR+AIAR L+
Sbjct: 530 VKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLL 588

Query: 602 KKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHD 661
           K   I+  DEATSALD  +E A+  T     +S S T + IAHRL TI  ++ +IVL  D
Sbjct: 589 KNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL-ED 647

Query: 662 GSVVEMGKFKKLYANPTSALSQLLN 686
           G+V E G    L A P S  + L N
Sbjct: 648 GAVKEEGTHSGLLATPGSLYANLWN 672

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  189 bits (481), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 146/522 (27%), Positives = 252/522 (48%), Gaps = 36/522 (6%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISR 230
            +++G AA     NF +  LL   SE  +  LR  +++K   ++  +F  +N+K  ++ + 
Sbjct: 766  VVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISAL 825

Query: 231  LGSDAYVVSRSMTQKVSDGVKAL--ICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSAS 286
            + +D     R +   VS+ + A+     V  +G++ +L    +LS++ +   P ++  + 
Sbjct: 826  VMNDL----RDLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSV 881

Query: 287  VFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
            ++G  ++    D + +  QL     + ++ IKT++   AE +    Y+     +  +   
Sbjct: 882  IYGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASK 941

Query: 347  XXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLST 406
                        +++       +  YG  LV+  + +   + A      +T  +   L  
Sbjct: 942  RAIATGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVG 1001

Query: 407  FYSEIMQGAGAASRLF----------ELTDRKPSISPTAGHKY--KPHRGVVEFKDVSFS 454
               +I +G  AAS ++          E+ D    +   +G  Y    ++ +V  ++++F+
Sbjct: 1002 QIPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFA 1061

Query: 455  YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITK 514
            YP+ P++ I+K ++  +  G +V IVG SG GKST+ LLL   Y    G I ID  D+  
Sbjct: 1062 YPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVND 1121

Query: 515  MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT 574
             N  SLRR I +V+Q+P L  G+IRDN+TYG        E+    K    ++F+   P +
Sbjct: 1122 WNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQS 1181

Query: 575  YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS 634
             DT I +   LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN     ++K 
Sbjct: 1182 LDTRIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKK 1235

Query: 635  K--SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
               ++  + I H    +R   +V+V   DG +VE G F  LY
Sbjct: 1236 GPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLY 1276

 Score =  161 bits (407), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 238/508 (46%), Gaps = 25/508 (4%)

Query: 195 LSERVVARLRAHVIKKTLHQD-AEFFDNHK--VGDL--ISRLGSDAYVVSRSMTQKVSDG 249
           + ER   R+R+ +++  L +   E++D ++  +GD   I+R   +    S   +      
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDFTQINRCVEELRSSSAEASAITFQN 159

Query: 250 VKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRV 309
           + A IC ++G     S S  L++++L  +P +   A  F + I   +K     TG+  ++
Sbjct: 160 LVA-ICALIGTSFFYSWS--LTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQL 216

Query: 310 AEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
               ++  + V+ +  +  E  ++   + +                     L    F+  
Sbjct: 217 LTWSMNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIKSCFYLAANAGVLRFLTLTMFVQG 276

Query: 370 LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
             +GS ++ + +L+I D+          G  +         + +G  A  ++  L +  P
Sbjct: 277 FWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLENGP 336

Query: 430 SISPTAGHK-YKP----HRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSG 484
             + +   + Y+P      G + F++VSF+YP+RP+  I +N   K   G    IVG SG
Sbjct: 337 KRNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKSG 396

Query: 485 RGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
            GKSTI+ LLL++Y+   G+I I+ ++I  +  KSL  +I +V+Q   L + T+++NI  
Sbjct: 397 SGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNILL 456

Query: 545 GLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIA 595
           G T +    +         I+   +       I   P+  +T+IGS G  LSGGQ+QR+A
Sbjct: 457 GSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQQRVA 516

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENV 655
           IARA I+   IL LDEA SALD+     +     H  K K  T I + H+LS I  +++ 
Sbjct: 517 IARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGK--TTIILTHQLSQI-EADDY 573

Query: 656 IVLGHDGSVVEMGKFKKLYANPTSALSQ 683
           + L  DG V+E G   +L  + T+  S+
Sbjct: 574 LYLMQDGKVIESGIQSELLVDSTTTFSK 601

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  189 bits (479), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 142/519 (27%), Positives = 255/519 (49%), Gaps = 16/519 (3%)

Query: 179  LIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK--VGDLISRLGSDAY 236
            +I   +NF +  LL I SE  +  LR   +K+ L +  ++F + K    ++ + + +D  
Sbjct: 780  IIDGISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLR 839

Query: 237  VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTS 296
             +   +++ +S     ++  + G+        +L+++ +   P ++  ++++G  ++ + 
Sbjct: 840  DLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSE 899

Query: 297  KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXX 356
             D + +   L  +  + +S IKT++S   EG+    Y VA   +  V             
Sbjct: 900  TDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGIS 959

Query: 357  XXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG 416
              + +       +  YG  L++  + ++  +        +T      L     ++ +G  
Sbjct: 960  ITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQR 1019

Query: 417  AASRLFEL----TDRKPSISPTA----GHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLN 468
            AAS ++ +     D K    P +     +       +++ K+++F+Y + PS+++   L 
Sbjct: 1020 AASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLT 1079

Query: 469  FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQ 528
             K+ PG  + I G SG GK+T+  LL+++Y+     I  + +DI     +SLR  I IV+
Sbjct: 1080 LKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVE 1139

Query: 529  QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSG 588
            Q+P ++SG+IRDN+        +  E+  V K     +FI   P+  DT+I +  TLLSG
Sbjct: 1140 QKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSG 1197

Query: 589  GQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLST 648
            GQ QRI IARAL++KP ILILDE TSALD  S   IN      +    +TIISI H  S 
Sbjct: 1198 GQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIISITHSESM 1255

Query: 649  IRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
            +   +NV VL  +G +VE+G +  L A  +S L +LL++
Sbjct: 1256 MTSCQNVAVL-KNGKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  166 bits (421), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 130/505 (25%), Positives = 235/505 (46%), Gaps = 21/505 (4%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFD-NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
           + ER   ++R  ++   L Q   ++D N ++    ++L      +  S  +  +   +  
Sbjct: 106 IGERQGIKVRTKILNNYLTQSMTWYDLNEQLQGDFTQLHRCVEELRSSSAEASAVTFQNC 165

Query: 254 ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           I  +  +      S  L++++L  TP +   +  F   I+  +      T    ++  E 
Sbjct: 166 IAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQIFTET 225

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           +  I+ ++    +  +L ++  +I    +                  L  L F+    +G
Sbjct: 226 IQNIQLIKLNNLQLKKLMKFQTSISKCNKFFIQMCLYVSLNTSILRTLTLLMFVQGFWFG 285

Query: 374 SYLVLQSQLSIGD-LTAF---MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
           S ++ +  L I + +T F   +L      N +  +      + +G  A  ++ +  D   
Sbjct: 286 STMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVV----LQKGEVALQKIVDFLDEAD 341

Query: 430 SISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489
                           + F+++SF+YP+RP+  I   +N      ++  IVG SG GKST
Sbjct: 342 DPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGKST 401

Query: 490 IALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT-- 547
           ++ LLL++Y    G I+ID+ +I  +N K+L  +I IV+Q+  L + TIR+NI +G++  
Sbjct: 402 LSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNF 461

Query: 548 ---YTPTK----EEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
              Y   +    E +++        +F+   PN  DTVIG+ G  LSGGQ+QR+A+ARA 
Sbjct: 462 TNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAY 521

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660
           ++ P ILILDEA SALDV     +      L +S   TII + H L+ I   + + V+ H
Sbjct: 522 MRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH 579

Query: 661 DGSVVEMGKFKKLYANPTSALSQLL 685
            G ++E GK K+L  +P +   +L+
Sbjct: 580 -GRIIEHGKRKELITDPNTEFHKLV 603

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  185 bits (469), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 135/440 (30%), Positives = 216/440 (49%), Gaps = 20/440 (4%)

Query: 252 ALICGVVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CG++      S +    S +LL+  FT       + +    R   +D  +A  +   
Sbjct: 244 SVVCGILTYQFGASFAAITFSTMLLYSIFT----IKTTAWRTHFR---RDANKADNKAAS 296

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E     +YN ++ +                   +L+   +   
Sbjct: 297 VALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTA 356

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++  G   V+   L++GDL             +  L + Y ++ Q       LF+L   +
Sbjct: 357 MMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNE 416

Query: 429 PSIS----PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSG 484
             I     P    +  P+   + F++V+F Y   P  +I KN +F I  G    IVG SG
Sbjct: 417 VKIKNAERPLMLPENVPYD--ITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSG 472

Query: 485 RGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
            GKSTI  L+ R+Y+P +G I+I+ +DI + +  +LR+ IG+V Q+  L + TI +N+ +
Sbjct: 473 SGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKF 532

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKP 604
           G     T EE+ +V ++      I K P  +DT++G RG ++SGG+KQR+AIAR L+K  
Sbjct: 533 G-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNA 591

Query: 605 TILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSV 664
            I+  DEATSALD  +E A+  T      S S T + IAHRL TI  ++ +IVL  +G V
Sbjct: 592 RIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVL-DNGRV 650

Query: 665 VEMGKFKKLYANPTSALSQL 684
            E GK  +L A P S   +L
Sbjct: 651 REEGKHLELLAMPGSLYREL 670

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 174/330 (52%), Gaps = 10/330 (3%)

Query: 363 DLSFLTVLAYGSYL----VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
           +L F + L    Y+    V++  L++GDL             +  L + Y E+ Q     
Sbjct: 355 NLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELKQSLIDM 414

Query: 419 SRLFELTDRKPSISPTAGHKYKPHR--GVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSS 476
             LF L   K +I      +  P +    + F++V+F Y   P  +I KN  F I  G  
Sbjct: 415 ESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKK 472

Query: 477 VCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSG 536
             IVGPSG GKSTI  L+ R+Y P  G I+ID +DI +++  SLR+ IG+V Q+  L + 
Sbjct: 473 TAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFND 532

Query: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAI 596
           TI +N+ +G     + ++I +  ++      I   P   +T++G RG ++SGG+KQR+AI
Sbjct: 533 TIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAI 591

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVI 656
           +R L+K   ++  DEATSALD  +E ++  T     + +S T + IAHRL TI  ++ +I
Sbjct: 592 SRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKII 651

Query: 657 VLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
           VL ++  V E G  K L   P S  S+L N
Sbjct: 652 VL-NNSRVHEEGDHKTLLKTPGSLYSELWN 680

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  181 bits (460), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 174/331 (52%), Gaps = 17/331 (5%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LTV+ Y G   ++   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 372 SALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQ 431

Query: 424 LTD--------RKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGS 475
           L           KP +    GH   P    + F++V+F Y  +   +I KN +F+I  G 
Sbjct: 432 LKKNPIIIKNVEKPLMLAEKGHM--PM--TIRFENVTFGYDKQR--KILKNASFQIESGQ 485

Query: 476 SVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMS 535
              IVGPSG GKSTI  LL R+Y+P  G I+++  D  + +  SLR+ IG+V Q+  L +
Sbjct: 486 KTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFN 545

Query: 536 GTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIA 595
            TI +N+ +G     + +EI  V  +      + K P   +T++G RG ++SGG+KQR+A
Sbjct: 546 DTIWENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLA 604

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENV 655
           IAR L+K   I+  DEATSALD  +E A+  T     K  S T + IAHRL TI  ++ +
Sbjct: 605 IARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKI 664

Query: 656 IVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
           IVL  +G+V E GK  +L A   S   +L N
Sbjct: 665 IVL-QEGTVREEGKHSELLARSGSLYKELWN 694

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  184 bits (466), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 163/557 (29%), Positives = 257/557 (46%), Gaps = 50/557 (8%)

Query: 136  IPKVIGIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRIL 195
            +PKV G+         GS  + LK  +  L          VA   G +  F +   L  +
Sbjct: 732  VPKVDGV---------GSSHYLLKWSVIVL---------CVAFTDGIST-FLKSFSLGFV 772

Query: 196  SERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
            SE  +  LR   ++   +++ E+F  D +K  +L + + +D   +   +++ +S     +
Sbjct: 773  SENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAMSTFI 832

Query: 254  ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
            +  + G+    +   +LS++ +   P ++  ++++G  ++      +     L     E 
Sbjct: 833  VVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENCVYEI 892

Query: 314  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
            + GIKT++    E + + RY+V    +  +G              + L       +  YG
Sbjct: 893  MLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAILFYYG 952

Query: 374  SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ------GAGAASRLFEL--- 424
              LV      IG+ T   ++  +T   +F + T  S I Q      G  AASR+F +   
Sbjct: 953  LKLVF-----IGEYTTMKMFKTFTL-LLFTIMTCTSLINQIPDVTRGQRAASRIFRILDE 1006

Query: 425  TDRKPSISPTAGH-----KYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
            +DR    S   G      K    + ++   ++ F YP+  S  +F  LN +IA   +V +
Sbjct: 1007 SDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVAV 1066

Query: 480  VGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 539
            V  SG GKST+  LL R Y     +I ID  DI +    SLR  I IV+Q+P L  G+IR
Sbjct: 1067 VAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSIR 1126

Query: 540  DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARA 599
             N+ YG        +I  V KQ    +F+T  PN  DT + +  +LLSGGQ QRI IARA
Sbjct: 1127 KNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRICIARA 1184

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGHLMKSK--SMTIISIAHRLSTIRRSENVIV 657
            L++K  ILILDE TSALD ES     +   +L+KS    +  I+I H    +R   NVIV
Sbjct: 1185 LLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVIV 1240

Query: 658  LGHDGSVVEMGKFKKLY 674
            L  DG   + G F +LY
Sbjct: 1241 L-QDGETAQQGTFDELY 1256

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 128/511 (25%), Positives = 244/511 (47%), Gaps = 46/511 (9%)

Query: 202 RLRAHVIKKTLHQDAEFFDNHK--VGDLIS--------RLGSDAYVVSRSMTQKVSDGVK 251
           R+R  ++   L +  E+FD +   +GD +         R GS     + ++T +    + 
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAE---ASAITFQNFVAII 159

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
           AL+C           S  L++++L  +P ++  A+ F + I N +K   + TG   +   
Sbjct: 160 ALVCTSF------YYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLT 213

Query: 312 EQLSGIKTVQSFVAEGNELSRY-NVAIR--DIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
             ++  + V+ +  +  E+ ++  + IR  D F                 SL     F+ 
Sbjct: 214 WSMNAAQLVKLYCTQDFEIKKFKEIVIRCNDYFINAWFYVSANTSILRFLSLA---MFVQ 270

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFG--LSTFYSEI--MQGAGAA-SRLFE 423
              +GS ++ ++++S+  +      T ++   + G  L+T   +I  +Q A    +R+ +
Sbjct: 271 GFWFGSTMIKKNKMSVDQVI-----TCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQD 325

Query: 424 LTDRKPSISPTAGHKYKPHRGVV----EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
             + K  ++     +   +   V     F  +SF YP+RP   + KN++    P  +  I
Sbjct: 326 FLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFI 385

Query: 480 VGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 539
           VG SG GKST++ LLL++YN   G I ++  ++  ++   + +++ +V+Q+  L + T+R
Sbjct: 386 VGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLR 445

Query: 540 DNITYGLTYTPTKEEIRS-VAKQC---FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIA 595
           +N+  GL++    E++ S + + C      N I K P+  DT +GS G  LSGGQ+QR+A
Sbjct: 446 NNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVA 505

Query: 596 IARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENV 655
           +ARA ++   ++ILDEA SALD  +   +        +SK+  I++  H L+ I  S+  
Sbjct: 506 LARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSKTAIILT--HELNQILPSD-F 562

Query: 656 IVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
           + L  +G + E G   +L  N  S   +  +
Sbjct: 563 LYLMENGQIKEEGYQNELIENVESTFCKFFH 593

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  179 bits (455), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 128/433 (29%), Positives = 210/433 (48%), Gaps = 16/433 (3%)

Query: 252 ALICGVVGVGMMCSLSP-QLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTR 308
           +++CG++      S +    S +LL+  FT    F  + +  + R   +D  +A  +   
Sbjct: 243 SMVCGILTYQFGASFAAITFSTMLLYSIFT----FRTTAWRTRFR---RDANKADNKAAS 295

Query: 309 VAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT 368
           VA + L   + V+ F  E     +Y+ ++                     +L+   +   
Sbjct: 296 VALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNTGQNLIFTTALTA 355

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRK 428
           ++      V+Q  L++GDL             +  L + Y ++ Q       LF+L   +
Sbjct: 356 MMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQ 415

Query: 429 PSISPTAGHKYKP-HRGV-VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRG 486
            +I  +   +  P H+ + + F++V+F Y   P  +I  N++F I  G    IVGPSG G
Sbjct: 416 VTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFTIPAGMKTAIVGPSGSG 473

Query: 487 KSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL 546
           KSTI  L+ R+Y P  G I++   DI  ++  SLR+ IG+V Q+  L + TI +N+ +G 
Sbjct: 474 KSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFGN 533

Query: 547 TYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTI 606
             +   E +R++ K       +   P    TV+G RG ++SGG+KQR+AIAR L+K   +
Sbjct: 534 ISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPL 592

Query: 607 LILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVE 666
           +  DEATSALD  +E A+ +T      S S T + +AHRL TI  ++ +IVL   GSV E
Sbjct: 593 MFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADKIIVL-EQGSVRE 651

Query: 667 MGKFKKLYANPTS 679
            G    L A+  S
Sbjct: 652 EGTHSSLLASQGS 664

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  179 bits (453), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 161/551 (29%), Positives = 255/551 (46%), Gaps = 37/551 (6%)

Query: 157 ELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDA 216
           E   P  +LP+   L+ F+  +     A FG  +L   L   V A++  + I+       
Sbjct: 173 EWSDPTIALPMSICLTIFSYGV-----ARFGA-VLFGELRNAVFAKVAQNAIRTV---SL 223

Query: 217 EFFDNHKVGDLISRLGSDAYVVSRSM---TQKVSDGVKALICGVVGVGMMCS-----LSP 268
           E F +    DL   L      ++R+M   T+ +S  + A++  ++ +G   S     L+ 
Sbjct: 224 ETFQHLMKLDLGWHLKRQTGGLTRAMDRGTKGISYVLSAMLFHIIPIGFEISVVCGILTY 283

Query: 269 QL--SILLLFFTPPVLFS-----ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           Q   S   + FT  +L+S      + +  Q R   +D  +A  +   VA + L   + V+
Sbjct: 284 QFGASFAGITFTTMLLYSIFTIRTTAWRTQFR---RDANKADNKGASVALDSLINFEAVK 340

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ 381
            F  E    ++Y+ ++                     +L+   +   ++  G   V++  
Sbjct: 341 YFNNETYLSNKYHDSLLQYRDSTIKVAQSLAFLNSGQNLIFTSALTMMMYLGCTGVIEGN 400

Query: 382 LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT----AGH 437
           L++GDL             +  L + Y E+ Q       LF+L      I       A  
Sbjct: 401 LTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPI 460

Query: 438 KYKPHRGVVE--FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
             K   G  E  F++V+F Y T  + +I KN +F I  G    +VGPSG GKSTI  L+ 
Sbjct: 461 MLKSSDGPFEIKFENVTFGYDT--NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVF 518

Query: 496 RYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
           R+Y+P  G ++I+  ++ + +  SLRR +G+V Q+  L + TI +N+ +G       EEI
Sbjct: 519 RFYDPEEGRVLINGINVQRYDIDSLRRVMGVVPQDTPLFNDTIWENVKFG-RINANDEEI 577

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
           + V ++      I K P    T++G RG ++SGG+KQR+AIAR L+K   I+  DEATSA
Sbjct: 578 KQVIEKAQLAPLIEKLPQREKTIVGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSA 637

Query: 616 LDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYA 675
           LD  +E A+  T      S + T I IAHRL TI  ++ +IVL  DG V E G   +L A
Sbjct: 638 LDTHTEQALLNTIRANFPSGTRTSIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLA 696

Query: 676 NPTSALSQLLN 686
              S  S L N
Sbjct: 697 TKGSLYSNLWN 707

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  177 bits (450), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 174/328 (53%), Gaps = 12/328 (3%)

Query: 365 SFLTVLAY-GSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE 423
           S LT + Y G   V+   L++GDL             +  L + Y E+ Q       LF+
Sbjct: 365 SALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 424

Query: 424 LTDRKPSISPTAGHK--YKPHRGV---VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
           L  RK  I     H+    P+      ++F++V+F Y      +I KN +F I  G    
Sbjct: 425 L--RKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYDKER--KILKNASFTIPAGWKTA 480

Query: 479 IVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTI 538
           +VGPSG GKSTI  L+ R+Y+P  G I+++  DI +++  SLR+ IG+V Q+  L + TI
Sbjct: 481 VVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTI 540

Query: 539 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIAR 598
            +N+ +G       E ++++ K       I K P   +T++G RG ++SGG+KQR+AIAR
Sbjct: 541 WENVKFGRIEATDNEILQAIEKAQLAP-LIKKLPKGRETIVGERGLMISGGEKQRLAIAR 599

Query: 599 ALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVL 658
            L+K   I+  DEATSALD  +E ++  T        S T + IAHRL TI  ++ +IVL
Sbjct: 600 VLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL 659

Query: 659 GHDGSVVEMGKFKKLYANPTSALSQLLN 686
             DG V E G  ++L A   S  S+L N
Sbjct: 660 -KDGQVEEEGTHRQLIAKKESLYSELWN 686

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  179 bits (455), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 141/491 (28%), Positives = 238/491 (48%), Gaps = 22/491 (4%)

Query: 196  SERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
            SE  +  LR   ++K  +   E+   DN+K  +L + L +D   +  S +  +S     +
Sbjct: 776  SEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTSTSNFISFVSSFV 835

Query: 254  ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
            I   VG+        +LS++ +   P ++  + ++G  ++    + +    +L  V  E 
Sbjct: 836  IVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEV 895

Query: 314  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
            ++G+KT++    E +  +++NV  +    +G              + L  +S   +L Y 
Sbjct: 896  VTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIVTGFGVAVSNGL-TMSIQGILYYY 954

Query: 374  SY-LVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--R 427
            +  LV+  + +   +      +L+T  T N    L     +I +G  AAS+++ + +   
Sbjct: 955  AIKLVIHGEYTTKKMFETFTLLLFTIMTCN---NLVNQIPDIRRGQRAASKIYRILEGID 1011

Query: 428  KPSISPTAGHKY-----KPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
            +     T GH+       P   ++ F D+SF+YPT P+V+I K+L+ +I  G  + IVG 
Sbjct: 1012 ESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGE 1071

Query: 483  SGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            SG GKST+  ++ R Y   + ++ +D+ D+       LR  I +V+Q+P L  GTIR+N+
Sbjct: 1072 SGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENL 1131

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIK 602
             YG        ++ ++ K    ++F    P   +T I S   LLSGGQ QR+ IARAL++
Sbjct: 1132 VYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKIDS--GLLSGGQNQRLCIARALLQ 1189

Query: 603  KPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDG 662
            +P ILILDE TSALD  S   IN          +M  ISI H    +R    V VL   G
Sbjct: 1190 RPKILILDECTSALDTMSSHIINEIIRE--GPPTMLTISITHDEQMVRACNKVAVLDQ-G 1246

Query: 663  SVVEMGKFKKL 673
             +VEMG  + L
Sbjct: 1247 HIVEMGNREDL 1257

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 138/556 (24%), Positives = 249/556 (44%), Gaps = 27/556 (4%)

Query: 163 FSLPLYEFLSFFTVALLIGCAANFGRFILLR---ILSERVVARLRAHVIKKTLHQDAEFF 219
           +S P++E      V L +G  +    +I +    +L ER   R+R  +I   L +  +++
Sbjct: 54  WSDPIHELRLRSMVILALGAGSIVIIWICISSWMLLGERQNFRVRTQLIDSYLQKPMKWY 113

Query: 220 DNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL-------SPQLSI 272
           D++        L  D    +R + +  S   +A       +  + +L       S  L++
Sbjct: 114 DDNDT------LTGDLTQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTL 167

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           + +   P ++  A  F + I   S+     T   +++    +   + V+    +  E+  
Sbjct: 168 VTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQN 227

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
           + +A++   +                  L    F+    +GS ++ + +L I D+     
Sbjct: 228 FQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQ 287

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT--AGHKYKPHRGV---VE 447
                G  + G       + +G      + E   +   +        ++    G+   +E
Sbjct: 288 SCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIE 347

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI 507
            ++V F+YP+RP+V   KN++  +  G    +VG SG GKS++  LLL+ Y+   G+I I
Sbjct: 348 LRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISI 407

Query: 508 DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT---KEEIRSVAKQCFC 564
           D  DI  ++ KS+ ++I +V+Q   L + T+R+NI +G   T      E +++  +    
Sbjct: 408 DGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRISLL 467

Query: 565 HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
            NFI   P   DT+IG+ G   SGGQ+QRIAIARA ++   IL+LDEA SALD+   G +
Sbjct: 468 DNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLL 527

Query: 625 NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
                +  +S+  TII + H LS I   +++I L  DG VVE G+ + L  N       +
Sbjct: 528 MNAIRN-WRSEKTTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNLLLNQQGRFFNM 584

Query: 685 LNERAAPGPSDQQQQI 700
           ++  A    +D    I
Sbjct: 585 VSLGAGTDLADSSSLI 600

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 150/554 (27%), Positives = 261/554 (47%), Gaps = 39/554 (7%)

Query: 152  GSDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKT 211
            GS F+ LK  +  L +    +F T          F +  ++   SE  +  LR  V++  
Sbjct: 744  GSSFYLLKWSLIVLSVAIIDAFCT----------FSKTFIMGYCSEYWIMDLRKKVMRTI 793

Query: 212  LHQDAEFFD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
             +   E+F    +K  ++ +   +D   +   +T+ ++     L+    G+        +
Sbjct: 794  TYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTEFLATASTFLVVSTCGLIWALVAGWK 853

Query: 270  LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            LS++ +   P ++  + V+G  ++    D + A  QL     E +  +KT++    + + 
Sbjct: 854  LSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHF 913

Query: 330  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IGD 386
             +RY+   + +  +G                L       +  YG  LV+  + +   + +
Sbjct: 914  QNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFE 973

Query: 387  LTAFMLYTEYTGNAVFG----------LSTFYSEIMQGAGAASRLFELTDRKPSISPTAG 436
            +   +L+T  T   +             +T+   I++ A A     ++ +R   IS T+ 
Sbjct: 974  VFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRILKEAAATREHQDMHNRTLPISNTS- 1032

Query: 437  HKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
                    +V  KD++F+YP  PS  ++++LN  +   +SV +VG SG GKSTI  LL +
Sbjct: 1033 ----EKDTMVLVKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGSGKSTIISLLTK 1088

Query: 497  YYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EI 555
             Y+     I +D  D+++ +  SLR  I +V+Q   L++GTIR+N+TYGL    T E ++
Sbjct: 1089 LYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYGLPEEDTTEVDL 1148

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
              + K    ++F+++ PN  DT++     LLSGGQ QR+ IARAL+K   ILILDE TSA
Sbjct: 1149 IGILKLVSIYDFVSRLPNGIDTIVDR--DLLSGGQAQRLCIARALVKPHRILILDECTSA 1206

Query: 616  LDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
            LD  S    N     + K    T II+I H    +R  E+V++L  +G++VE G F +L 
Sbjct: 1207 LDALS---TNIIIDIVRKGIPNTLIIAITHDEHMMRSCESVLLL-KNGAIVEQGSFVELM 1262

Query: 675  ANPTSALSQLLNER 688
                S   + LN R
Sbjct: 1263 QQD-SEFKKCLNGR 1275

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 130/511 (25%), Positives = 233/511 (45%), Gaps = 27/511 (5%)

Query: 202 RLRAHVIKKTLHQDAEFFDNHK---VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVV 258
           R+R +++   L +   ++D +    +G+  ++L      V +S ++  +  +++ +  + 
Sbjct: 95  RIRINMLGSYLSKSWTWYDGNGKRLLGEF-TQLSRCIEEVRQSSSESAAITLQSFVSVLS 153

Query: 259 GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGI- 317
            +G     S  L++++L  TP +   A  F K + N   DL+    + T  A E L+   
Sbjct: 154 LIGTSFYYSWSLTLIILCSTPIITAIAIYFAK-LTNKYTDLE---NKETSYAAELLTWSM 209

Query: 318 ---KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
                V+ + A+  E+S+++ ++     +                 L    F+    +G+
Sbjct: 210 RFNDMVKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGA 269

Query: 375 YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT 434
            ++ +++L I D+          G  V    +  + I +G  A  +L    + +      
Sbjct: 270 TMIRRNKLDINDVITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQ 329

Query: 435 AGHKYKPHRGV--VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
           A  K  P      + F ++SF YP R S    +N++ ++  G    I+G SG GKST+A 
Sbjct: 330 AALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAK 389

Query: 493 LLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG------- 545
           LLLR+Y   +G+I +D+  I  +N + L  +I +V+Q   L + T+R+NI  G       
Sbjct: 390 LLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEP 449

Query: 546 LTYTPTKEEIRSVAKQC---FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIK 602
                 +E  R + K C     +  +    +  DTVIGS G  LSGGQ+QR+A+ARA ++
Sbjct: 450 ARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLR 509

Query: 603 KPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDG 662
              I+I DE+ SALDV     +        + K  T I + H LS I  ++ + ++ H G
Sbjct: 510 NTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-G 566

Query: 663 SVVEMGKFKKLYANPTSALSQLLNERAAPGP 693
            V E G  + L  + TS  S+    +A  G 
Sbjct: 567 RVCEYGYQEDLLKSETSYFSRFYQHQAPEGA 597

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  175 bits (443), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 149/546 (27%), Positives = 248/546 (45%), Gaps = 39/546 (7%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           +AL + C  AA FG  +L   L   V AR+  + I+       E F +    DL   L  
Sbjct: 150 IALTVICYGAARFGS-VLFGELRNAVFARVAQNAIRTV---SLETFKHLMKLDLGWHLSR 205

Query: 234 DAYVVSRSM---TQKVSDGVKALI-------------CGVVGVGMMCSLSP-QLSILLLF 276
               ++R+M   T+ +S  + A++             CG++      S +    + +LL+
Sbjct: 206 QTGGLTRAMDRGTKGISYVLSAMVFHILPITFEISVVCGILTYQFGASFAGITFATMLLY 265

Query: 277 --FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             FT  V    + F        +D  +A  +   VA + L   + V+ F  E     +Y+
Sbjct: 266 SIFTIKVTAWRTAF-------RRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYH 318

Query: 335 VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
            ++                     + +   +   ++  G   V+   L++GDL       
Sbjct: 319 NSLMKYRDSQVKIAQSLAFLNAGQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLV 378

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRG---VVEFKDV 451
                 +  L + Y E+ Q       LF L + K  I         P       ++F++V
Sbjct: 379 FQLSVPLNFLGSVYRELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENV 438

Query: 452 SFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQD 511
           +F Y TR   +I +N +F I  G    IVGPSG GKSTI  L+ R+Y+P +G ++++ +D
Sbjct: 439 TFGYDTRR--KILRNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKD 496

Query: 512 ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
           + + +  S R+ IG+V Q+  L + TI +N+ +G     T +E+ +  ++      I K 
Sbjct: 497 VREYDLDSFRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKL 555

Query: 572 PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHL 631
           P    T++G RG ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T    
Sbjct: 556 PVGSATIVGERGLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIREN 615

Query: 632 MKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAP 691
               S T + +AHRL TI  ++ ++VL  +G V E G   +L + P S   QL + +   
Sbjct: 616 FDRGSRTSVYVAHRLRTIADADKILVL-EEGCVREEGSHTELLSRPNSLYKQLWDIQENL 674

Query: 692 GPSDQQ 697
              DQ+
Sbjct: 675 DVIDQE 680

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  177 bits (448), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 144/506 (28%), Positives = 237/506 (46%), Gaps = 31/506 (6%)

Query: 186  FGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSMT 243
            F +   L   SE  +  LR   I+K   QD  +F  D +K  ++ + + +D   + RS+ 
Sbjct: 808  FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDL-RSLV 866

Query: 244  QKVSDGVKALICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE 301
             +    +  LI  V  VG++ +     +LS++ +   P  +  +  +G  ++    D + 
Sbjct: 867  SEFLSSISTLII-VSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKT 925

Query: 302  ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 361
               +L     E   GI T++    E   L +Y    + + +                + L
Sbjct: 926  KVAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTL 985

Query: 362  GDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAA 418
                   +  YG  LV     S   + +    +L+T  T  ++ G      +I +G  AA
Sbjct: 986  TLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAA 1042

Query: 419  SRLFELTDRKPSISPTAGHKYKP-------HRGVVEFKDVSFSYPTRPSVQIFKNLNFKI 471
            + +F + D +   SP A  + K        H  ++  K++SFSYP+ PS  I+K L   +
Sbjct: 1043 TYIFRIIDNQ---SPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDV 1099

Query: 472  APGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEP 531
              G ++ +VG SG GKST+ LL+   Y    G+I ID  DI + +   LR  I +V+Q+P
Sbjct: 1100 FSGETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKP 1159

Query: 532  VLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQK 591
                GT+ +N+ YG++   T+ +++         +F+   P   DT I +  +L+SGGQ 
Sbjct: 1160 QFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQA 1217

Query: 592  QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK--SMTIISIAHRLSTI 649
            QR++IARA+++KP IL LDE TSALD  +  AI     +L+K     +T I I H    +
Sbjct: 1218 QRLSIARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMM 1273

Query: 650  RRSENVIVLGHDGSVVEMGKFKKLYA 675
            R  E + VL  +G V E G F  LYA
Sbjct: 1274 RACERIAVL-QNGKVAEDGSFDDLYA 1298

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 114/444 (25%), Positives = 195/444 (43%), Gaps = 20/444 (4%)

Query: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
           S  L+++++   P ++  + +  K I   ++     + +  ++        + ++ F  +
Sbjct: 177 SWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQ 236

Query: 327 GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E+ ++ ++++   +                       F+    +G+ ++ Q  L+ GD
Sbjct: 237 QFEIEKFELSVKKCTKYFIRISLFSSASYAMLRFFTLCMFIQGFWFGNKMIRQGVLTTGD 296

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT-------DRKPSISPTA---- 435
           +          GN +         + +G  A  ++   T       D +  I   A    
Sbjct: 297 VITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISDAFILN 356

Query: 436 ---GHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
               +K++   G + FK+VSFSYPTRP+  + KN++       +  IVG SG GKSTI  
Sbjct: 357 HINANKFRCG-GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGK 415

Query: 493 LLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
           LLL+ Y   TG I +D  DI  +    L  +I +V+Q   L + TI++NI  G       
Sbjct: 416 LLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYG 475

Query: 553 EE-IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDE 611
           +  +R   +       I   PN  DTV+GS G  LSGGQKQR+A+ARA ++   ILILDE
Sbjct: 476 DSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDE 535

Query: 612 ATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
           A S +D+     +          K MT + + H L+ I   E+ +    +G + E G   
Sbjct: 536 AISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRESGFKC 592

Query: 672 KLYANPTSALSQLLN-ERAAPGPS 694
            L  N  S  ++L   ++A  G S
Sbjct: 593 NLEKNENSHFNRLWRLQKAKTGFS 616

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  176 bits (446), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 147/523 (28%), Positives = 256/523 (48%), Gaps = 32/523 (6%)

Query: 177  ALLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLIS 229
             +++G AA     NF +  LL   SE  +  LR  V++K   +   +F  +++K  ++ +
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSA 849

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP--QLSILLLFFTPPVLFSASV 287
             + +D   + RS+  +    + + I  V  +G++ +L+   +LS++ +   P ++  +++
Sbjct: 850  LVLNDLRDL-RSLVSEFLSAITSFIT-VSFIGLVWALASGWKLSLVCISMFPLIIIFSAI 907

Query: 288  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 347
            +G  ++    D + +  QL     + ++ IKT++   AE +    Y+     + Q+    
Sbjct: 908  YGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKR 967

Query: 348  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTF 407
                       +++       +  YG  LV+  + +   +        +T  +   L + 
Sbjct: 968  AIATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQ 1027

Query: 408  YSEIMQGAGAASRLFELTDRKPSISPTA----------GHKYKPHRG--VVEFKDVSFSY 455
              +I +G  AAS ++ + D K                 G  Y   +   ++  ++++F+Y
Sbjct: 1028 IPDISRGQRAASWIYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAY 1087

Query: 456  PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKM 515
            P+ PSV I+KN+N  +  G ++ IVG SG GKST+ LLL R Y+   G+I +D  D+   
Sbjct: 1088 PSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDW 1147

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 575
            N   LRR I +V+Q+P+L +GTIRDN+TYG      + EI    K    ++F+   P   
Sbjct: 1148 NLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGL 1207

Query: 576  DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
             T I +   LLSGGQ QR+ IARAL++KP ILILDE TSALD  S   I      ++K  
Sbjct: 1208 GTRIDT--NLLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKKG 1261

Query: 636  --SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676
              ++  + I H    +R  +++ V   DG V+E G F  LY N
Sbjct: 1262 PPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLYNN 1303

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 143/513 (27%), Positives = 236/513 (46%), Gaps = 38/513 (7%)

Query: 192 LRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVK 251
           LRI S+ + A L    +K     D    D  ++   +  L S +   S    Q +     
Sbjct: 131 LRIRSQLLEAYLEKKPMKWYDVNDTLLGDFTQINRCVEELRSSSAEASAITFQNL----- 185

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
             IC ++G     S S  L++++L  +P + F A  F + +   S+   E T +  ++  
Sbjct: 186 VAICALLGTSFYYSWS--LTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFA 243

Query: 312 EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS---FLT 368
             ++  + V+ +  +  E  ++    R I                   +L  L+   F+ 
Sbjct: 244 WSMNAAQLVRLYCTQPLERKKFQ---RIILSCNTFFIKSCLFVAANAGILRFLTLTMFVQ 300

Query: 369 VLAYGSYLVLQSQLSIGD-LTAF---MLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
              +GS ++ Q +L+I D +T F   +L      N +  +      + +G  A  ++  L
Sbjct: 301 GFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVV----LQKGEVALQKIMNL 356

Query: 425 TDRKPSISP---TAGHKYKPHRGVVE--FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
            +  P  +P      H+Y       +  F +VSFSYP+RPS  + +N + K   G    I
Sbjct: 357 LENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFI 416

Query: 480 VGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 539
           VG SG GKST++ LLL++Y+   G+I I+ ++I  +  K L ++I +V+Q   L + T+R
Sbjct: 417 VGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLR 476

Query: 540 DNITYGLT-------YTPTKEE--IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQ 590
            NI  G T       Y+  K    I+   +       I   P+  +T+IGS G  LSGGQ
Sbjct: 477 KNILLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQ 536

Query: 591 KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIR 650
           +QR+A+ARA I+   IL LDEA SALD+     +     H  K K  T I + H L  + 
Sbjct: 537 QQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGK--TTIILTHELGQV- 593

Query: 651 RSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
            S++ + L  +G V+E G   +L A+ TS  S+
Sbjct: 594 ESDDHLYLMQEGKVIESGTQSELLADSTSTFSK 626

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  173 bits (439), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 148/533 (27%), Positives = 244/533 (45%), Gaps = 35/533 (6%)

Query: 176 VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGS 233
           + L + C  AA FG  +L   L   V AR+  + I+       E F +    DL   L  
Sbjct: 149 IMLTVVCYGAARFGA-VLFGELRNAVFARVGQNAIRNV---SMETFRHLMKLDLGWHLSR 204

Query: 234 DAYVVSRSM---TQKVSDGVKALICGVV----GVGMMCS-LSPQL--SILLLFFTPPVLF 283
               ++R+M   T+ +S  + A++  ++     + ++C  L+ Q   S   + FT  +L+
Sbjct: 205 QTGGLTRAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLY 264

Query: 284 SASVFGKQIRNTS--KDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           S   F      T   ++  +A  +   VA + L   + V++F  E     +Y  ++    
Sbjct: 265 SIFTFRTTAWRTKFRREANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYR 324

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAV 401
                            +L+   +   ++  G   ++   L++GDL             +
Sbjct: 325 DSQVRVAQSLAFLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPL 384

Query: 402 FGLSTFYSEIMQGAGAASRLFELTDR--------KPSISPTAGHKYKPHRGVVEFKDVSF 453
             L + Y E+ Q       LF L +         KP + P     +      + F++V+F
Sbjct: 385 NFLGSVYRELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFD-----IVFENVTF 439

Query: 454 SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDIT 513
            Y   P  +I +N +F I  G    +VGPSG GKST+  L+ R+Y+P  G I+++  DI 
Sbjct: 440 GYD--PRRKILQNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIR 497

Query: 514 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
           + +  SLRR IG+V Q+  L + TI +N+ +G      +E  RS+ K       + + P 
Sbjct: 498 EYDLDSLRRAIGVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPG 556

Query: 574 TYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMK 633
             +T++G RG ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T      
Sbjct: 557 GLNTIVGERGLMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFD 616

Query: 634 SKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
             S T + IAHRL TI  ++ +IVL  +G   E G   +L     S   +L N
Sbjct: 617 RGSKTSVYIAHRLRTIADADKIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 137/509 (26%), Positives = 239/509 (46%), Gaps = 17/509 (3%)

Query: 178  LLIGCAA-----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLG 232
            ++IG A+     NF +  LL  +SE+ V +LR ++++  L +D  +   +K  ++ +   
Sbjct: 766  VVIGIASFDAVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTM 825

Query: 233  SDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQI 292
            +D   +    +  +S      +   VG+     +  +L+++ L   P  +   +++G  +
Sbjct: 826  NDLRDLRNVTSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFV 885

Query: 293  RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXX 352
            + +    + A  QL  +  E + G+KT++    E     RY    + + +          
Sbjct: 886  QKSEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYG 945

Query: 353  XXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                  S L  L    +  YG  LV+  +     L        +T  +  GL +      
Sbjct: 946  SGLAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSS 1005

Query: 413  QGAGAASRLFELT-------DRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFK 465
            +G  A + +F +        D   ++   A   +     +V  + ++F+YP    VQI+K
Sbjct: 1006 RGQRAGTFVFGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYK 1065

Query: 466  NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIG 525
            N N +I  G+ V IVG SG GKST+  L+   Y     ++ ID  DI      +LR+ I 
Sbjct: 1066 NFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIA 1125

Query: 526  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTL 585
            +V+Q+P   +GTIR+N+ YGL  T T  EI  V  +    NF+   P   +T + +   L
Sbjct: 1126 VVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDT--NL 1183

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            +SGGQ QR++I RAL+++PT+LILDE TSALD  +  AI     + +    +T+I I H 
Sbjct: 1184 VSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHS 1241

Query: 646  LSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
               ++  + ++VL  +G+V E G F  L+
Sbjct: 1242 KQMMKMCDRIVVL-KNGAVAEDGSFDDLF 1269

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 129/526 (24%), Positives = 230/526 (43%), Gaps = 46/526 (8%)

Query: 194 ILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV------- 246
           +L ER   R+R  +++  L +  +++D  K+ D+     +  Y ++    ++        
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYD--KIDDI-----NGMYTITNRCVEEARASCAEA 149

Query: 247 -----SDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE 301
                   V ALI  V         S +L+++ L   P +     VF K ++  +    E
Sbjct: 150 SGVLFQSAVTALILAVTAF----KFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENE 205

Query: 302 ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLL 361
            T   +      L+    V+ F  +  EL ++N A+    +                  L
Sbjct: 206 QTSSASSTLSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFL 265

Query: 362 GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL 421
             + F+    YGS L+ + ++    +      +    +++  + +    + +G  A  ++
Sbjct: 266 SLMMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQI 325

Query: 422 FELTDRKPSISPT-------AGH--KYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIA 472
            E  + +P   P         GH    +     + F  VSF+YP RP  +    ++    
Sbjct: 326 AEAVNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFR 385

Query: 473 PGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPV 532
           P     IVG SG GKST+  LLL++Y+   G I ++  ++  ++   L ++I +V+Q   
Sbjct: 386 PNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCT 445

Query: 533 LMSGTIRDNITYGLTYTPTKEEIRSVAKQC---FCHNFITKFPNTYDTVIGSRGTLLSGG 589
           L +GT+ +NIT  L+  P  +   +V + C        +   P    T +GS G  +SGG
Sbjct: 446 LFNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGG 503

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI 649
           Q+QR+A+ARA+++   +LILDEA SALD+     +          K  T I + H LS +
Sbjct: 504 QQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADK--TTIILTHELSHV 561

Query: 650 RRSENVIVLGHDGSVVEMGKFKKLYANPTS---ALSQLL---NERA 689
              + + ++ H G V+E G   +L +NP S   AL++L    NERA
Sbjct: 562 LDDDYLYMMEH-GQVIEQGYKSELLSNPNSRFRALNRLQNSKNERA 606

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 150/540 (27%), Positives = 258/540 (47%), Gaps = 25/540 (4%)

Query: 163  FSLPLYEFLSFFT--VALLIGC--AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 218
            ++ P  E+L  F+  V+L+  C   + F +   L    E  +  LR     K +     +
Sbjct: 696  YNSPGSEYLLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISW 755

Query: 219  FD--NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276
            F   N+K   L + L +D   +   +T+ +S     ++   +G+    ++  +LS++ + 
Sbjct: 756  FSKSNNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIA 815

Query: 277  FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
              P V+    ++G  +  T    + +   L  +  E + G+KT+QS   +     ++N  
Sbjct: 816  IIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCK 875

Query: 337  IRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL---TAFMLY 393
            I+ + + G              ++L  L    +  YG  LVL  + +   L    A +L+
Sbjct: 876  IKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLF 935

Query: 394  TEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISP-----TAGHKYKPHRGVV 446
            T  T   V  L T   +I +G  + S + ++   D + +I P     T    + P++ V+
Sbjct: 936  TIVT---VASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVI 992

Query: 447  EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIM 506
            E  ++SF+Y    + +   N+N ++       IVG SG GKST+  L+   Y+ S G+I 
Sbjct: 993  EVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSIN 1052

Query: 507  IDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            I   DI K + K L + + ++QQ PVL   TIR+N+ YGLT T   E + +V +     +
Sbjct: 1053 ICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKS 1112

Query: 567  FITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
            FI    N  D+ +    +LLSGGQ QR+ +AR +++ P +LILDE TSALDV S   IN 
Sbjct: 1113 FIISLNNGLDSKLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKIND 1170

Query: 627  TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
              G   +S +   I ++H+  TI+  + +  L  DG+V  MG +++L  N      +LLN
Sbjct: 1171 IIGS--RSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMEN-NWEFRKLLN 1226

 Score =  167 bits (423), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 142/501 (28%), Positives = 239/501 (47%), Gaps = 31/501 (6%)

Query: 175 TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD-----AEFFDNHK---VGD 226
           T+++LI    N   F  L I    ++   ++++I+K L  +       +FD ++   +G+
Sbjct: 74  TMSILILGMGNLP-FNWLAIYGWMMLGERQSYIIRKKLFHEYFNLPCSWFDKYRSDIMGE 132

Query: 227 LISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSAS 286
             ++L      V  S  +  +   ++L+  +  +G     S  L++++   TP ++  A 
Sbjct: 133 F-TQLHRCIEEVRSSSAEASAIMSQSLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAV 191

Query: 287 VFGKQI-RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
           +F K I + T K+  E+     R+A   L  I+ V+    +  E+S Y   I    +   
Sbjct: 192 IFSKYIHKYTEKENTESECAAERLAW-MLKNIEFVRLHNGDDFEISMYTHYIAQANEYYI 250

Query: 346 XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-LTAF--MLYTEYTGNAVF 402
                         LL  L F+    +GS ++ Q +L+I   +T+F   L      N+  
Sbjct: 251 KASLFISANISILRLLSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSAL 310

Query: 403 GLSTFYSEIMQGAGAASRLFELTDRKPS-----ISPTAGHKYKPHRGVVEFKDVSFSYPT 457
           G +     + +G  A  RL ++ DR P      I   +G    P    + F +VSF YP 
Sbjct: 311 GQAVV---LQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLLP----IVFNNVSFCYPE 363

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           R + ++F  +NF I P     ++GPSG GKST+  L+L +Y+   G+IM+ D DI  +N 
Sbjct: 364 RKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINR 423

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT--PTKEEIRSVAKQCFCHNFITKFPNTY 575
             +  +I +V Q P L + TIR+NI     +T  P+K E+  + K     N I + P+  
Sbjct: 424 NIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGL 483

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
           DT IGS G  LSGGQ Q++A+ARA  +  +IL+LDE  SA+D+     +          K
Sbjct: 484 DTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK 543

Query: 636 SMTIISIAHRLSTIRRSENVI 656
           +  II+  H L  IR ++N++
Sbjct: 544 TTVIIT--HDLEFIRNTDNIL 562

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 135/523 (25%), Positives = 258/523 (49%), Gaps = 30/523 (5%)

Query: 183  AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSR 240
             +NF +  +L   SE  +  LR   ++  L++D  +F  D +K  +L + L +D   +  
Sbjct: 773  VSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRS 832

Query: 241  SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300
             +++ +S     ++  ++G+        +LS++ L   P ++  ++V+G  ++      +
Sbjct: 833  LVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYK 892

Query: 301  EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSL 360
             +   L     E ++GIKT++S  AE + +  Y+    ++  +               ++
Sbjct: 893  TSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNM 952

Query: 361  LGDLSFLTVLAYGSYLVLQSQLS---IGDLTAFMLYTEYTGNAVFGL----------STF 407
            +       +  YG  LV + + S   + +    +L+T  T  ++             +TF
Sbjct: 953  ITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATF 1012

Query: 408  YSEIM-QGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKN 466
               I+ +G  +    FE   +   ++P    K  P   +++ ++++F+YP+  +V ++++
Sbjct: 1013 LYRILDEGLASDESEFETHRKAEIVAPKQESKSNP---LIKIQNLTFAYPSETNVNVYED 1069

Query: 467  LNFKI-APGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIG 525
            LN ++ A   ++ +VG SG GKST+  LL + Y  +  +I +D  D+      +LR  I 
Sbjct: 1070 LNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQIS 1129

Query: 526  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTL 585
            +V+Q+P L  GT+R+N++YG++      E+  + K    + F+   P   DT I ++  L
Sbjct: 1130 VVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK--L 1187

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK--SMTIISIA 643
            LSGGQ QRI IARAL++KP ILILDE TSALD  S   I      ++K+   ++  I I 
Sbjct: 1188 LSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIVIT 1243

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
            H    + R+ N I +  +G ++E G FK+L  N    L ++++
Sbjct: 1244 HS-EKMMRACNTIAVLKNGKIIEKGGFKEL-VNGNGELKKIID 1284

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 126/517 (24%), Positives = 229/517 (44%), Gaps = 43/517 (8%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL- 253
           L ER    +R  ++++ L +   ++D++        L  D   ++R + +  S   +A  
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 254 --------ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA-TG 304
                   I  ++G     S S  L IL    T P++ + +VF   + +   +L+   TG
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILC---TAPIIIAFAVFFSHMIHKYTELENTETG 212

Query: 305 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL 364
           +  ++A   +  I+ V+ +  +  E+  +     +   +                 L   
Sbjct: 213 KAAQLANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDLFIKCCLYVSANTALLRFLSLS 272

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +G+ +V + +L I ++          G+ +         + +G  A  ++   
Sbjct: 273 MFIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGF 332

Query: 425 TDRKPSISPTAGHK-----YKPHR----GVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGS 475
                 +S +  H      Y+P        + F +++FSYP+RPS  + KN++    P  
Sbjct: 333 ------LSTSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTK 386

Query: 476 SVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMS 535
              I+G SG GKST++ LLL++Y+   GTI +   D+ ++N   L  ++ +V+Q   L +
Sbjct: 387 FTFIIGKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFN 446

Query: 536 GTIRDNITYGLT------YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGG 589
            T+R+NI  G++      +   +++++           +   P+  +T+IGS G  LSGG
Sbjct: 447 DTLRNNILLGVSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGG 506

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI 649
           Q+QR+AIARA ++   ILILDEA SALD+     +          K  T I + H LS I
Sbjct: 507 QQQRVAIARAFMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQI 564

Query: 650 RRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
              +   V+  +G V E G  K L    TS  + +LN
Sbjct: 565 EPDDYTYVI-QEGEVKENGYQKDLKQKKTSVFNHMLN 600

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
            YKL209C
          Length = 1293

 Score =  172 bits (437), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 142/523 (27%), Positives = 247/523 (47%), Gaps = 31/523 (5%)

Query: 184  ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMT 243
            +NF +  +L   SE  +  LR   +   +++  ++F   +  +  S L +      R + 
Sbjct: 781  SNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEE--NKSSELSALLLNDLRDLR 838

Query: 244  QKVSDGVKALICGVVG--VGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
              VS+ + A+   +V   VG++ +L    +LS++ +   P ++  + ++G  ++      
Sbjct: 839  SLVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMY 898

Query: 300  QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            + A  +L     E ++ IKT++   A    +  Y V   ++ ++               +
Sbjct: 899  KTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITN 958

Query: 360  LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
             +       +  YG  LV + + S   +        +T  +   L +   +I +G  AAS
Sbjct: 959  TIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAAS 1018

Query: 420  RLFELTD-------------RKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKN 466
             L+ + D             R   I  +      P   ++  K++ FSYP+  +V+I+KN
Sbjct: 1019 WLYRILDESDDNKESVDSGSRSADIIISGNTNSVP---LISIKNLRFSYPSAQTVEIYKN 1075

Query: 467  LNFKIAPGS-SVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIG 525
            +   +     ++ IVG SG GKST+  LL + Y     +I ID  D+ + +   LR+ I 
Sbjct: 1076 ITLHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQIS 1135

Query: 526  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTL 585
            +V+Q P L  GT+RDN+ YG     ++ EI  V K    + FI   P   D+ I ++  L
Sbjct: 1136 VVEQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--L 1193

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            +SGGQ QR+ IARAL++KPTILILDE TSALD  S   IN    +L+K+   T+++I   
Sbjct: 1194 VSGGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVIT 1249

Query: 646  LS-TIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
             S  +  + N + +  DG + E G F +L  N  S L +++NE
Sbjct: 1250 HSKQMMEACNSLAVIKDGRLAEQGNFAELMKN-NSELRRIINE 1291

 Score =  172 bits (437), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 135/514 (26%), Positives = 238/514 (46%), Gaps = 34/514 (6%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKA-- 252
           L ER    +R  ++ + L +  E++D H       +L  D   V+R + +  S   +A  
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCH------DKLLGDFTQVNRCVEELRSSSAEASA 153

Query: 253 -----LICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
                 +  +  +G     S  L++++L   P ++  A +F   I   ++     TG+  
Sbjct: 154 ITFQNFVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAA 213

Query: 308 RVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS-- 365
           ++    ++  + V+ +  +  E+  +   +    Q                S+L  LS  
Sbjct: 214 QLLNWSMNSAQLVKLYCTQAYEIHSFKELVG---QCNDLFIKSCFYVSANTSILRFLSLS 270

Query: 366 -FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            F+    +G+ +V + +LSI D+          G+ +         + +G  A  ++ + 
Sbjct: 271 MFVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDF 330

Query: 425 ---TDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVG 481
              + R PS+ P          G + F+++SF+YPTRP   + K+++    PG S  I+G
Sbjct: 331 ISFSQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIG 390

Query: 482 PSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 541
            SG GKST+A LLL++YN   G+I I + ++ K+N   L  +I +V+Q   L + T+R+N
Sbjct: 391 KSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNN 450

Query: 542 ITYGLTYTPTKEE---------IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQ 592
           +  G++ +  K E         ++   +       I + P+  DT+IG+ G  LSGGQ+Q
Sbjct: 451 LLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQ 510

Query: 593 RIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRS 652
           R+AIARA IK  ++LILDEA SALD+     I     +    K  T I + H LS +   
Sbjct: 511 RVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGK--TTIILTHDLSQLDYD 568

Query: 653 ENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
           + + V   DG V E G  + L  +  +  S+L +
Sbjct: 569 DFLYVF-EDGEVKESGYQQALLQDEKTIFSKLYD 601

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 130/448 (29%), Positives = 214/448 (47%), Gaps = 35/448 (7%)

Query: 252 ALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTS------KDLQEATGQ 305
           +++CG++      S +       + FT  +L+S  +F   IR T+      K+  +A  +
Sbjct: 272 SVVCGILTYQFGASFAG------ITFTTMLLYS--IF--TIRTTAWRTRFRKEANKADNK 321

Query: 306 LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS 365
              VA + L   + V+ F  E    ++Y+ ++                     SL+   +
Sbjct: 322 GASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLNSGQSLIFTTA 381

Query: 366 FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
              ++  G   V+   L++GDL             +  L + Y E+ Q       LF+L 
Sbjct: 382 LTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLR 441

Query: 426 DRK---------PSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSS 476
             +          SIS + G    P    ++F++V+F Y  +   +I KN +F I  G  
Sbjct: 442 KNQVKIQNCSQPKSISKSDG----PFE--IKFENVTFGYDGQR--KILKNASFTIPAGMK 493

Query: 477 VCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSG 536
             I GPSG GKST+  L+ R+Y+P  G ++++  D+ + +   LR+ IG+V Q+  L + 
Sbjct: 494 TAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFND 553

Query: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAI 596
           TI +N+ +G     + EEI  V  +    + I K P    T++G RG ++SGG+KQR+AI
Sbjct: 554 TIWENVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAI 612

Query: 597 ARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVI 656
           AR L+K   I+  DEATSALD  +E ++  T      S   T + IAHRL TI  ++ +I
Sbjct: 613 ARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKII 672

Query: 657 VLGHDGSVVEMGKFKKLYANPTSALSQL 684
           VL  +G+V E G  ++L A   S   +L
Sbjct: 673 VL-EEGTVREEGTHQELLARENSLYKEL 699

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  171 bits (434), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 140/510 (27%), Positives = 246/510 (48%), Gaps = 21/510 (4%)

Query: 176  VALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGS 233
            V++  GC     +FIL  + SE  +  LR   + +  +QD  +F  D +K  ++ + + +
Sbjct: 799  VSVTDGCFTFLKKFIL-SVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILN 857

Query: 234  DAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIR 293
            D   +   ++  +S     +    +G+        +LS++ +   P  +    ++G  ++
Sbjct: 858  DLRDLRYLVSGFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQ 917

Query: 294  NTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXX 353
                D + A  +L     E + GIKTV+    E +  ++Y +    +             
Sbjct: 918  KYETDYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGF 977

Query: 354  XXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT---AFMLYTEYTGNAVFGLSTFYSE 410
                 + L       +  YG  LV+  + +  +L      +++T  T +A+      +S 
Sbjct: 978  GVALSNALVIGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFS- 1036

Query: 411  IMQGAGAASRLFE-LTDRKPSISPTAGHKYKP-----HRG-VVEFKDVSFSYPTRPSVQI 463
              +G  AA+ +F  L  R   +S     + +P     H   ++  +D++F+YP+   V++
Sbjct: 1037 --RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEV 1094

Query: 464  FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
            +K L+  I  G ++ IVG SG GKST+ L+L   Y  +  T+ IDD DI K N  SLR+H
Sbjct: 1095 YKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKH 1154

Query: 524  IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
            I +V+Q+     G+IRDN+ YGL    T  +I  V       +F+ + P   +T I +  
Sbjct: 1155 ISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDT-- 1212

Query: 584  TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIA 643
             L+SGGQ QRI+I RAL+++P +LILDE TS+LD ++  AI    G  +    +T I I 
Sbjct: 1213 NLISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITTIVIT 1270

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
            H  + + +S N I+   +G + E G F++L
Sbjct: 1271 HN-TQMMKSCNRILFFKNGRISEEGTFQEL 1299

 Score =  125 bits (315), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 128/550 (23%), Positives = 232/550 (42%), Gaps = 64/550 (11%)

Query: 182 CAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRS 241
           C A    ++LL    ER   R+R  ++   L +   ++D ++       L  D   + R 
Sbjct: 92  CWATLSSWMLL---GERQGFRVRRRLLGAYLSKTMAWYDTNE------NLEGDFTQIHRG 142

Query: 242 MTQKVSDGVKA----LICGVVGVGMMCS---LSPQLSILLLFFTPPVLFSASVFGKQIRN 294
           + +  S   ++     +  V  V ++ +    S  L++++L  TP ++  A +F K +  
Sbjct: 143 VEELRSSAAESSAVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEK 202

Query: 295 TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
            ++     T     +    +   + ++ F  E  EL +++++++   +            
Sbjct: 203 YTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAAN 262

Query: 355 XXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNAVFGLSTFYSEIMQ 413
                 L  + F+    +G+ ++ + +L+ G  +T F        +A   L T  +  +Q
Sbjct: 263 QASLRGLSLIMFVQGFWFGNTMIKRGKLNSGQVITCF--------SACILLGTTLNNTLQ 314

Query: 414 -------GAGAASRLFELTDRKPSI-------------SPTAGHKYKP-HRGVVEFKDVS 452
                  G  A  ++  + + +                SP +G    P     + F++VS
Sbjct: 315 HIVIMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVS 374

Query: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDI 512
           FSYP+RP+     N++    P     IVG SG GKST++ LLL+ Y+   GTI +   DI
Sbjct: 375 FSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDI 434

Query: 513 TKMNCKSLRRHIGIVQQEPVLMSG--------TIRDNITYGLTYTPTKEEIRSVAKQCFC 564
                  L  +I +V+Q   L +         T +D+          +  I+   +    
Sbjct: 435 RATKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDD-------NKNEASIKRACQMALL 487

Query: 565 HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              +   P+   TVIGS G  LSGGQ+QR+A+ARA+++   +LILDE+ SALD+     +
Sbjct: 488 EKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLL 547

Query: 625 NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
                +    K  T I + H LS I   ++ + L  DG V E G  + L +  +   ++L
Sbjct: 548 MEVIRNWRAGK--TTIILTHELSHI-LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTEL 604

Query: 685 LNERAAPGPS 694
            N      PS
Sbjct: 605 HNAVIPSDPS 614

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 139/241 (57%), Gaps = 4/241 (1%)

Query: 444 GVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTG 503
           G +EF+DVSF+YPTRP   + KN++ KI  G++  IVG SG GKST+A LLL+ Y   TG
Sbjct: 355 GDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTG 414

Query: 504 TIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
            I   + +I  ++   L  +I +V+Q   L +GT++DN+T    Y     E++   +   
Sbjct: 415 EIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTIVNKYASCT-EVKQACQFAL 473

Query: 564 CHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGA 623
            +  +   PN  DT++G  G  LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S   
Sbjct: 474 LNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSREL 533

Query: 624 INYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
           I     H  K K  T I + H  + I+  E V ++  +G+VVE G    L  NP S  +Q
Sbjct: 534 IVEAIRHWRKGK--TTIILTHEYTQIKDDEYVYLMS-EGTVVESGFKYDLLENPDSYFAQ 590

Query: 684 L 684
           L
Sbjct: 591 L 591

 Score =  151 bits (382), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 131/505 (25%), Positives = 243/505 (48%), Gaps = 23/505 (4%)

Query: 184  ANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD--NHKVGDLISRLGSDAYVVSRS 241
            + F +  +L   SE  + RLR   + K   +  ++F    +   +L S + +D   + R 
Sbjct: 761  STFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDL-RG 819

Query: 242  MTQKVSDGVKALICGVVGVGMMCSL--SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDL 299
            +  +    +  L+  V  +G++ +L    +LS++ +   P  +  + ++G  ++      
Sbjct: 820  LASEFLSAITTLVF-VASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAY 878

Query: 300  QEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            +    +L     E +  +KT++    + +    +   +  +  V               +
Sbjct: 879  KTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTN 938

Query: 360  LLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
             L  +    +  +G  LV+Q + S+  +        ++      L     EI +G  AA+
Sbjct: 939  ALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAAT 998

Query: 420  RLFELTDRKPSIS-----PTAGHKY---KPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKI 471
             +F++ +   S+      P+    +     +R  ++  ++SF++ + P  +IF +L+ +I
Sbjct: 999  YIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCEI 1058

Query: 472  APGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEP 531
                +V IVG SG GKST++LLL R Y   +G + I   DI K +  +LRR I IV+Q+P
Sbjct: 1059 CLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKP 1118

Query: 532  VLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQK 591
                GT+R+N+ YGL    +  E+RSV K     +F+   PN  +T +     L+SGGQ 
Sbjct: 1119 KFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQA 1176

Query: 592  QRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS--KSMTIISIAHRLSTI 649
            QR++IAR L+++P I+ILDE TSALD  +  AI      L+++  K++T+I I H    +
Sbjct: 1177 QRLSIARTLLRQPKIIILDECTSALDAANSFAI----AELIRTVLKNVTVIVITHSEQLM 1232

Query: 650  RRSENVIVLGHDGSVVEMGKFKKLY 674
            +  + V+VL   G V E G + +L+
Sbjct: 1233 QICDRVLVL-KKGKVKEEGSYAELF 1256

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 130/510 (25%), Positives = 241/510 (47%), Gaps = 29/510 (5%)

Query: 185  NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFF--DNHKVGDLISRLGSDAYVVSRSM 242
            NF +  +L   SE  +  LR  +++    +  E++   ++K  ++ +   +D   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 243  TQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEA 302
            T+ +S     +   ++G+    +   +LS++ +   P ++  + ++G  ++N     + A
Sbjct: 799  TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSA 858

Query: 303  TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLG 362
               L  +  E ++ IKT++      + L  Y+   + + ++               + + 
Sbjct: 859  VADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTIT 918

Query: 363  DLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYS------EIMQGAG 416
                  +  YG  LVL      G+ T+  ++  +T   +F ++T  S      ++ +G  
Sbjct: 919  TCIQSILYYYGLKLVLT-----GEYTSKTMFQTFTL-VLFTVTTCNSLVSQIPDVSRGQR 972

Query: 417  AASRLFELTDRKPSISPTAGHKYK----PHRG----VVEFKDVSFSYPTRPSVQIFKNLN 468
            AAS +  + D         G   +     H      ++E ++++F YP  P V ++++LN
Sbjct: 973  AASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQDLN 1032

Query: 469  FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQ 528
             KI  G ++ +VG SG GKST+  LL + Y+     I+I+  DI   +   LR  I +V+
Sbjct: 1033 LKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVE 1092

Query: 529  QEPVLMSGTIRDNITYGLTY-TPTKE-EIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLL 586
            Q+P L  GTIR+NITYG++   P  E E++ + +    H F+   P   DTV+     LL
Sbjct: 1093 QKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDI--GLL 1150

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIA--H 644
            SGGQ QR+ I R L++KP +LILDE TS+LD ++   +      L       I++I   H
Sbjct: 1151 SGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDILTIVITH 1210

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
                ++    ++VL   G VVE G+F  L+
Sbjct: 1211 NRQMMQCCSRLVVLDV-GRVVEDGQFDDLH 1239

 Score =  151 bits (382), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 130/511 (25%), Positives = 243/511 (47%), Gaps = 46/511 (9%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI 254
           L ER   R+R+ ++++ L +  E++D      L   L  D   ++R M +  S   +A  
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNRCMEELRSGSAEASA 146

Query: 255 CG----VVGVGMMC---SLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
                 V  + ++C     S QL++++L  +P ++  A+ F + I+  +    + T    
Sbjct: 147 VTYQNCVAIIALICVSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 308 RVAEEQLSGIKTVQSFVAEGNELSRYNVAI---RDIFQVGXXXXXXXXXXXXXXSLLGDL 364
            +    +   +TV+    +  E+ ++   +    D F                 + +G L
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYF---------IRTSLFTAANIGIL 257

Query: 365 SFLTV------LAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNAVFGLSTFYSEIMQ-GAG 416
            FLT+        +GS ++ + +L+I D +T F  Y+     ++   +  +   +Q G  
Sbjct: 258 RFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQV 315

Query: 417 AASRLFELTDRKPSI---SPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAP 473
           A +++ +  +  P +   + T+      H  +    +++F+YP+RP+  + KN++ KI  
Sbjct: 316 ALAKIQKFINESPELPSKTLTSSGLVYSHVDI-SIDNLTFAYPSRPTENVLKNVSLKIKS 374

Query: 474 GSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVL 533
             +  IVG SG GKSTI  L++++Y    G I++ D+DI  +    L ++I +V+Q   L
Sbjct: 375 ARTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTL 434

Query: 534 MSGTIRDNITYGLTYTPTKEE---IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQ 590
            + T+++NI  G  YT        + S+       + I+  P+  +T +G+ G  LSGGQ
Sbjct: 435 FNDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQ 494

Query: 591 KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIR 650
           +QR+A+ARA ++   ILILDEA SALD+     +      + ++K  T I + H L+ I 
Sbjct: 495 QQRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQIN 552

Query: 651 RSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
            ++  I L  +  + E G FKK   N  + L
Sbjct: 553 DND-YIYLFENNEIKENG-FKKTLMNDENTL 581

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 163/573 (28%), Positives = 259/573 (45%), Gaps = 84/573 (14%)

Query: 153  SDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTL 212
             D F+ + P F + LY F  FF+  L     + F     + +LS + +  LRA  +K+ L
Sbjct: 955  EDKFKNRAPSFYMGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSKWL-NLRA--VKRIL 1008

Query: 213  HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-P 268
            H    + D   +G +++R   D    + S+  ++++ V+ L+     +VGV +MC +  P
Sbjct: 1009 HTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRMLLYQFANIVGVCIMCIIYLP 1064

Query: 269  QLSILLLFFTPPVLFSASVF-GKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSF 323
              +I +     P LF   V      +++ ++++  EA  +  +     E L G+ T++S+
Sbjct: 1065 WFAIAI-----PFLFVGFVLIADHYQSSGREIKRLEAIQRSFVYNNFNEVLGGMDTIKSY 1119

Query: 324  VAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ---- 379
             +E   +++ +  I  + + G                     FL V+A    L++     
Sbjct: 1120 RSENRFIAKSDFLIDKMNEAGYLVVAVQRWVAI---------FLDVIAVCFALIITLLCV 1170

Query: 380  ------SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRK 428
                  S  S+G L  ++L      N V    T     M  A      A     E   RK
Sbjct: 1171 TRAFPISAASVGVLLTYVLQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRK 1230

Query: 429  PSISPTAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGK 487
            P +SP       P +G + F++V FSY P  P+V   KNL+  I  G  + I G +G GK
Sbjct: 1231 PEVSPPEEW---PTKGEIHFENVDFSYRPGLPTV--LKNLSLDIKSGEKIGICGRTGAGK 1285

Query: 488  STIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN------ 541
            STI   L R    S+G ++IDD DI+ +    LRR + I+ Q+PVL  GTIR N      
Sbjct: 1286 STIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNE 1345

Query: 542  ----------ITYGLTYTPTKEEIRSVA-KQCFCHNFITKFPNTYDTVIGSRGTLLSGGQ 590
                      +  G        EI++    +   H+ + KF    D ++   G   S G+
Sbjct: 1346 HQDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGE 1403

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINY----TFGHLMKSKSMTIISIAHRL 646
            +Q +A+ RAL+++  ILILDEATS++D E++G I       FGH       TI+ IAHRL
Sbjct: 1404 RQLLALTRALVRQARILILDEATSSVDYETDGKIQARIVEEFGHC------TILCIAHRL 1457

Query: 647  STIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
             TI   + ++VL   G V E    K L+A   S
Sbjct: 1458 KTILTYDRILVL-EKGEVAEFDTPKTLFAQEDS 1489

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 128/257 (49%), Gaps = 27/257 (10%)

Query: 430 SISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489
           +I  TA  K K  + ++E KD     P       F +LNF+I  G  + +VGP G GK++
Sbjct: 621 AIDKTAELKLK--KDLMEDKDAIEKIPFNG----FHDLNFEIKKGEFIIMVGPIGTGKTS 674

Query: 490 IALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
           +      + N  +G I I+  D+             ++   P + + +++DNI +G  Y 
Sbjct: 675 LLNAFAGFMNKVSGRIQING-DL-------------LLCGYPWIQNASVKDNIIFGSPYN 720

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILIL 609
             K +   V + C   + +   P    T IG RG  LSGGQK RI +AR++ K+  I + 
Sbjct: 721 KAKYD--EVIRVCSLKSDLDILPAGDLTEIGERGITLSGGQKARINLARSVYKQKDIYLF 778

Query: 610 DEATSALDVE-SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           D+  SA+D    +  ++  F  L+K K  T I   H+LS + R+  VIVLG+DGS  ++G
Sbjct: 779 DDVLSAVDSRVGKHIMDECFLGLLKDK--TRILATHQLSLLERASRVIVLGNDGS-FDIG 835

Query: 669 KFKKLYANPTSALSQLL 685
             ++L    +S L  LL
Sbjct: 836 TVEEL-KQRSSTLVNLL 851

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  160 bits (405), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 136/520 (26%), Positives = 235/520 (45%), Gaps = 36/520 (6%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK---- 223
            + FL  FT++    C  N+ R +           RLRA   K   +++  +F++ +    
Sbjct: 789  FTFLKCFTLS---KCGENWIRAL-----------RLRA--FKNISNRELAWFNSEQNSTS 832

Query: 224  -VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVL 282
             V  L+     D   ++      V+  V    CG++      +   +LS++ +   P  +
Sbjct: 833  NVSSLVINDLRDLRALASEFLAAVTTLVVVSFCGLIWA---LASGWKLSLVCISLIPAFI 889

Query: 283  FSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ 342
                 +G  ++    + + A   +       +  IKT++    E   +  Y V       
Sbjct: 890  LFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKL 949

Query: 343  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVF 402
             G              + L  ++   +L YG  LV+  + S   +   +    +T     
Sbjct: 950  AGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCM 1009

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRKPSISPT--AGHKYKPHRG-----VVEFKDVSFSY 455
             L     EI +G  AA+ LF + D +   +     G      RG     ++  KD+ FSY
Sbjct: 1010 SLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSY 1069

Query: 456  PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKM 515
                +  +++ LN  +  G +V +VG SG GKST+  L+ R Y   +G+I  D  D+ + 
Sbjct: 1070 SFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEW 1129

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY 575
               +LR+ I +V+Q P L  G+I DN+TYGL+ +  + EIR + +     +F+   P   
Sbjct: 1130 EEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGL 1189

Query: 576  DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
             + I +   +LSGGQ QR+AI RAL++KP +L+LDE TSALD +  G I   F     S+
Sbjct: 1190 QSFIDT--DVLSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQ-HGFIMSEFVR-QGSQ 1245

Query: 636  SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYA 675
            S T + + H    + R+ N I+   +G+++E G F++LY+
Sbjct: 1246 STTTLVLTHS-EQMMRACNRILTFANGNIIEDGSFERLYS 1284

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 130/507 (25%), Positives = 223/507 (43%), Gaps = 27/507 (5%)

Query: 195 LSERVVARLRAHVIKKTLHQDAEFFD-NHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
           L ER   RLR  +++  L +   ++D N ++    ++L      +  S  +  +   + +
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDFTQLNRCVEELRSSSAESSAIVFQNV 158

Query: 254 ICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQ 313
           +     +G     S  L+++++  +P V+  A  F +++   +K     T          
Sbjct: 159 VTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWS 218

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
           L   K V+    +  EL+R+   ++   Q                  L    F+    YG
Sbjct: 219 LDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYG 278

Query: 374 SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ------GAGAASRLFELTDR 427
           +     S+++IG L    + T ++ + V   ST  S + Q      GA    ++    + 
Sbjct: 279 N-----SRINIGKLKPGDVVTCFS-SCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNS 332

Query: 428 KPSISPTAGHKYK---------PHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
           + + S +  +K +           R  + F++V F+YPTRP   + K ++     G +  
Sbjct: 333 RDA-SESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTF 391

Query: 479 IVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTI 538
           ++G SG GKSTI  LLL +Y   +GTI ++ QD+ ++N   L R+I +V+Q   L + T+
Sbjct: 392 VIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETL 451

Query: 539 RDNITYGLTYTPTKE-EIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIA 597
            +N+T G       E  ++   +     N I       +T IG  G  LSGG++QR+A+A
Sbjct: 452 ANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALA 511

Query: 598 RALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIV 657
           RA  +   ILILDEA SA D   +  +          K  T I + H LS I  ++ V V
Sbjct: 512 RAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADK--TTIILTHELSDILDTDYVYV 569

Query: 658 LGHDGSVVEMGKFKKLYANPTSALSQL 684
           +  DG + E G    L +NP S  S L
Sbjct: 570 MS-DGQIREHGYKSGLLSNPKSEFSNL 595

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  154 bits (390), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 144/549 (26%), Positives = 254/549 (46%), Gaps = 58/549 (10%)

Query: 171  LSFFTVALLIGCA-ANFGRFILL--RILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + + ++  LIG A A  G   +L    L  +   ++   ++KK +H    FFD+  +G +
Sbjct: 1106 MYYLSIYFLIGIAQALLGSLKVLINFFLGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRI 1165

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSILLL-----FFTPPV 281
            ++R   D   + + +   V     +L+  V  + ++  ++PQ LS+ +L     +     
Sbjct: 1166 MNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFITPQFLSVAILVTGLYYLIGYF 1225

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG----NELSRYNVAI 337
              +AS   K+  + +K        + +   E L G+ T+++F  EG      LS+ +   
Sbjct: 1226 YLAASREFKRFDSITK------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDENN 1279

Query: 338  RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQLSIGDLTAFMLYTEY 396
            R  F +               +L+       V   GS+++     +  G     + Y   
Sbjct: 1280 RPFFYLWVANRWLSFRIDMVGALV-------VFGSGSFIIWNIKNIDAGMAGISLTYAIS 1332

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTAGHKYK-PHRGVVEFKDVSF 453
                   L   YS +     +  RL E    +++P    T     + P  G +E  D+S 
Sbjct: 1333 FTEGALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSL 1392

Query: 454  SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDIT 513
             Y      ++ KN+ F +AP + + IVG +G GKSTI   L R+ +P TG I ID+ DIT
Sbjct: 1393 RYAEGLP-RVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDIT 1451

Query: 514  KMNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YGL-----TYTPTK------EEIRS-VAK 560
             +N   LRR I I+ Q+P L +GTI+ N+  YG       +T  +      E++ S +  
Sbjct: 1452 SINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIET 1511

Query: 561  QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
            +      + KF N  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S
Sbjct: 1512 ESISSQNVNKFLN-LNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNS 1570

Query: 621  EGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSA 680
            +  I  T     +  S TI++IAHRL ++   + ++V+       + G+ K+ Y +P S 
Sbjct: 1571 DAKIQETIRK--EFNSSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHPYSL 1620

Query: 681  LSQLLNERA 689
               LLN+++
Sbjct: 1621 ---LLNKKS 1626

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 136/549 (24%), Positives = 240/549 (43%), Gaps = 78/549 (14%)

Query: 170 FLSFFTVALLIGCAANFGRFILLRI----LSERVVARLRAHVIKKTLHQDAEFFDNHKV- 224
           FLS   V++  G A   GR + +RI    +SE     LR  V  K+    AE  D   V 
Sbjct: 412 FLSRILVSICEGQALFLGRRVCIRIKSIVISEIYNKALRRKVSVKSNKVSAEDLDPQDVN 471

Query: 225 -------------------GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 265
                              G +I+ +  DA+ VS  +   +   V+A +  ++ + ++  
Sbjct: 472 EQKHIDGDEESSDPSSANLGGIINLMAVDAFKVSE-VCAYLFAFVEATVMAIISLTLLYR 530

Query: 266 L--SPQL--SILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT--RVAE--EQLSGI 317
           L  S  +  +I++L   P   + A++ GK        +Q+AT  +T  R+ +  E L  I
Sbjct: 531 LIGSSAIIGTIVILIAAPANYYFATLLGK--------IQKATLLVTDKRIQKLNESLQAI 582

Query: 318 KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVLAYGSY 375
           + ++ F  E N    +  +I D+ +                S +  +  S +T  A+  Y
Sbjct: 583 RIIKFFSWEDN----FEKSINDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAFAFY 638

Query: 376 LVLQSQLSIGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
           + +Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+      +  +  
Sbjct: 639 IYVQKEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRI------RDFLLE 691

Query: 434 TAGHKYK-----PHRGVVEFKDVSFSYPTRPSVQIFK----NLNFKIAPGSSVCIVGPSG 484
           T   KY      P    +EFK+ + S+ +  S Q FK    N++FKI  G    ++GP+G
Sbjct: 692 TDTAKYDQLTVAPQGDQLEFKNTTVSWDS--SAQDFKLKDLNIDFKI--GKLNVVIGPTG 747

Query: 485 RGKSTIALLLLRYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 541
            GK+++ + LL       G I++   D ++   ++       I    Q   L++ T+R+N
Sbjct: 748 SGKTSLLMALLGEMKIMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNN 807

Query: 542 ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALI 601
           I +   Y   +    SV + C              T IG +G  LSGGQKQR+++ARA+ 
Sbjct: 808 ILFNSPYNEAR--YTSVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMY 865

Query: 602 KKPTILILDEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLG 659
                ++LD+  SA+D  +   I  N   G LM  +  T I ++H ++   ++ +++V+ 
Sbjct: 866 SNSRHILLDDCLSAVDSHTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVIL 923

Query: 660 HDGSVVEMG 668
            DG V + G
Sbjct: 924 EDGKVKDQG 932

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 155/564 (27%), Positives = 252/564 (44%), Gaps = 66/564 (11%)

Query: 153  SDFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTL 212
             D F+ +   F + LY   SFF  A   G      +F LL  +  R    L    + + L
Sbjct: 940  EDKFKNRSTSFYMGLY---SFFVFA---GYLFTSSQFTLLCAIGIRASKWLNLKAVHRIL 993

Query: 213  HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-P 268
            H    + D   +G +++R   D    + S+  ++++ ++ ++     +VGV +MC +  P
Sbjct: 994  HTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLP 1049

Query: 269  QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFV 324
              +I +    P +    ++     ++T ++++  EA  +  +     E L G+ T++S+ 
Sbjct: 1050 WFAIAI----PFLFIGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYG 1105

Query: 325  AEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGD-LSFLTVLAYGSYLVLQSQLS 383
            +E   L++ +  I  + + G               L+    + +  L   +     S +S
Sbjct: 1106 SEERFLAKSDYLINKMNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVS 1165

Query: 384  IGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTAGHK 438
            +G L  ++L      N V    T     M  A      A+ L  E   R+P +SP     
Sbjct: 1166 VGVLLTYVLQLPGLLNGVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPPENW- 1224

Query: 439  YKPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
              P  G +EFK V FSY  RP + I  K+L+  I  G  + I G +G GKSTI   L R 
Sbjct: 1225 --PSEGKIEFKHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRL 1280

Query: 498  YNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE--- 554
               S G I+ID+ DI+K+    LRR + I+ Q+PVL  GTIR N+       P  E    
Sbjct: 1281 NEISQGEILIDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNL------DPFNEHDDD 1334

Query: 555  ------IRSVAKQCFCHNFITK------------FPNTYDTVIGSRGTLLSGGQKQRIAI 596
                  +R  A +    N I              F    D ++   G   S G++Q +A+
Sbjct: 1335 LLWDSLVRGGAIERAALNKIKNQKVDKDGTHADMFKFHLDQLVEEEGANFSLGERQLLAL 1394

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS-KSMTIISIAHRLSTIRRSENV 655
             RAL+++  +LILDEATS++D E++G I      ++K     TI+ IAHRL+TI   + +
Sbjct: 1395 TRALVRQAKVLILDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRI 1451

Query: 656  IVLGHDGSVVEMGKFKKLYANPTS 679
            +VL   G V E  K K L+    S
Sbjct: 1452 LVL-EKGEVAEFEKPKVLFDQEDS 1474

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 102/206 (49%), Gaps = 20/206 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F ++   I  G  + +VGP G GK++    L  + N + G I ++  D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
             ++   P + + T+RDNI +G  Y   K E   V + C     +   P    T IG RG
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKSMTIISI 642
             LSGGQK RI +AR + KK  I + D+  SA+D    +  ++  F  L+K++  T I  
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNE--TRILA 788

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMG 668
            H+LS + R+  VIVLG DGS  E+G
Sbjct: 789 THQLSLLERASRVIVLGTDGS-FEIG 813

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 131/510 (25%), Positives = 241/510 (47%), Gaps = 32/510 (6%)

Query: 183  AANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFD--NHKVGDLISRLGSDAYVVSR 240
            A  F +  +L    E  +  LR +  +  + +D  +F   N+   ++ S + +D     R
Sbjct: 787  AFTFLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----R 842

Query: 241  SMTQKVSDGVKALICGVVGVGMMCSL------SPQLSILLLFFTPPVLFSASVFGKQIRN 294
             +    S+ + AL    + V  +C L        +LS++ +   P  +  + ++G  ++N
Sbjct: 843  DLRALASEFLAAL--STLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQN 900

Query: 295  TSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
                 +    +L     + +  +KT++    E N+++R +  + ++   G          
Sbjct: 901  YEARYKTCIAELENELYKAIRCMKTIKCLQME-NKVAR-SYEMLEVTSKGAARKRAMGTG 958

Query: 355  XXXXSLLGDLSFLT---VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEI 411
                S    L+F+T   +L +G  LV+  + + G +   +    +T      L +   EI
Sbjct: 959  FGVASS-NALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEI 1017

Query: 412  MQGAGAASRLFEL-TDRKPSISPTAGHKYKP------HRGVVEFKDVSFSYPTRPSVQIF 464
             +G  AA+ LF+L  +     +     ++ P       + ++  K + FSY    +  ++
Sbjct: 1018 SRGQRAATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVY 1077

Query: 465  KNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHI 524
            KNL+ K+  G  V ++G SG GKST+  LL R Y    G+I ID  DI + + K+LR  I
Sbjct: 1078 KNLSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCI 1137

Query: 525  GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGT 584
             +V+Q+P+  SG+I +N+TYGL    + EE+  +        F+   P    +VI ++  
Sbjct: 1138 AVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ-- 1195

Query: 585  LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAH 644
            LLSGGQ QR+AI RAL++KP +L+LDE TSALD      ++    H +   +  +++ + 
Sbjct: 1196 LLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHTTTLVVTHSE 1255

Query: 645  RLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
            ++    RS + I+  + G +VE G    L+
Sbjct: 1256 QM---MRSCHRILTFNKGEIVEEGSIDNLF 1282

 Score =  148 bits (373), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 154/597 (25%), Positives = 257/597 (43%), Gaps = 51/597 (8%)

Query: 114 RDWKXXXXXXXXXXXSCSIGMSI-PKVIGIVLDTLKTSSGSDFFELKIPIFSL-----PL 167
           RDW             CS+   I P V  I++       G+ F  L+ P+         L
Sbjct: 24  RDWWLLMIISI-----CSVAYGIVPAVTSILM-------GAVFNLLQKPVIQQFDSVNTL 71

Query: 168 YEFLSFFTVALLIGCAANFGRFILLRI-----LSERVVARLRAHVIKKTLHQDAEFFD-N 221
              L+  T+A+LI   A+   F  L I     L ER   RLR  +++    +   ++D N
Sbjct: 72  MRDLTIRTMAILITGIASIP-FCWLSIYAWMSLGERQGFRLRRKLLRSYFEKSMAWYDIN 130

Query: 222 HKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPV 281
            ++    ++L      +  S  +  +   + L+  +  +G     S  L+++++  +P V
Sbjct: 131 EQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLTLVIMANSPLV 190

Query: 282 LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
           +  A    + +    K     T     +    L+  K V+    +  E++++  ++    
Sbjct: 191 IGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKCR 250

Query: 342 QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD-LTAFMLYTEYTGNA 400
                              L    F+    YG+  +    L  GD +T F        + 
Sbjct: 251 MNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCF-------SSC 303

Query: 401 VFGLSTFYSEIMQ------GAGAASRLFEL--TDRKPSISPTAGHKYKP---HRGVVEFK 449
           +   ST  S + Q      GA    ++ E   +D            + P    +  + F+
Sbjct: 304 ILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFE 363

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDD 509
           +VSF+YP+R    + KNLN K+  G    IVG SG GKSTI+ LLL+ Y P +G I ++D
Sbjct: 364 NVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVND 423

Query: 510 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNF 567
            DI ++N + L R I +V+Q   L   +I++NI   LT    +++ R     +       
Sbjct: 424 VDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQ--LTSDEHRDDGRLSQACQAAMLEGV 481

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           I       DT+IGS G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  +   
Sbjct: 482 IRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEA 541

Query: 628 FGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
                K +  T I + H L+ I   ++ ++L  DG+V+E G+   L ++ TS  S L
Sbjct: 542 IRFWRKGR--TTIILTHELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSKFSLL 595

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 140/544 (25%), Positives = 255/544 (46%), Gaps = 64/544 (11%)

Query: 173  FFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 229
            + ++  LIG   +     + +L  +L  R   ++   ++ +TLH    FFD   +G +++
Sbjct: 1108 YLSIYFLIGLTQSLLAASKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMN 1167

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSILLL-----FFTPPVLF 283
            R   D   V + +T  +      L+  +  + ++  ++PQ LS+ +L     +       
Sbjct: 1168 RFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYM 1227

Query: 284  SASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
            +AS   K+  + SK        + +   E L G+ T++++   G+E SR+   + ++ ++
Sbjct: 1228 AASRELKRFESISK------SPIYQHFSETLVGVATIRAY---GDE-SRF--MLENLHKI 1275

Query: 344  GXXXXXXXXXXXXXXSL---LGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTE 395
                            L   +  +    +   G +++     + S ++   LT  + +TE
Sbjct: 1276 DENNKPFFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE 1335

Query: 396  YTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKP--SISPTAGHKYKPHRGVVEFKDV 451
                    L  FY+++     +  RL E  +  ++P      T  H   P  G +E KD+
Sbjct: 1336 ----GALWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDL 1391

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQ 510
            S  Y P  P  ++ KN++F + P + + IVG +G GKSTI   + R+ NP +G I IDD 
Sbjct: 1392 SLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDV 1449

Query: 511  DITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEIRS 557
            +I  +N   LRR I I+ Q+P L +GTI+ N+     +T              T+EE+++
Sbjct: 1450 NIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQN 1509

Query: 558  VAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
               Q        KF N  +  I   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D
Sbjct: 1510 NGTQTGTSENANKFLNL-ENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASID 1568

Query: 618  VESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANP 677
              S+  I  T     +    TI++IAHRL ++   + +IV+       + G+ K+ Y +P
Sbjct: 1569 YASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-------DAGEVKE-YDHP 1618

Query: 678  TSAL 681
             S L
Sbjct: 1619 YSLL 1622

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 11/229 (4%)

Query: 446 VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI 505
           + FK+V+ ++         ++LN +  PG+   ++GP+G GK+++ L LL       G I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 506 MIDD----QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
           ++      QD+  ++   L   I    Q   L++ T+R+NI +   Y   +E   +V   
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPYN--EERYNAVIDA 827

Query: 562 CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C     +     +  T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 622 GAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             I  N   G LM  +  T I ++H ++   ++  ++V+  +G V + G
Sbjct: 888 LWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVILENGRVKDQG 934

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  151 bits (381), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 137/500 (27%), Positives = 227/500 (45%), Gaps = 59/500 (11%)

Query: 202  RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
            R+   ++ K LH    F D+  +G +++R   D   V + +T  +     A  C V  + 
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLE---AAFFCLVQCIS 1197

Query: 262  MMCSLSPQLSILLLFFTPPVLFSA-------SVFGKQIRNTSKDLQE----ATGQLTRVA 310
             +        IL+ F TP  LF A        + G    NTS++L+         + +  
Sbjct: 1198 TI--------ILITFITPQFLFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHF 1249

Query: 311  EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL 370
             E L+G+ T+++F   G+E+      +  I +                  +  +  L + 
Sbjct: 1250 SETLTGVATIRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIF 1306

Query: 371  AYGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
              G +++L      S ++   LT  + +TE        L  FYS +     +  RL E  
Sbjct: 1307 GSGVFILLNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYM 1362

Query: 426  D--RKPSISPT-AGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
            D  ++P    T       P  G +E KD+S  Y      ++ K ++F I P + V IVG 
Sbjct: 1363 DVPQEPYNEGTITTSTNWPTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGR 1421

Query: 483  SGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+  P TG+I ID  DIT ++ ++LRR I I+ Q+P L +GTIR N+
Sbjct: 1422 TGAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNL 1481

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHN----------------FITKFPNTYDTVIGSRGTLL 586
                 Y P +E  R + +     +                 + KF N  +  I   G  L
Sbjct: 1482 DPFGKY-PDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLNL-ENEITEGGNNL 1539

Query: 587  SGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRL 646
            S GQKQ + +ARAL++ P +++LDEAT+++D  S+  I  T  ++      T+++IAHRL
Sbjct: 1540 SQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRL 1597

Query: 647  STIRRSENVIVLGHDGSVVE 666
             ++   + ++V+   G V+E
Sbjct: 1598 RSVIDYDKILVMDA-GEVIE 1616

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 107/460 (23%), Positives = 199/460 (43%), Gaps = 30/460 (6%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL---SPQLSILLLFFTP 279
            +G +I+ +  DA+ VS  +   +   ++A++  VV   ++  L   +  + IL++    
Sbjct: 493 NIGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLLGYAAIVGILIVIGMI 551

Query: 280 PVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
           PV F   S+ GK      K     T +  +   E L  I+ ++ F  E N  S     I 
Sbjct: 552 PVNFKLVSLMGKY----QKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSE----ID 603

Query: 339 DIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIG--DLTAFMLYT 394
           +I +                + +  L+   +T  ++  Y+ +Q Q+       TA  L+ 
Sbjct: 604 EIREAEIQMYINKAYAWAFSAFIWFLTPTIVTGASFTVYIYVQKQVLTAPVAFTALALF- 662

Query: 395 EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFS 454
           +     +  LS   S ++Q   +  R+    D + +       K  P    + F++ + +
Sbjct: 663 QLLKQPLDQLSNMLSYVIQSKVSLDRVQNFLDEEDT-QKYNQLKVAPDGNKLAFENATIA 721

Query: 455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI---DDQD 511
           +         K+L+     G    ++GP+G GK+++ L LL      +G I++   D + 
Sbjct: 722 WSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARH 781

Query: 512 ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE-IRSVAKQCFCHNFITK 570
              ++   +   I    Q   L++ T+R+NI   L Y+P  E+  + V   C        
Sbjct: 782 EMLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDFEL 838

Query: 571 FPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTF 628
           F     T IG +G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N   
Sbjct: 839 FDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCIT 898

Query: 629 GHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           G LM+ ++  ++S  H ++   ++  ++V+  +G +   G
Sbjct: 899 GPLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRG 936

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 153/571 (26%), Positives = 247/571 (43%), Gaps = 75/571 (13%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            Y    +FT+      A      IL    + +   +L + +          FF+   +G +
Sbjct: 984  YYLFIYFTLGFASSLANLIQTIILWIFCTIQGSKQLHSSMTSSIFRAPMSFFETTPIGRI 1043

Query: 228  ISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLF 283
            ++R  +D Y    ++ RS +Q   + ++     VV    +CS + Q     +F   P+ F
Sbjct: 1044 LNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVV----ICSTTWQF----IFLIIPMAF 1095

Query: 284  SASVFGKQIRNTSKDLQEATGQ----LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
                + +    TS++L+         L    +E L G+ T++ F A+ +     N +   
Sbjct: 1096 LYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGF-AQQDRFIHINQS--- 1151

Query: 340  IFQVGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
              +V                L   L FL +++  G+  +   +L  G LTA M+      
Sbjct: 1152 --RVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMI------ 1203

Query: 399  NAVFGLSTFYS-EIMQGAGAASRL-------------FELTDRKPSISPTAGHKYKPH-- 442
                GLS  Y+ ++ Q      R+              E     PS +P      +P   
Sbjct: 1204 ----GLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEE 1259

Query: 443  ---RGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
               +G +EFK+ S  Y  RP +  + KN+N KI P   V IVG +G GKS++ L L R  
Sbjct: 1260 WPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRII 1317

Query: 499  NPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 558
              S+G+I ID  +I ++    LR  + I+ Q+  +  G+IR+NI    T   +++EI + 
Sbjct: 1318 EASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNA 1375

Query: 559  AKQCFCHNFITKF---------------PNTYDTVIGSRGTLLSGGQKQRIAIARALIKK 603
             +       I K                 N  D  I   G+ LS GQ+Q I +ARAL+  
Sbjct: 1376 LEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVP 1435

Query: 604  PTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGS 663
              +LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ +IVL  +G 
Sbjct: 1436 SNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLD-NGE 1492

Query: 664  VVEMGKFKKLYANPTSALSQLLNERAAPGPS 694
            V E  K + L  N  S    L  E     P+
Sbjct: 1493 VAEFDKPEILLTNKNSLFYSLCYESGVLKPN 1523

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 123/252 (48%), Gaps = 20/252 (7%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           + +F +  +P  ++  KN+NF+   G   CIVG  G GKS     +L             
Sbjct: 619 NATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSIL------------- 665

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+  ++  V Q   +M+GT++DNI +G  Y P  E      K C     
Sbjct: 666 -GDLFRVKGFASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDP--EFYEKTIKACALTID 722

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++  P+   T++G +G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I  
Sbjct: 723 LSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQN 782

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
             G     KS T I   +++  +  ++++ +L  +G + E G +  + A   S+LS+L+ 
Sbjct: 783 VLGAKGLLKSKTRILTTNKIPVLSIADSITLL-ENGEITEQGTYFDVMATEGSSLSKLIT 841

Query: 687 ERAAPGPSDQQQ 698
           E      S + +
Sbjct: 842 EYGKKKDSSESE 853

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 141/529 (26%), Positives = 246/529 (46%), Gaps = 51/529 (9%)

Query: 203  LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVG 259
            L  + + + LH    + D   +G +++R   D    + S+  ++++ V+ +   +  +V 
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRLMLFQVGNIVA 1002

Query: 260  VGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATG-QLTRVAE---EQL 314
            V +MC +  P  +I +    P + F   +     ++TS++++     Q + V     E L
Sbjct: 1003 VIVMCIVYLPWFAIAV----PFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVL 1058

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T++S+  +    ++ +  I  + + G               ++  + F  ++A  S
Sbjct: 1059 GGMDTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVA-IIFALIIALLS 1117

Query: 375  Y--LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDR 427
               +   S  S+G L  ++L      N+V    T     M  A      A++L  E   +
Sbjct: 1118 VTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPLEAAYK 1177

Query: 428  KPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGK 487
            KP +SP       P +G + F DV F+Y +   V + K LN  I  G  + I G +G GK
Sbjct: 1178 KPELSPPESW---PSKGEIRFLDVDFAYRSGLPV-VLKGLNLDIKSGEKIGICGRTGAGK 1233

Query: 488  STIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 547
            STI   L R    ++G I+IDD DI+ +    LRR + I+ Q+PVL  GTIR N+     
Sbjct: 1234 STIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSN 1293

Query: 548  YTPT-------------KEEIRSVAKQCF----CHNFITKFPNTYDTVIGSRGTLLSGGQ 590
            Y  +             KE +  V  +       H  + KF    D ++   G+  S G+
Sbjct: 1294 YDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGE 1351

Query: 591  KQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIR 650
            +Q +A+ RAL+++  ILILDEATS++D E++G I      + +  + TI+ IAHRL TI 
Sbjct: 1352 RQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRI--VEEFDNCTILCIAHRLKTIL 1409

Query: 651  RSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQ 699
            + + ++VL   G + E  +  KL+++  S    +  ER+    SD + Q
Sbjct: 1410 QYDRILVL-EKGVIAEFDQPFKLFSDKDSIFRSMC-ERSNITESDFKIQ 1456

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 100/201 (49%), Gaps = 19/201 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F NL+F+I  G  + I GP G GKS++      + N + G I ++      + C      
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNGD---LLFCGY---- 640

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
                  P + + T++DNI +G  +   KE+  +V + C     +   P    T IG RG
Sbjct: 641 -------PWIQNATVKDNILFGSPFI--KEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKSMTIISI 642
             LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     L++ K  T I  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRILA 749

Query: 643 AHRLSTIRRSENVIVLGHDGS 663
            H+LS I +++ VIVLG DGS
Sbjct: 750 THQLSLIEKADRVIVLGTDGS 770

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 148/563 (26%), Positives = 246/563 (43%), Gaps = 60/563 (10%)

Query: 156  FELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F+ + P F + LY   SFF  A  I      G++ +L ++       L    +K+ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMN---GQYTILCVMGIMASKWLNLKAVKRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMMCSLS-PQLS 271
              + D   +G +++R   D    + S+  ++++ ++ L      +VGV +MC +  P  +
Sbjct: 980  MSYIDTTPLGRILNRFTKD----TDSLDNELTESLRLLTSQFANIVGVCVMCIVYLPWFA 1035

Query: 272  ILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELS 331
            I + F     +  A  +    R   +        +     E L G+ T++++ ++   L+
Sbjct: 1036 IAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLA 1095

Query: 332  RYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAF 390
            + +  I  + + G               ++  + + +  L   +     S  S+G L  +
Sbjct: 1096 KSDFLINKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPISAASVGVLLTY 1155

Query: 391  MLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTAGHKYKPHRGV 445
            +L      N +    T     M  A      A+ L  E   RKP ++P       P +G 
Sbjct: 1156 VLQLPGLLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPPESW---PSKGE 1212

Query: 446  VEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
            +  ++V FSY  RP + +  KNLN  I  G  + I G +G GKSTI   L R    S G 
Sbjct: 1213 IVLENVCFSY--RPGLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGK 1270

Query: 505  IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP----TKEEIR---- 556
            I+IDD DI+K+    LRR + I+ Q+PVL  GTIR N+       P    T +E+     
Sbjct: 1271 ILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNL------DPFDERTDDELWDALV 1324

Query: 557  ---SVAKQCF------------CHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALI 601
               ++AK                H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKNDLSEAKLQKPDKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQARI--VEEFGDCTILCIAHRLQTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKKLYANPTSALSQL 684
            G V E      L+    S    +
Sbjct: 1440 GEVAEFDTPWTLFTQENSIFRNM 1462

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 109/219 (49%), Gaps = 20/219 (9%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           + S + FK+LNF+I  G  + I GP G GKS++        N   G++   D  I ++N 
Sbjct: 598 KTSFRGFKDLNFEIKKGEFIMITGPIGTGKSSL-------LNAMAGSMRKTDGKI-EVNG 649

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
             L      +Q  PV      RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 650 DLLMCGYPWIQNAPV------RDNIIFGSPFI--KEKYNEVIRVCSLKADLDILPAGDMT 701

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKS 636
            IG RG  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     ++ +K 
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK- 760

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYA 675
            T I   H+LS I R+  VIVLG DG  V++G   +L A
Sbjct: 761 -TRILATHQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  148 bits (374), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 143/533 (26%), Positives = 240/533 (45%), Gaps = 41/533 (7%)

Query: 180  IGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 237
            +G AA  N    ++L   S R   +L   + K  +     FF+   VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDA 1088

Query: 238  VSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSK 297
            V  S+    S   K+++  +V V ++    P   +  +F     ++  + +    R   +
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQTFYIVLSRELKR 1148

Query: 298  DLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQVGXXXXXXX 351
             +  +   +  +  E L+G   +      + F+    E  +YN+     F+         
Sbjct: 1149 LISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVR 1208

Query: 352  XXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAVFGLSTFYSE 410
                    +L   + LT+    +    + QLS G +   M Y+ E TG+  + + T    
Sbjct: 1209 LQTIGATIVLAT-AMLTLATMNT----KKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVM- 1262

Query: 411  IMQGAGAASRLFE---LTDRKPSISPTAG-HKYKPHRGVVEFKDVSFSYPTRPSVQ-IFK 465
            I     +  R+ E   L     SI+P     K  P RG +EFKD S  Y  R ++  + K
Sbjct: 1263 IETNIVSVERIVEYCELPSEAQSINPEKRPDKNWPSRGSIEFKDYSTKY--RENLDPVLK 1320

Query: 466  NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIG 525
            ++N KI P   V IVG +G GKST++L L R   P+ G I+ID  +I+ +    LR H+ 
Sbjct: 1321 DINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHLA 1380

Query: 526  IVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-------------- 571
            I+ Q+     GT++ N+     Y  +++E++   +       + K               
Sbjct: 1381 IIPQDAQAFEGTVKTNLDPFNRY--SEDELKKAVELAHLKPHLEKMLENEPSDSEESCDI 1438

Query: 572  PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHL 631
             +  D  I   G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  I  T    
Sbjct: 1439 KDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETDKIIQDTIRRE 1498

Query: 632  MKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
             K +  TI++IAHR+ T+  S+ +IVL  +GSV E     KL +N  S    L
Sbjct: 1499 FKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLSNKASIFYSL 1548

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/327 (25%), Positives = 156/327 (47%), Gaps = 44/327 (13%)

Query: 398 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTAGHKYKPHRGVVEFKD 450
            +A++ + +  + I++ + +  RL  F L+D         I P+   +  P   V+E  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLP---VIEMNN 619

Query: 451 VSFSYPTRPSV--------------------QI-FKNLN-FKIAPGSSVCIVGPSGRGKS 488
           ++F + ++ ++                    QI  KN++ F+   G+ VCIVG  G GKS
Sbjct: 620 ITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKS 679

Query: 489 TIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
           T    +L      +G+    +    K+  +S    +    QE  +M+ ++++NI +G  +
Sbjct: 680 TFLKAILGQLPCMSGS---KESIPPKLIIRS--SSLAYCSQESWIMNASVKENILFGHKF 734

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI 608
                ++    K C     +   P+  +T++G +G  LSGGQK R+++ARA+  +  I +
Sbjct: 735 DKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYL 792

Query: 609 LDEATSALDVE-SEGAINYTF-GHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVE 666
           LD+  SA+D E S+  I Y   G     K+ TII   + +S ++ S+ +  L  +G +VE
Sbjct: 793 LDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVE 851

Query: 667 MGKFKKLY--ANPTSALSQLLNERAAP 691
            G +  +    N TS L +LL E  +P
Sbjct: 852 QGNYDSVMNRENSTSKLKKLLEEFDSP 878

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  148 bits (373), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 133/493 (26%), Positives = 219/493 (44%), Gaps = 13/493 (2%)

Query: 201  ARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 260
            ARL   + K  L     FF+   VG +++R  +D Y V   + +  S     +   V  +
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTM 1074

Query: 261  GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
             ++CS++ Q    +L  +   LF    + +  R   +        +    +E L+G+ TV
Sbjct: 1075 IVICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTV 1134

Query: 321  QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 380
            +SF  +   +      I                       +G +  L       + + Q 
Sbjct: 1135 RSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQG 1194

Query: 381  QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS---ISPTAGH 437
            +L+ G L   + Y      ++  +     E+     +  R+ E TD KP    I PT+  
Sbjct: 1195 KLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRP 1254

Query: 438  -KYKPHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
             K  P  G ++F+  S  Y  RP +  I +++N  I P   V IVG +G GKS++ + L 
Sbjct: 1255 PKNWPANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLF 1312

Query: 496  RYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
            R    + G I+IDD  I  +    LR  + I+ Q+  +  GT R+NI     +  T +EI
Sbjct: 1313 RLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPCNKF--TDDEI 1370

Query: 556  RSVAKQCFC-HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             +  +      + +T      +T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+
Sbjct: 1371 WNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATA 1430

Query: 615  ALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
            A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL   G + E      L 
Sbjct: 1431 AIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVLDK-GRIAEFDTPCNLL 1487

Query: 675  ANPTSALSQLLNE 687
             + TS    L NE
Sbjct: 1488 KDETSIFYSLCNE 1500

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 117/239 (48%), Gaps = 20/239 (8%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D ++ +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML------------- 665

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    +L   +  V Q   +M+GTI+DNI +G  Y    E      K C     
Sbjct: 666 -GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKTIKACALSLD 722

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +   P+   T +G RG  LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + Y
Sbjct: 723 LNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKY 782

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLL 685
             G     K+ T I   +++  +  ++++ +L  +G +V+ G + ++ +N  S L +L+
Sbjct: 783 VIGPTGLLKTKTRILTTNKIHVLSVADSITLLD-NGVIVQQGSYDQVNSNKDSPLFKLI 840

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  148 bits (373), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 133/504 (26%), Positives = 233/504 (46%), Gaps = 54/504 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            +++K LH    FFD+  +G +++R   D   V + +T        +L+  +  V ++  +
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +PQ  I+ +       F    +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDE 1301

Query: 327  G----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-SQ 381
                   L + +   R  F +                L+G L    V   G +++L    
Sbjct: 1302 SRFIQENLHKIDENNRPFFYLWVANRWLAMRI----DLIGSL---VVFGAGVFILLNIDH 1354

Query: 382  LSIG----DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE--LTDRKPSISP-- 433
            +  G     LT  + +TE        L   YS +     +  RL E  + +++P   P  
Sbjct: 1355 IDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIM 1410

Query: 434  TAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
            T    + P  G VE  DVS  Y P  P  ++ KN++F + P S V +VG +G GKSTI  
Sbjct: 1411 TPPSDW-PQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIIT 1467

Query: 493  LLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-- 550
             L R+ +P TG I ID+ DI+ ++ + LRR I I+ Q+P L +GTI+ N+     Y+   
Sbjct: 1468 ALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDED 1527

Query: 551  -----------TKEEI--RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIA 597
                       ++EE+   ++         + KF +  ++ I   G  LS GQ+Q + +A
Sbjct: 1528 IFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDL-NSEINEGGGNLSQGQRQLVCLA 1586

Query: 598  RALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIV 657
            R+L++ P I++LDEAT+++D +S+  I  T     +    TI++IAHRL ++   + ++V
Sbjct: 1587 RSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILV 1644

Query: 658  LGHDGSVVEMGKFKKLYANPTSAL 681
            +       + G+ K+ Y +P S L
Sbjct: 1645 M-------DQGEVKE-YDHPYSLL 1660

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 124/523 (23%), Positives = 216/523 (41%), Gaps = 42/523 (8%)

Query: 177 ALLIGCAANFGRFILLR----ILSERVVARLRAHVIKKTLHQDAEFFD-------NHKVG 225
           A+  G A  FGR + ++    I+SE     LR  V   +  Q  +  D        H+ G
Sbjct: 458 AIFSGQALFFGRRVCIKMKAIIISEIYTKALRRQVAVNSNKQSTDEVDPQELNEEEHRDG 517

Query: 226 D-----------LISRLGSDAYVVSR--SMTQKVSDGVKALICGVVGVGMMCSLSPQLSI 272
           D           +I+ +  DA+ VS   +      + V      +V +  +  LS  +  
Sbjct: 518 DEESGTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVAMSCVAIVLLYKLLGLSAIIGA 577

Query: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332
           LL+    PV F    +  Q++  S      T +  +   E    I+ ++ F  E N   +
Sbjct: 578 LLIVVLMPVNFRLVTWLGQLQKKSLSY---TDKRIQNLNEAFQAIRIIKFFSWEDN-FEK 633

Query: 333 YNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392
              AIRD+ ++                     + +T  A+  Y+ +Q Q ++    AF  
Sbjct: 634 GIQAIRDV-ELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYIYVQKQ-TLTTPVAFTA 691

Query: 393 YTEYT--GNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKD 450
            + ++     +  LS   S ++Q   +  R+ E  + +P           P    + F++
Sbjct: 692 LSLFSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPGGQKLGFEN 750

Query: 451 VSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI--- 507
            + S+ +       +NLN     G    ++GP+G GK++I + LL       G I++   
Sbjct: 751 ATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSL 810

Query: 508 DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
           D + +  ++   +   I    Q   L++ T+R+NI +   Y+  +     V + C     
Sbjct: 811 DPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYSEAR--YNDVIEACGLKRD 868

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--N 625
                    T IG RG  LSGGQKQRI++AR+L      L+LD+  SA+D  +   I  N
Sbjct: 869 FEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDN 928

Query: 626 YTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
              G LM+ +  T I I+H ++   R+  ++VL  +G V E G
Sbjct: 929 CITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 148/562 (26%), Positives = 243/562 (43%), Gaps = 67/562 (11%)

Query: 156  FELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F+ + P F + LY   SFF  A  I     F     + I++ + +  LRA  +++ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKCL-NLRA--VRRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    +VGV +MC +  P  +I +
Sbjct: 980  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1039 PFLLVVFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1098

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----------SQLSI 384
              I  + + G                     FL ++A    L++           S  S+
Sbjct: 1099 FLINKMNEAGYLVVVLQRWVGI---------FLDMVAIAFALIITLLCVTRAFPISAASV 1149

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTAGHKY 439
            G L  ++L      N +    T     M  A      A++L  E   RKP ++P      
Sbjct: 1150 GVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPPESW-- 1207

Query: 440  KPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P +G + F++V F+Y  RP + I  KN N  I  G  + I G +G GKSTI   L R  
Sbjct: 1208 -PSKGKIVFENVDFAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLN 1264

Query: 499  NPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN----------------I 542
              + G I IDD DI+++    LR+ + I+ Q+PVL  GTIR N                +
Sbjct: 1265 ELTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDERTDDELWDALV 1324

Query: 543  TYGLTYTPTKEEIR-SVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALI 601
              G        E+R     +   H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKKLYANPTSALSQ 683
            G V E       Y  P +  SQ
Sbjct: 1440 GEVAE-------YDTPWALFSQ 1454

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 114/228 (50%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           + S + FK+LNF I  G  + I GP G GKS++        N   G++   D  I ++N 
Sbjct: 598 KTSFRGFKDLNFDIQKGEFIMITGPIGTGKSSL-------LNAMAGSMRKVDGKI-EVNG 649

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
             L      +   P + + T+RDNI +G  +   KE+   V   C     +   P    T
Sbjct: 650 DLL------MCGYPWIQNATVRDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKS 636
            IG RG  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K 
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNK- 760

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
            T I   H+LS I R+  VIVLG DG  V++G  ++L A   + ++ L
Sbjct: 761 -TRILATHQLSLIERASRVIVLGTDGK-VDIGTVEELKARNKTLINLL 806

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 148/558 (26%), Positives = 243/558 (43%), Gaps = 60/558 (10%)

Query: 156  FELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F+ + P F + LY   SFF  A  I     F     + I++ + +  LRA  +K+ LH  
Sbjct: 926  FKNRPPSFYMGLY---SFFVFAAFIFMNGQFTILCAMGIMASKWL-NLRA--VKRILHTP 979

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    +VGV +MC +  P  +I +
Sbjct: 980  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1039 PFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1098

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ----------SQLSI 384
              I  + + G                     FL ++A    L++           S  S+
Sbjct: 1099 FLINKMNEAGYLVVVLQRWVGI---------FLDMVAIAFALIITLLCVTRAFPISAASV 1149

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG-----AASRLFELTDRKPSISPTAGHKY 439
            G L  ++L      N +    T     M  A      A     E + RKP ++P      
Sbjct: 1150 GVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESW-- 1207

Query: 440  KPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P  G + F++V F+Y  RP + I  KNLN  I  G  + I G +G GKSTI   L R  
Sbjct: 1208 -PSMGEIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLN 1264

Query: 499  NPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------- 550
              + G I+ID+ DI+++    LRR + I+ Q+PVL  GTIR N+      T         
Sbjct: 1265 ELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALV 1324

Query: 551  -----TKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALI 601
                  K+++  V  Q       H  + KF    D  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 602  KKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EK 1439

Query: 662  GSVVEMGKFKKLYANPTS 679
            G V E      L++   S
Sbjct: 1440 GEVAEFDTPWTLFSQEDS 1457

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 119/243 (48%), Gaps = 20/243 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           + S + FK+LNF I  G  + I GP G GKS++        N   G++   D  + ++N 
Sbjct: 598 KTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSL-------LNAMAGSMRKTDGKV-EVNG 649

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
             L      +   P + + ++RDNI +G  +   KE+   V + C     +   P    T
Sbjct: 650 DLL------MCGYPWIQNASVRDNIIFGSPFN--KEKYDEVVRVCSLKADLDILPAGDMT 701

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKS 636
            IG RG  LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K 
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK- 760

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQ 696
            T I   H+LS I R+  VIVLG DG  V++G   +L A   + ++ L          D+
Sbjct: 761 -TRILATHQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQTLINLLQFSSQNSEKEDE 818

Query: 697 QQQ 699
           +Q+
Sbjct: 819 EQE 821

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 145/556 (26%), Positives = 244/556 (43%), Gaps = 46/556 (8%)

Query: 156  FELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F+ K P F + LY   SFF  A  I     +     + I++ +    L    +K+ LH  
Sbjct: 927  FKNKSPSFYMGLY---SFFVFAAFIFMNGQYTILCAMGIMASK---WLNLKAVKRILHTP 980

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILL 274
              + D   +G +++R   D   +   +T+ +   + +    +VGV +MC +  P  +I +
Sbjct: 981  MSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCVMCIVYLPWFAIAI 1039

Query: 275  LFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
             F     +  A  +    R   +        +     E L G+ T++++ ++   L++ +
Sbjct: 1040 PFLLIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSD 1099

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLAYGSYLVLQSQLSIGDLTAFMLY 393
              I  + + G               ++  + + +  L   +     S  S+G +  ++L 
Sbjct: 1100 FLINKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLTYVLQ 1159

Query: 394  TEYTGNAVFGLSTFYSEIMQGA----GAASRL-FELTDRKPSISPTAGHKYKPHRGVVEF 448
                 N +    T     M  A      A+ L  E   RKP ++P       P +G + F
Sbjct: 1160 LPGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPPESW---PSKGEIAF 1216

Query: 449  KDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI 507
            K+V FSY  RP + +  KNLN  I  G  + I G +G GKSTI   L R    S G I+I
Sbjct: 1217 KNVDFSY--RPGLPVVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILI 1274

Query: 508  DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR-------SVAK 560
            DD +I+++    LRR + I+ Q+PVL  GTIR N+        T++E+        ++AK
Sbjct: 1275 DDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFNERTEDELWDALVRGGAIAK 1332

Query: 561  QCF------------CHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI 608
                            H  + KF    D  +   G+  S G++Q +A+ RAL+++  ILI
Sbjct: 1333 NDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILI 1390

Query: 609  LDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LDEATS++D E++G I      + +    TI+ IAHRL TI   + ++VL   G V E  
Sbjct: 1391 LDEATSSVDYETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFD 1447

Query: 669  KFKKLYANPTSALSQL 684
                L++   S    +
Sbjct: 1448 TPWALFSQEDSIFKNM 1463

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/228 (30%), Positives = 116/228 (50%), Gaps = 20/228 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           + S + FK+L+F+I  G  + I GP G GKS++        N   G++   D  I ++N 
Sbjct: 598 KTSFKGFKDLDFEIKKGEFIMITGPIGTGKSSL-------LNAMAGSMRKTDGKI-EVNG 649

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
             L      +   P + + T++DNI +G  +   KE+   V   C     +   P    T
Sbjct: 650 DLL------MCGYPWIQNATVKDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMT 701

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKS 636
            IG RG  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L+++K+
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKT 761

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
             + +  H+LS I ++  VIVLG DG  V++G   +L A   + ++ L
Sbjct: 762 RVLAT--HQLSLIEKASRVIVLGTDGD-VDIGTVDELKARNQTLINLL 806

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 132/485 (27%), Positives = 226/485 (46%), Gaps = 31/485 (6%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    V+ R+ +Q   + VK        +G++C  + Q    
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFT----IGVICVTTWQF--- 1095

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L GI T++ +  +  
Sbjct: 1096 -IFVIVPLGVFYIYYQQYYLRTSRELRRLDS-ITRSPVYSHFQETLGGIVTIRGY-GQQK 1152

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S+ N   + +                    L+G +  L         + Q  L+ G +
Sbjct: 1153 RFSQINQCRVDNNMSAFYPSVNANRWLAYRLELIGSIIILGAATLSVMRLKQGTLTAGMV 1212

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVE 447
               + Y      ++  +     E+     +  R+ E  D K S +P     ++P     E
Sbjct: 1213 GLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLK-SEAPEIIEDHRPQETWPE 1271

Query: 448  FKDVSFSYPT---RPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTG 503
              D+ F + +   RP +  + K++NF I P   + IVG +G GKS++ L L R    S G
Sbjct: 1272 EGDIKFEHYSTRYRPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEG 1331

Query: 504  TIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
             I+ID+ DI+ +    LR  + I+ Q+  +  GTIR+NI     Y  T E+I  V +   
Sbjct: 1332 NIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNQY--TDEQIWRVLELSH 1389

Query: 564  CHNFI-TKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
              + I T   +  DT +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++ 
Sbjct: 1390 LRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDK 1449

Query: 623  AINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALS 682
             +  T     K +  TI++IAHR++TI  ++ ++VL  +GS+ E  + KKL  N +S   
Sbjct: 1450 VLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLD-NGSIKEFDEPKKLLENKSSLFY 1506

Query: 683  QLLNE 687
             L  E
Sbjct: 1507 SLCEE 1511

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 120/244 (49%), Gaps = 26/244 (10%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 630 DATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSIL------------- 676

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++  ++  V Q   +M+GT++DNI +G  Y    E      K C     
Sbjct: 677 -GDLFRVKGFATIHGNVAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKTIKACALTID 733

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           ++   +   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   E    + 
Sbjct: 734 LSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVD---EHVARHL 790

Query: 628 FGHLMKSKSM----TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
             H++    +    T +   +++S +  +++V +L  +G +V+ G + ++  +  S L++
Sbjct: 791 IEHVLGPNGLLHTKTKVLATNKVSVLSVADSVSLL-ENGEIVQQGSYDEIMKDGASQLNK 849

Query: 684 LLNE 687
           L+ E
Sbjct: 850 LIME 853

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 144/546 (26%), Positives = 241/546 (44%), Gaps = 66/546 (12%)

Query: 146  TLKTSSGSDFFELKIPIFSLPLYEFLSFFTVAL--LIGCAANFGRFILLRILSERVVARL 203
            TL T++ + F+ L I I    L   +S   V L  + G  A+   F LL           
Sbjct: 1115 TLSTTTRNTFYYLSIYILLGTLRALISTVKVILSYISGLKASRKIFTLL----------- 1163

Query: 204  RAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM 263
                +KK L+    FFD+   G +++R   D   +   +         +L+  +  + ++
Sbjct: 1164 ----LKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLI 1219

Query: 264  CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKT 319
              ++P    + LFF   +  S  + G      S++LQ         + +   E L G+ T
Sbjct: 1220 GYITP----VFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTT 1275

Query: 320  VQSFVAE----GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            +++F  E     + LS+ +   R  F +               + +       +LA G +
Sbjct: 1276 IRAFGDERRFLADNLSKVDTHNRPFFYLWVTNRWLAFRIDFIGAFV-------ILASGIF 1328

Query: 376  LVLQ-SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSIS 432
            ++L  + L  G     ++Y          L   YS +     +  RL E    +++PS  
Sbjct: 1329 ILLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTG 1388

Query: 433  PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
                    P RG +E  ++S  Y +    ++ KN+ F + P S V IVG +G GKSTI  
Sbjct: 1389 LYEPPPEWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVGRTGAGKSTIIT 1447

Query: 493  LLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY---- 548
             L R+ +P TGTI +D+ DIT +  K LR+ I I+ Q+PVL +GTI+ N+     Y    
Sbjct: 1448 ALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDR 1507

Query: 549  ----------------TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQ 592
                            TPT  +I S +      N + KF +   + I   G+ LS GQ+Q
Sbjct: 1508 IFEALKRVNLIVQEELTPT--DIPSSSSSLSFEN-VNKFLD-LTSEITEGGSNLSQGQRQ 1563

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRS 652
             + +AR+L++ P  ++LDEAT+++D  S+  I  T     +    TI++IAHRL +I   
Sbjct: 1564 LVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIRE--EFSGSTILTIAHRLRSIIDY 1621

Query: 653  ENVIVL 658
            + V+V+
Sbjct: 1622 DKVLVI 1627

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 106/216 (49%), Gaps = 9/216 (4%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI---DDQDITKMNCKSL 520
            KNLN     G    IVGP+G GK+++ + LL   N S G I +   + ++   ++   +
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGM 789

Query: 521 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              IG   Q   L++ T+R+NI +   Y   +    +V   C     +        T +G
Sbjct: 790 TDSIGYCSQSAWLLNDTLRNNILFSAPYEANR--YNAVIHACGLTRDLEILNAGDQTEVG 847

Query: 581 SRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGHLMKSKSMT 638
            +G  LSGGQKQR+++ARA+  +   ++LD+  SA+D  +   I  +   G LM+ ++  
Sbjct: 848 EKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRTCV 907

Query: 639 IISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
           ++S  H  +   ++ + +V+  +  V   G+  +L+
Sbjct: 908 LVS--HNTALTLKNADWVVILENAKVTAQGEPLELF 941

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 144/558 (25%), Positives = 249/558 (44%), Gaps = 74/558 (13%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            F + LY   SFF     +     F    ++ I++ +    L    +K+ LH    + D  
Sbjct: 934  FYMGLY---SFFVFGGYLFMNIQFTMLCMMGIMASK---WLNLKAVKRILHAPMSYLDTT 987

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILLLFFTPPV 281
             +G +++R   D   +   +T+ +   + +    ++GV ++C +  P  +I + F     
Sbjct: 988  PLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLVF 1046

Query: 282  LFSASVF---GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
            +  A  +   G++I+     +Q +      +  E L G+ T++++ ++   +++ +  I 
Sbjct: 1047 VLIADHYQSAGREIKRLEA-IQRSFVYNNLI--EVLGGMDTIKAYKSQDRYMTKMDFLIN 1103

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----SIGDLTAFMLY 393
             + +V                ++  ++F  ++   S L +  Q      ++G L  ++L 
Sbjct: 1104 KMNEVSYMVVSVQRWVAIFLDMIA-VAFALII---SLLCVTRQFHISPSAVGVLLTYVLQ 1159

Query: 394  --------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKY 439
                          TE   N+   L T+ +E+ Q A           RK   SP      
Sbjct: 1160 LPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAY---------RKSDYSPPDNW-- 1208

Query: 440  KPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYY 498
             P  G V F+DVSF+Y P  P+V   KN+N  IA G  + I G +G GKSTI   L R  
Sbjct: 1209 -PTNGEVIFEDVSFAYRPGLPTV--LKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 499  NPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------- 550
              ++G I ID  D  K+    LRR + I+ Q+PVL  GTIR N+     ++         
Sbjct: 1266 ELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLI 1325

Query: 551  -----TKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALI 601
                  K+++  +  Q       +N + KF    D ++   G   S G++Q +A+ RAL+
Sbjct: 1326 RGGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALV 1383

Query: 602  KKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHD 661
            ++  ILILDEATS++D E++G I        + +  TI+ IAHRL TI   + ++VL   
Sbjct: 1384 RQSKILILDEATSSVDYETDGKIQTRIA--TEFQDCTILCIAHRLKTILNYDRILVL-EK 1440

Query: 662  GSVVEMGKFKKLYANPTS 679
            G V E  K + L+ N  S
Sbjct: 1441 GEVAEFDKPEILFNNEKS 1458

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 110/211 (52%), Gaps = 20/211 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F NLNF+I  G  + I GP G GKS++   +  +   +TG + I+              H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
           + ++   P + + T+RDNI +G  Y   +E+ + V + C     I   P    T IG RG
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFGSPYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKSMTIISI 642
             LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  F   ++SK  T I  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
            H+LS I +++ VIVL  +GS V++G  ++L
Sbjct: 779 THQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 145/545 (26%), Positives = 247/545 (45%), Gaps = 46/545 (8%)

Query: 168  YEFLSFFTVALLIGCAANFGR----FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHK 223
            Y  L F  V   IG    F        +L   S R   +L   + K  +     FF+   
Sbjct: 989  YNLLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTP 1048

Query: 224  VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLF 283
             G +I+R  SD   V  ++    S   ++++  ++ V ++    P   +L        L+
Sbjct: 1049 TGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVTFNMPLFFLLNAGLLVIYLY 1108

Query: 284  SASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
              S +    R   +    +   +  +  E LSG  T+ ++     ++ R++    +  Q 
Sbjct: 1109 YQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYERIQF 1164

Query: 344  GXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTG 398
                           S+ L  +  L VL+ G    S L    QLS G +   M Y     
Sbjct: 1165 SINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVT 1224

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYK-----PHRGVVEFKDVSF 453
            +++  +      I     +  R+ E  D  P  +P    +++     P++G +EFK+ S 
Sbjct: 1225 SSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQGQIEFKNYST 1283

Query: 454  SYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDI 512
            SY  R ++  + K++N  I+PG  + +VG +G GKST+++ L R   P+ GTI ID+ DI
Sbjct: 1284 SY--RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDI 1341

Query: 513  TKMNCKSLRRHIGIVQQEPVLMSGTIR-----------DNITYGLTYTPTKEEIRSVAKQ 561
            T +  + LR HI I+ Q+     GTIR           D++ + +  +  K  + ++AK+
Sbjct: 1342 TSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKE 1401

Query: 562  CFC---HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                  ++  ++  +  D  +   G+ LS GQKQ + +ARAL+ K  IL+LDEAT+++DV
Sbjct: 1402 INDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDV 1461

Query: 619  ESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT 678
            E++  I  T       +  TI++IAHRL T+  S+ +IVL  DG   E+ +F K    P 
Sbjct: 1462 ETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL--DGG--EVKEFDK----PE 1511

Query: 679  SALSQ 683
            + L Q
Sbjct: 1512 TLLEQ 1516

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 114/232 (49%), Gaps = 17/232 (7%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIV 527
           NF++   S +C+VG  G GKSTI   +L      +G     + D      +     +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG-----NNDHLSPQFQINATTVAYC 693

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLS 587
            QE  +M+ +++DNI +G  Y   +   ++  K C     I   P+  +T++G +G +LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYD--EAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVES-----EGAINYTFGHLMKSKSMTIISI 642
           GGQK R+++ARA+  +  + +LD+  SA+D E      +  ++   G L+K KS  I+  
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTG-LLKDKS--IVLA 808

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN-PTSALSQLLNERAAPGP 693
            + +S ++ S  + +L  + S+ + G +  +  N   S L  +L+E     P
Sbjct: 809 TNTISVLKHSTKIYLL-ENKSIAQEGNYDDIMNNQQDSKLKNILHEFDLEKP 859

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  145 bits (367), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 124/491 (25%), Positives = 221/491 (45%), Gaps = 48/491 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++K +LH    FFD+  +G +++R   D   V + +   +      L+     + ++  +
Sbjct: 1174 LLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLI 1233

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +PQ   + +F      F  +V+    R   +        + +   E L+GI TV+++  E
Sbjct: 1234 TPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITTVRAYGDE 1293

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
               +      I +  +                 ++G  +F+ + A G  +   +++  G 
Sbjct: 1294 SRFMRENLEKIDENNKPFFYMWVSNRWLSFRTQIIG--AFVILGAGGFSIWNINKIDSGL 1351

Query: 387  LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP----SISPTAGHKYK 440
                + Y     +A   L  FY +      +  R+ E    D++P    ++ P A     
Sbjct: 1352 AGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADW--- 1408

Query: 441  PHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            P  G +E  DVS  Y P  P  ++ KN++F +   S V IVG +G GKSTI   L R+  
Sbjct: 1409 PENGKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLE 1466

Query: 500  PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY----------- 548
            P TG I ID+ DI  ++ + LRR I I+ Q+P L +GTIR N+     Y           
Sbjct: 1467 PETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLDPYTQYSDKEIFDSLIC 1526

Query: 549  -------------TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIA 595
                         +P+  +  S+  + F H    ++       +   G+ +S GQ+Q + 
Sbjct: 1527 VNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYN------VSEGGSNISQGQRQLLC 1580

Query: 596  IARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENV 655
            +AR+L+ KP I++LDEAT+++D ES+  I  T  +  +  + TI++IAHRL ++   + +
Sbjct: 1581 LARSLLGKPKIILLDEATASIDYESDKKIQETIRN--EFGNSTILTIAHRLRSVIDYDKI 1638

Query: 656  IVLGHDGSVVE 666
            +V+  D   VE
Sbjct: 1639 LVM--DAGEVE 1647

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 128/550 (23%), Positives = 228/550 (41%), Gaps = 83/550 (15%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVIKKT-----------LHQ 214
           F+S   VA+  G A   GR I +R    I+SE  +  LR  +I KT           L++
Sbjct: 464 FISKCIVAVCEGQALFIGRRICIRMRSIIISEIYIKALRRQIITKTKKSTDEVDPEQLNE 523

Query: 215 DAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           D++   + +      VG +I+ +  DA+ V+          + A +   +G  +M  +S 
Sbjct: 524 DSKIDGDEESTASANVGAIINLIAVDAFKVAE---------IGAYLHTFIGTIIMTFVS- 573

Query: 269 QLSILLLFFTPPVLFSASVFGK-----------QIRNTSKDLQE----ATGQLTRVAEEQ 313
              I LLF    +L SA+  G            +I N   +LQ+     T +  +   E 
Sbjct: 574 ---IYLLF---NLLGSAAFIGALTIIVLIPVNYKIANWLGNLQQKNLKTTDKRIQKLNET 627

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL-----T 368
              I+ ++ F  E N          DI ++               S    + F+     T
Sbjct: 628 FQAIRIIKFFSWEKN-------FENDIHKIREEELYILLLRCLVWSFSTFIFFISPTIVT 680

Query: 369 VLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFG-----LSTFYSEIMQGAGAASRLFE 423
            L++  Y+ +Q Q    +LT+ + +T  +  A+       ++   S ++Q   +  R+  
Sbjct: 681 SLSFAYYIFIQKQ----ELTSPVAFTALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQT 736

Query: 424 LTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPS 483
             D +P             +  + FK+ + S+         +NL+     G    ++GP+
Sbjct: 737 FLD-EPDTKKYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPT 795

Query: 484 GRGKSTIALLLLRYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
           G GK+++ + LL     + G I I   D +    +        I    Q   L++ T+R+
Sbjct: 796 GSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRN 855

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
           NI +   Y   + +   VA        I    +   T IG RG  LSGGQKQRI++ARAL
Sbjct: 856 NILFNSPYNKDRYDAAIVAAGLKRDFEILAAGDL--TEIGERGITLSGGQKQRISLARAL 913

Query: 601 IKKPTILILDEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVL 658
                 ++LD+  SA+D  +   I  N   G LM+ ++  ++S  H ++   ++ +++V+
Sbjct: 914 YSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNASLVVM 971

Query: 659 GHDGSVVEMG 668
             +G V + G
Sbjct: 972 LKNGRVADQG 981

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 142/519 (27%), Positives = 239/519 (46%), Gaps = 63/519 (12%)

Query: 200  VARLRAH------VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL 253
            VA +RA       ++K  L+    FFD+  +G +++R   D   + + +T  +     +L
Sbjct: 1123 VAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSL 1182

Query: 254  ICGVVGVGMMCSLSPQLSI------LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLT 307
            I  V  + ++  ++PQ  I      LL +F      S +   K++ + S+        + 
Sbjct: 1183 IQCVSTIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSR------SPIH 1236

Query: 308  RVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL 367
            +   E L GI T+++F  E   L      I D  +                 L+G L   
Sbjct: 1237 QHFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRIELIGAL--- 1293

Query: 368  TVLAYGSYLVLQSQLSIGDLTAFML--YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT 425
             VLA GS+++L  +     L    L    ++T  A++ +   YS +     +  RL E T
Sbjct: 1294 IVLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYT 1352

Query: 426  --DRKPS-ISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGP 482
              +++PS +         P  G +E KD+S  Y      ++ KN+ F +     V IVG 
Sbjct: 1353 TIEQEPSNVGALVPPCEWPQNGKIEVKDLSLRYAAGLP-KVIKNVTFTVDSKCKVGIVGR 1411

Query: 483  SGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+ +P TG I IDD DIT +  K LR+ I I+ Q+P L +GT++ N+
Sbjct: 1412 TGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNL 1471

Query: 543  TYGLTYTPTKEEIRSVAKQCFCHNFITK----FPNTYDTV----------------IGSR 582
                 Y  ++ EI    K+    N ++      P+T D+                 +   
Sbjct: 1472 DPYNEY--SEAEIFEALKRV---NLVSSEELGNPSTSDSTSVHSANMNKFLDLENEVSEG 1526

Query: 583  GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISI 642
            G+ LS GQ+Q I +AR+L++ P +++LDEAT+++D  S+  I  T      +   TI++I
Sbjct: 1527 GSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTI 1584

Query: 643  AHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
            AHRL +I   + ++V+       + G+ K+ Y +P S L
Sbjct: 1585 AHRLRSIIDYDKILVM-------DAGEVKE-YDHPYSLL 1615

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 121/551 (21%), Positives = 225/551 (40%), Gaps = 75/551 (13%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLR----ILSERVVARLRAHVI----------- 208
           +Y FL F    L   CAA     GR + +R    I+SE     LR  +            
Sbjct: 400 MYIFLMFLARILTAICAAQALFLGRRVCIRMKAIIISEIYSKALRRKISPNSTKEPTDVV 459

Query: 209 -------KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
                  K+ +  D E      +G +I+ +  DA+ VS  +   +   ++A+I  +V + 
Sbjct: 460 DPQELNDKQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALF 518

Query: 262 MMCSLSPQLSI----LLLFFTPPVLFSASVFG----KQIRNTSKDLQEATGQLTRVAEEQ 313
           ++  L    ++    +++ F P     AS+ G    K +  T K +Q+          E 
Sbjct: 519 LLYRLIGWSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN--------EA 570

Query: 314 LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL--SFLTVLA 371
              I+ ++ F  E N    +   I++                   SL+  +  S +T  +
Sbjct: 571 FQAIRIIKFFSWEEN----FEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSAS 626

Query: 372 YGSYLVLQSQ-----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
           +  Y+ +Q Q     ++   L+ F L      N +  LS   S ++Q   +  R+ E  +
Sbjct: 627 FAVYIYVQGQTLTTPVAFTALSLFALLR----NPLDMLSDMLSFVIQSKVSLDRVQEFLN 682

Query: 427 RKPSISPTAGHKYKP---HRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPS 483
            + +       KY+     R  +  ++ +F++         KNL      G    IVGP+
Sbjct: 683 EEET------KKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPT 736

Query: 484 GRGKSTIALLLLRYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
           G GK+++ + LL       G + +   + ++   +    +   I    Q   L++ T+R+
Sbjct: 737 GSGKTSLLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRN 796

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
           NI +   Y   +    +V   C              T IG +G  LSGGQKQR+++AR+L
Sbjct: 797 NILFNAPYNENR--YNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSL 854

Query: 601 IKKPTILILDEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVL 658
                 L+LD+  SA+D  +   I  N   G LM+ ++  ++S  H ++   ++ + +++
Sbjct: 855 YSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVII 912

Query: 659 GHDGSVVEMGK 669
             +G V E G+
Sbjct: 913 MENGRVKEQGE 923

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 138/545 (25%), Positives = 241/545 (44%), Gaps = 53/545 (9%)

Query: 173  FFTVALLIGCAA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            F  +  LIG A+    N    ILL   + R   +L  ++    ++   +FF+   +G ++
Sbjct: 1006 FVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRIL 1065

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVF 288
            +R  +D   V  ++        K++   ++ V ++    P   +  LF     ++   +F
Sbjct: 1066 NRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFLVFCLFLMVIYIYYQKLF 1125

Query: 289  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQ 342
              Q R   +    +   +  +  E L G+  +++      F    NE  ++N  I  +F 
Sbjct: 1126 IVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQFN--INCVFD 1183

Query: 343  VGXXXXXXXXXXXXXXSLL----GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                            +L+    G LS  T+ +          L+ G +   M Y     
Sbjct: 1184 YRSTNRWLSIRLQTIGALMVLITGMLSLSTISS-------SKPLTAGMVGLLMSYVLQVT 1236

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKP-----HRGVVEFKDVSF 453
             ++  +      I  G  +  R+ E  +  PS +      Y+P      +G ++FK+ S 
Sbjct: 1237 TSLMWIVRSSVMIETGIVSVERIMEYCEL-PSEAEQIVDDYRPASNWPSKGAIQFKNYST 1295

Query: 454  SYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDI 512
             Y  R ++  + KN++  I PG  V IVG +G GKST+ L L R   P  GTI+ID  DI
Sbjct: 1296 RY--RANLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDI 1353

Query: 513  TKMNCKSLRRHIGIVQQEPVLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQ 561
            +K+    LR H+ I+ Q+     GT+R N           +   +T +  K  ++ + ++
Sbjct: 1354 SKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEE 1413

Query: 562  CFCHNFITKFP-NTY-DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                   ++ P N Y +  I   G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++DVE
Sbjct: 1414 SG-----SELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVE 1468

Query: 620  SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
            ++  I  T       +  TII+IAHR+ T+  S+ ++VL   G V E      L A+ ++
Sbjct: 1469 TDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLADKST 1525

Query: 680  ALSQL 684
               QL
Sbjct: 1526 LFYQL 1530

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 134/311 (43%), Gaps = 50/311 (16%)

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAV-----------FGLSTFYSEIMQGAGAASRLFELT 425
           ++++ +SIG +  F+L  E   + +           F +    +  +  + A+ +  + T
Sbjct: 576 IIETNVSIGRVKKFLLGEELDRSFIEEIADKHDESPFAVEILNATFLWKSKASLQAGDGT 635

Query: 426 DRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGR 485
           D + SI  T          VV  KD+ F               F+       C+VG  G 
Sbjct: 636 DEETSIGST----------VVALKDIDF---------------FRAKKNVLTCVVGRVGS 670

Query: 486 GKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 545
           GK+T+   +L     ++G+     Q             +    QE  +M+ +I++NI +G
Sbjct: 671 GKTTLLKSILGQLPCTSGS-----QKAIPPKLIIRGESVAYCPQEAWIMNDSIKENILFG 725

Query: 546 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPT 605
             Y  T   +    K C         P+  +T++G +G  LSGGQK R+++ARA+  +  
Sbjct: 726 HRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQKARLSLARAVYSRSD 783

Query: 606 ILILDEATSALDVESEGAINYTF----GHLMKSKSMTIISIAHRLSTIRRSENVIVLGHD 661
           I +LD+  SA+D     +I +        L+K+K+  II   + +S +  S+ + VL  D
Sbjct: 784 IYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKA--IILTTNDISVLEHSDRIYVL-QD 840

Query: 662 GSVVEMGKFKK 672
           G ++E   + +
Sbjct: 841 GRIIEESTYAE 851

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 130/503 (25%), Positives = 225/503 (44%), Gaps = 49/503 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +P   ++ +F           +    R   +    +   + +   E L GI T+++F   
Sbjct: 980  TPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAF--- 1036

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 381
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1037 GDERRFMQENLEKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1096

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK--- 438
            L+   LT  + +TE        L   YS +     +  RL E  + +      + H    
Sbjct: 1097 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHTPPP 1152

Query: 439  YKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
              P +G +E  D+S  Y P+ P  ++ KN++F + P   V IVG +G GKSTI   L R+
Sbjct: 1153 EWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTIITALFRF 1210

Query: 498  YNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP------- 550
             +P +G I ID+ DIT +  K LR+ I I+ Q+P L +GT++ N+     Y+        
Sbjct: 1211 LDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFEAL 1270

Query: 551  ------TKEEIRSV-----AKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARA 599
                  T+EE+ S               + KF    D  I   G  LS GQ+Q + +AR+
Sbjct: 1271 KRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRL-DNEITEGGANLSQGQRQLVCLARS 1329

Query: 600  LIKKPTILILDEATSALDVESEGAINYTF-GHLMKSKSMTIISIAHRLSTIRRSENVIVL 658
            L++ P +++LDEAT+++D  S+  I  T  G    S   TI++IAHRL +I   + ++V+
Sbjct: 1330 LLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKILVM 1386

Query: 659  GHDGSVVEMGKFKKLYANPTSAL 681
                   + G+ K+ Y +P S L
Sbjct: 1387 -------DAGEVKE-YDHPYSLL 1401

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 121/549 (22%), Positives = 235/549 (42%), Gaps = 63/549 (11%)

Query: 171 LSFFTVALLIGC----------AANFGRFILLR----ILSERVVARLR------------ 204
           L++F V  +  C          A  FGR + +R    I+SE     LR            
Sbjct: 174 LAWFYVCSMFACRVLVAICQSQALFFGRRVCIRMKAIIISEIYTKALRRKTSPNKSKSPT 233

Query: 205 AHVIKKTLHQDAEFFDNHK-----VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVG 259
             V  +TL++  +   + +     +G +I+ +  DA+ VS  +   +   V+AL+  +V 
Sbjct: 234 DEVDPQTLNEQKDIDADEESSTANLGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVA 292

Query: 260 VGMMCSL---SPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLS 315
           + ++  L   S  + +LL+    P+ F  A++ G    N  K+    T +  +   E   
Sbjct: 293 LTLLYKLLGWSAIVGVLLIIVILPLNFKLANLLG----NLQKETLSFTDKRIQKLNETFQ 348

Query: 316 GIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY 375
            I+ ++ F  E N   +    IRD  ++                     S +T +++ +Y
Sbjct: 349 AIRIIKFFSWEEN-FEKDIQNIRDQ-ELKMLVKRSIVWALTAFVWFVTPSIVTTVSFATY 406

Query: 376 LVLQSQLSIG--DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP 433
           + +Q ++       TA  L+T    N +  LS   S ++Q   +  R+      +  +  
Sbjct: 407 IYIQGEVLTTPVAFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRV------QVFLEE 459

Query: 434 TAGHKYKP---HRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI 490
               KY      R  + F++ +FS+  +      KN++ +   G    ++GP+G GK+++
Sbjct: 460 DETEKYDQITVSRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSL 519

Query: 491 ALLLLRYYNPSTGTIM---IDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 547
            + LL   +   G +    +D ++   +    +   I    Q   L++ T+++NI +   
Sbjct: 520 LMGLLGEMDLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSP 579

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTIL 607
           +   + +  +V + C              T IG +G  LSGGQKQR+++ARAL      L
Sbjct: 580 FNEARYD--AVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHL 637

Query: 608 ILDEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVV 665
           +LD+  SA+D  +   I  N   G LM+ +  T I ++H ++   ++ + +V   +G V 
Sbjct: 638 LLDDCLSAVDSHTALWIYENCITGPLMEGR--TCILVSHNVALTLKNADWVVFMENGKVK 695

Query: 666 EMGKFKKLY 674
           + G+  +L+
Sbjct: 696 DQGEPLELF 704

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 137/545 (25%), Positives = 245/545 (44%), Gaps = 56/545 (10%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLVLYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASV 287
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ   + +  +    F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIGYF 1221

Query: 288  FGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXX 347
            +    R   +    +   + +   E L G+ T+++F  EG  +      I +  +     
Sbjct: 1222 YMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYL 1281

Query: 348  XXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEYTGNAVF 402
                        ++G L    +   G +++     L S ++   LT  + +TE       
Sbjct: 1282 WVANRWLAFRIDMIGSL---VIFGAGLFILSNIDHLDSGMAGISLTYAISFTE----GAL 1334

Query: 403  GLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK-----YKPHRGVVEFKDVSFSY-P 456
             L   YSE+     +  R+ E  + +    P   HK       P  G +E  D+S  Y P
Sbjct: 1335 WLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDLSLRYAP 1392

Query: 457  TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
              P  ++ KN++F +   S V IVG +G GKSTI   L R+  P TG I ID+ DI+ ++
Sbjct: 1393 NLP--RVIKNVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVD 1450

Query: 517  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK------------EE------IRSV 558
             + LRR I I+ Q+P L SGTI+ N+     ++  K            EE      +R V
Sbjct: 1451 LQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREV 1510

Query: 559  AKQCFCHNF--ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
            A      +   + KF +  ++ +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++
Sbjct: 1511 ATDTSSADSENVNKFLDL-ESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASI 1569

Query: 617  DVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676
            D  S+  I  T     + +  TI++IAHRL ++   + ++V+       + G+ K+ Y +
Sbjct: 1570 DYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDH 1619

Query: 677  PTSAL 681
            P S L
Sbjct: 1620 PYSLL 1624

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 117/533 (21%), Positives = 221/533 (41%), Gaps = 50/533 (9%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAVCQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPAAEDPQAINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLGL 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +IL +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAILGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN- 578

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIG-- 385
              +   I+ I +                S +  ++   +T  ++  Y+ +Q ++     
Sbjct: 579 ---FENDIKAIRESELALLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPV 635

Query: 386 DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYK----- 440
             TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       KY      
Sbjct: 636 AFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT------EKYDQLTID 688

Query: 441 PHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           P+     F++ + S+         K+LN +   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 501 STGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 557
             G +++   D +    +        I    Q   L++ T+++NI +   +  T+   ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNETR--YKA 806

Query: 558 VAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           V + C              T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 618 VESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 142/514 (27%), Positives = 230/514 (44%), Gaps = 66/514 (12%)

Query: 211  TLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQL 270
             LH    FFD   VG +++R   D             +G+   +   + V + C +    
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDI------------EGIDQELIPYLEVTVFCLIQCSS 1129

Query: 271  SILLLFFTPPVLFSASVF--------GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIK 318
             +LL+    P  FS +V         GK     S+DL+         + +   E L G+ 
Sbjct: 1130 ILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVC 1189

Query: 319  TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV- 377
            T+++F   G+E       +  I Q                  +  +    VL  GS+++ 
Sbjct: 1190 TIRAF---GDEKRFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFILF 1246

Query: 378  ----LQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKPSI 431
                + S L+   LT  +L+T+    +   L   YS       +  RL E +   ++  +
Sbjct: 1247 NIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIVQEKYL 1302

Query: 432  SPTAGH------KYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGR 485
                 H         P  G +E +++S  Y +   + + KN+ FK+ P S V IVG +G 
Sbjct: 1303 GYDEDHIQALNDSSWPKHGKIEVENLSLRYASNLPL-VLKNVCFKVDPQSKVGIVGRTGA 1361

Query: 486  GKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 545
            GKSTI   L R   P TG I IDDQDI+K++  +LRR I I+ Q+PVL +GTI+ NI   
Sbjct: 1362 GKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSNIDPH 1421

Query: 546  LTYTPTK--------EEIRSVA-KQCF----CHNFITKFPNTYDTVIGSRGTLLSGGQKQ 592
              Y   +          I S+  KQ F      N   KF N    ++   G  LS G++Q
Sbjct: 1422 DEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIVEG-GLNLSQGERQ 1480

Query: 593  RIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK--SMTIISIAHRLSTIR 650
             + IAR+L+++  I++LDEATS++D +S+  I      +++SK    TI++IAHRL ++ 
Sbjct: 1481 LLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIAHRLRSVI 1536

Query: 651  RSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
              + ++V+   G + E G   +L  N  S   ++
Sbjct: 1537 YYDKILVMDA-GEIKEYGHPYELLKNERSTFYRM 1569

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 113/248 (45%), Gaps = 26/248 (10%)

Query: 441 PHRGVVEFKDVSFSYPTRPS-VQIFK--NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
           P R  +EFK  +  +    + +  FK  +LN   + G    ++G +G GKS + + LL  
Sbjct: 659 PDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGE 718

Query: 498 YNPSTGTI----------MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 547
            +  +G I          +I D D        L        Q   L+S TI++NI +  +
Sbjct: 719 LDLVSGFIIIPGLEPRHDLIPDHD-------GLTNSFAYCSQSAWLVSDTIKNNIVFNGS 771

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTIL 607
           Y   K   + V   C  +  +   P    T IG +G  LSGGQKQRI++ARA+      +
Sbjct: 772 YD--KSRYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHV 829

Query: 608 ILDEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVV 665
           +LD+  SA+D  +   I  N   G LMK++  T I + H +    R+ +  ++  DG V 
Sbjct: 830 LLDDCLSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVK 887

Query: 666 EMGKFKKL 673
             G  K+L
Sbjct: 888 NQGTIKEL 895

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 137/540 (25%), Positives = 232/540 (42%), Gaps = 31/540 (5%)

Query: 167  LYEFLSFFTVALLIGCAANFGR-FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            +++F+  +    +   A N  R  +LL   + R  A+L   + K  L     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R  SD   V  ++    +   ++++   V V ++    P   I+        ++  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQ 1112

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
            + +    R   +    +T  +  +  E L G   + +F        R++    +  Q   
Sbjct: 1113 AFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRFDFINFNNVQFNI 1168

Query: 346  XXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGNA 400
                         S+ L  +    VLA      S +  + +LS G +   M Y     ++
Sbjct: 1169 NCSFNFRSTNRWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSS 1228

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTAGHKYKPHRGVVEFKDVSFSYP 456
            +  +     +I     +  R++E  +  P     I      K  P  G + FK+ S  Y 
Sbjct: 1229 LMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYK 1288

Query: 457  TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
            T+  + + K +N  I P   + +VG +G GKST++L L R    + GTI ID  DI+KM 
Sbjct: 1289 TKGDLAL-KGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMG 1347

Query: 517  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF----- 571
             K LR H+GI+ Q+     GT+R N+     Y+ T+E   S+       + +  F     
Sbjct: 1348 LKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYS-TEELWASIELSHLKPHIVEMFRKEDN 1406

Query: 572  -------PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
                       D  I   G  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++  I
Sbjct: 1407 SELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKII 1466

Query: 625  NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
              T    +K K  TI++IAHR+ T+  S+ +IVL   G V E    + L +N  S    L
Sbjct: 1467 QETIRSELKEK--TILTIAHRIDTVLDSDKIIVLDA-GQVKEFDTPENLLSNKQSIFYAL 1523

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 84/289 (29%), Positives = 139/289 (48%), Gaps = 40/289 (13%)

Query: 423 ELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPT---------------RPSVQIFKNL 467
           EL D    I  T   K  P   VVE  + +F + +                 S    +N+
Sbjct: 585 ELDDSFIEIDKTPSDKVSP---VVEIINATFLWKSPKILFSEGSDEESRIESSQVALENI 641

Query: 468 N-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH--I 524
           N F+   G   CIVG  G GKST+   +L       G +   +  +  +  K L R   +
Sbjct: 642 NGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTV 694

Query: 525 GIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGT 584
               QEP +M+ +I+DNIT+G  Y  T     +  K C     +   P   +T++G +G 
Sbjct: 695 AYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEKGI 752

Query: 585 LLSGGQKQRIAIARALIKKPTILILDEATSALDVE-----SEGAINYTFGHLMKSKSMTI 639
            LSGGQK RI++ARA+  +  + +LD+  SA+D E      E  ++   G L+++K  T+
Sbjct: 753 SLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMG-LLRNK--TV 809

Query: 640 ISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT-SALSQLLNE 687
           +   + +S + RS+ + +L   GS+VE G F ++ ++P  S L ++++E
Sbjct: 810 VLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 137/506 (27%), Positives = 231/506 (45%), Gaps = 53/506 (10%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            V+KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQS 322
            +P   ++ +F    + F   + G      S++L+     +   + +   E L GI T+++
Sbjct: 1198 TPGFLVVAIF----IGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRA 1253

Query: 323  FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ--- 379
            F   G+E       ++ I +                  +  +    V A G +++L    
Sbjct: 1254 F---GDERRFMLENLQKIDENNKPFFYLWVANRWLAFRIDMIGACVVFAAGVFILLNIKK 1310

Query: 380  --SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE--LTDRKPSISPTA 435
              S L+   LT  + +TE        L   YS +     +  RL E  + +++PS     
Sbjct: 1311 LDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAF 1366

Query: 436  GHKYK-PHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL 494
                + P +G +E  D+S  Y T    ++ KN++F + P   V IVG +G GKSTI   L
Sbjct: 1367 NPPIEWPDQGKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGIVGRTGAGKSTIITAL 1425

Query: 495  LRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE 554
             R+ +P TG I ID+ DIT +  K LR+ I I+ Q+P L SGT++ N+     Y  T E+
Sbjct: 1426 FRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEY--TDEQ 1483

Query: 555  IRSVAKQCFCHNFIT-----KFPNTYDTV----------------IGSRGTLLSGGQKQR 593
            I    K+    N +T       P++ D                  I   G  LS GQ+Q 
Sbjct: 1484 IFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQGQRQL 1540

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSE 653
            + +AR+L++ P I++LDEAT+++D  S+  I  T     +    TI++IAHRL +I   +
Sbjct: 1541 VCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRSIIDYD 1598

Query: 654  NVIVLGHDGSVVEMGKFKKLYANPTS 679
             ++V+   G V E      L  N +S
Sbjct: 1599 KILVMDA-GEVREYDHPYSLLLNKSS 1623

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 132/548 (24%), Positives = 240/548 (43%), Gaps = 70/548 (12%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLR----ILSERVVARLRAHV-----------I 208
           LY F  FF   L+  C A    FGR + +R    I+SE     LR  +           I
Sbjct: 394 LYVFGMFFCRILVAICQAQALFFGRRVCIRMKAIIISEIYTKALRRKISPNSSKVSTDEI 453

Query: 209 KKTLHQDAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGM 262
                 + E  D  +      +G +I+ +  DA+ VS  +   +   V+A I  +V + +
Sbjct: 454 DPQALNETEEIDGDEESTTANLGGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTL 512

Query: 263 MCSL---SPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIK 318
           +  L   +  +  +L+    P+ F  A++ GK      KD    T +  +   E    I+
Sbjct: 513 LYKLLGWAAVIGAILIVCMLPLNFKLANLIGK----LQKDNLGVTDKRIQKLNETFQSIR 568

Query: 319 TVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYG 373
            ++ F  E N         RDI  +               +L+  + F+T      +++ 
Sbjct: 569 IIKFFSWEEN-------FERDIKAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVSFA 621

Query: 374 SYLVLQSQLSIGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI 431
            Y+ +Q ++    +  TA  L+T    N +  LS   S ++Q   +  R+ E  D + + 
Sbjct: 622 FYIYVQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDEEET- 679

Query: 432 SPTAGHKYKP---HRGVVEFKDVSFSYPTR-PSVQIFKNLNFKIAPGSSVCIVGPSGRGK 487
                 KY      R  + F++ +F++  + PS ++ KNLN +   G    ++G +G GK
Sbjct: 680 -----EKYNQLTISRNKIAFENATFAWDKKNPSFKL-KNLNVEFKLGKLNVVIGSTGSGK 733

Query: 488 STIALLLLRYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
           +++ + LL   +   G + +   D ++   +    +   I    Q   L++ T+R+NI +
Sbjct: 734 TSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILF 793

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKP 604
              Y  T+   ++V + C              T IG +G  LSGGQKQR+++ARAL    
Sbjct: 794 NSPYNETR--YKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSS 851

Query: 605 TILILDEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLS-TIRRSENVIVLGHD 661
             ++LD+  SA+D  +   I  N   G LM+ +  T I ++H ++ T++ +E V+VL  +
Sbjct: 852 RHVLLDDCLSAVDSHTALWIYENCITGPLMQGR--TCILVSHNVALTLKNAEWVVVL-DN 908

Query: 662 GSVVEMGK 669
           G + + G+
Sbjct: 909 GRIKDQGE 916

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 137/557 (24%), Positives = 242/557 (43%), Gaps = 64/557 (11%)

Query: 168  YEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            Y  + +F + L      +   F L  I       ++ A ++ K +H    FFD   +G +
Sbjct: 1160 YYLIMYFMIGLTGATVGSLKTF-LTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRI 1218

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASV 287
            ++R   D   V + +T  ++    + +     + ++  ++PQ      FF   +L S   
Sbjct: 1219 MNRFSKDIESVDQELTPYLTGAFYSFVECFSTIILISWITPQ------FFVVAILISIMY 1272

Query: 288  F--GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            +  G      S++L+         + +   E L G+ T+++F   G+E+      +  I 
Sbjct: 1273 YLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVTTIRAF---GDEMRFLKENLFKID 1329

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                  +  +    V   G +++     + S ++   LT  + +TE 
Sbjct: 1330 ENNKPFFYLWVANRWLSFRIDMIGSFVVFGAGVFILADIKNIDSGMAGISLTYAISFTE- 1388

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRL----------FELTDRKPSISPTAGHKYKPHRGVV 446
                   L  FYSE+     +  R+          +++ D      PT      P  G +
Sbjct: 1389 ---GALWLVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVW----PDEGKI 1441

Query: 447  EFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIM 506
            E  D+S  Y      ++ KN++F + P S V +VG +G GKSTI   L R+ +P +G I 
Sbjct: 1442 EVNDLSLRYAANLP-RVIKNVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIK 1500

Query: 507  IDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKE 553
            ID+ DIT +    LRR I I+ Q+P L +GT++ N+     Y               + E
Sbjct: 1501 IDNMDITTIPLTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGE 1560

Query: 554  EIR----SVAKQCFCH-NFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI 608
            E+     +V+ Q   H N   +F +  + +    G  LS GQ+Q I +AR+L++ P IL+
Sbjct: 1561 ELNGETTAVSDQGSMHSNNENRFLDLSNEITEGGGN-LSQGQRQLICLARSLLRNPKILL 1619

Query: 609  LDEATSALDVESEGAINYTF-GHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
            LDEAT+++D ES+  +  T  G    S   TI++IAHRL ++   + ++V+   G V+E 
Sbjct: 1620 LDEATASIDYESDARLQATIRGEFGNS---TILTIAHRLRSVIDYDKILVMDA-GEVIEY 1675

Query: 668  GKFKKLYANPTSALSQL 684
                 L  N  S   ++
Sbjct: 1676 DHPYSLLLNRNSEFYKM 1692

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 113/481 (23%), Positives = 207/481 (43%), Gaps = 44/481 (9%)

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           +++++ D E   N K+G +I+ +  DAY +S  +   +    +A++  V+ + ++  L  
Sbjct: 525 EESINADEESGSNAKLGTIINLMAIDAYKISE-ICAYLHFFAEAIVMTVIALVLLYRLIG 583

Query: 269 QLSIL---LLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFV 324
             +IL   ++    PV F  A++ G   + T   L E   ++ ++  E L  I+ ++ F 
Sbjct: 584 NAAILGTVIILVLLPVNFKLATLLGDYQKLT---LGETDKRIHKL-NEALQSIRIIKFFS 639

Query: 325 AEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVLQ 379
            E N         RDI ++                + G + F+T       ++  Y+ +Q
Sbjct: 640 WENN-------FERDIMEIRERELQMLIKRTLAWVMGGFVWFVTPSIVTTASFAWYIYVQ 692

Query: 380 SQLSIG--DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGH 437
            ++       TA  L+T    + +  +S   S  +Q   +  R+         +S     
Sbjct: 693 GEVLTTPVAFTALSLFT-LLRDPLDRVSDMLSFAIQSKVSLERV------GAFLSEAETE 745

Query: 438 KYKPHRGVVEFKDVSF-----SYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
           KY+      E K ++F     S+ T  S    +NLN     G    ++G +G GK+++ +
Sbjct: 746 KYEQLTVDNEGKKLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLM 805

Query: 493 LLLRYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
            LL   +   G I++   + +     N       I    Q   L++ T+R+NI +  ++ 
Sbjct: 806 ALLGEMHICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFD 865

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILIL 609
             +     V + C              T IG +G  LSGGQKQRI++ARAL      L+L
Sbjct: 866 ENR--YHKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLL 923

Query: 610 DEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
           D+  SA+D  +   I  N   G LM  +  T I ++H ++   R+  ++V+  DG V + 
Sbjct: 924 DDCLSAVDSHTASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRVKDQ 981

Query: 668 G 668
           G
Sbjct: 982 G 982

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 144/531 (27%), Positives = 246/531 (46%), Gaps = 64/531 (12%)

Query: 188  RFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVS 247
            +F LL  L  R    L    +++ LH    + D   +G +++R   D    + S+  +++
Sbjct: 918  QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELT 973

Query: 248  DGVKALICGV---VGVGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ--E 301
            + ++ ++  V   +GV +MC +  P  +I +    P +L    +     ++T ++++  E
Sbjct: 974  ESIRLMLSQVGNLIGVIVMCIVYLPWFAIAV----PFLLIIFVLICDHYQSTGREIKRLE 1029

Query: 302  ATGQ--LTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXS 359
            A  +  +     E L G+ T++++ ++   L++ +  I  + + G               
Sbjct: 1030 AVQRSFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLINKMNEAGYLIVAVQRWVAI--- 1086

Query: 360  LLGDLSFLTVLAYGSYLVLQ----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGA 415
            LL  ++ +  L      V +    S  S+G L  ++L      N +    T     M  A
Sbjct: 1087 LLDSVAVVFALIITLLCVTRAFPISAGSVGVLLTYVLQLPGLLNTILRALTQTENDMNSA 1146

Query: 416  G-----AASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQI-FKNLNF 469
                  A     E   RKP +SP       P +G ++F DV+F+Y  RP + +  KN+N 
Sbjct: 1147 ERLVTYATELPLEAAYRKPEVSPPESW---PEKGDIDFIDVNFAY--RPGLPVVLKNMNL 1201

Query: 470  KIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQ 529
            KI  G  + I G +G GKSTI   L R    S G I+ID  DI K+    LR+ + I+ Q
Sbjct: 1202 KINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQ 1261

Query: 530  EPVLMSGTIRDNITYGLTYTPTKE---------EIRS-VAKQCFCHNFITKFP---NTY- 575
            +PVL  GTIR N+       P KE          IR+ V ++   ++   + P   N+Y 
Sbjct: 1262 DPVLFRGTIRKNL------DPFKECSDDLLWDALIRTGVVERENLNDIKLEKPDENNSYS 1315

Query: 576  -------DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
                   D ++   G+  S G++Q +A+ RAL++   ILILDEATS++D E++G I    
Sbjct: 1316 NMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRI 1375

Query: 629  GHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
              + +    TI+ IAHRL TI   + ++VL   G + E  K  +L+ +  S
Sbjct: 1376 --VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELFNDKNS 1423

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 99/208 (47%), Gaps = 33/208 (15%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F +LN +I  G  + + GP G GK+++   +  +   ++G + ++ +             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR--SVAKQCFCHNFITKFPNTYDTVIGS 581
             ++   P +++ T+RDNI +G  Y    EE R   + + C     +   P    T IG 
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 582 RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS------K 635
           RG  LSGGQK RI +ARA+ K   I + D+  SA+D       +    H+M        K
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVD-------SRVGKHIMDDCLLGILK 735

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGS 663
             T I   H+LS I R++ +IV+G +GS
Sbjct: 736 GKTRILATHQLSVIERADRIIVVGPNGS 763

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  141 bits (356), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 126/486 (25%), Positives = 220/486 (45%), Gaps = 55/486 (11%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ K +H    FFD+  +G +++R   D     + +T  +     +L+  V  V ++  +
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 267  SPQ------LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
            +PQ      L  +L +F      + S   K++ + S+        + +   E L G+ T+
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISR------SPIYQHFSETLVGVTTI 1241

Query: 321  QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ- 379
            ++F   G+E       ++ I +                  +  +  L +   G +++L  
Sbjct: 1242 RAF---GDESRFMRENLQKIDENNRPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLLNI 1298

Query: 380  SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD--RKPS----ISP 433
              +  G     + Y          L   YS +     +  RL E  D  ++P     ++P
Sbjct: 1299 DHIDSGKAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQSILTP 1358

Query: 434  TAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
                   P +G +E  D+S  Y P  P  ++ KN++F + P S V IVG +G GKSTI  
Sbjct: 1359 PVEW---PQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAGKSTIIT 1413

Query: 493  LLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-- 550
             L R+ +P TG I ID+ DIT ++ + LRR I I+ Q+P L +GTI+ N+     YT   
Sbjct: 1414 ALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTDQQ 1473

Query: 551  -----------TKEEIR---SVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAI 596
                       T+EE+    +          I KF +   + I   G  +S GQ+Q + +
Sbjct: 1474 IFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLDL-SSEISEGGGNISQGQRQLVCL 1532

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYT----FGHLMKSKSMTIISIAHRLSTIRRS 652
            AR+L++ P I++LDEAT+++D  S+  I  T    FG        TI++IAHRL ++   
Sbjct: 1533 ARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFG------GNTILTIAHRLRSVIDY 1586

Query: 653  ENVIVL 658
            + ++V+
Sbjct: 1587 DKILVM 1592

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 108/479 (22%), Positives = 208/479 (43%), Gaps = 38/479 (7%)

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           ++ ++ D E   +  +G +I+ +  DA+ VS  +   +   V+A++  +V   ++  L  
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHLLG 520

Query: 269 QLSIL---LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
             +I+   L+    P+ F  + +   ++   K+    T +  +   E    I+ ++ F  
Sbjct: 521 FAAIVGAALIVAMMPLNFKLATWLGHLQ---KETLSVTDKRIQKLNEAFQAIRIIKFFSW 577

Query: 326 EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLS 383
           E N    +   IRD+ +                S +  ++   +T  A+  Y+ +Q ++ 
Sbjct: 578 ENN----FEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEVL 633

Query: 384 IGDL--TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKP 441
              +  TA  L++      +  LS   S ++Q   +  R+ E  + K +       KY  
Sbjct: 634 TTPIAFTALSLFS-LLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDT------EKYNQ 686

Query: 442 HRGVVEFKDVSFSYPT------RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL 495
                + K + F   T      RP  ++ KNLN     G    I+GP+G GK+++ + LL
Sbjct: 687 LSTAKDKKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPTGSGKTSLLMALL 745

Query: 496 RYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK 552
              +  +G I++   D +    +    +   +    Q   L++ T+++NI +   Y   +
Sbjct: 746 GEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGR 805

Query: 553 EEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEA 612
            E  +V + C      +       T IG RG  LSGGQKQRI++AR+L      ++LD+ 
Sbjct: 806 YE--AVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDC 863

Query: 613 TSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            SA+D  +   I  N   G LM+ +  T I ++H  +   R+  ++V   +G V   G+
Sbjct: 864 LSAVDSHTASWIYDNCITGPLMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQGE 920

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  141 bits (356), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 150/530 (28%), Positives = 242/530 (45%), Gaps = 69/530 (13%)

Query: 173  FFTVALLIGC-AANFGRF-ILLRILS-ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 229
            + TV  LIG   A  G F  ++  LS  R   ++  +++   LH    FFD   VG +++
Sbjct: 1041 YLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMN 1100

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVF- 288
            R   D   V + +   +   +  LI     + ++  ++P+      F T  V+     F 
Sbjct: 1101 RFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPR------FLTVAVIVFVLYFF 1154

Query: 289  -GKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQV 343
             GK     S++L+         + +   E L G+ T+++F   G+E       +  I Q 
Sbjct: 1155 VGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAF---GDERRFILENMNKIDQN 1211

Query: 344  GXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQLSIGDLTAFMLYTEYTG 398
                             +  +    VLA GS+++L      S L+   LT  +L+T+   
Sbjct: 1212 NRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD--- 1268

Query: 399  NAVFGLSTFYSEIMQGAGAASRLFELT--DRKPSISPTAG------HKYKPHRGVVEFKD 450
                 L   YS       +  RL E +  +++  +    G          P  G +E ++
Sbjct: 1269 -GALWLVRLYSTFEMNMNSVERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIEN 1327

Query: 451  VSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDD 509
            +S  Y P  P V   +N++FK+ P S + IVG +G GKSTI   L R   P TG I ID 
Sbjct: 1328 LSLRYAPNLPPV--IRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDG 1385

Query: 510  QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK----------------- 552
            QDI+K++  +LRR I I+ Q+P+L +GTI+ N+     Y   K                 
Sbjct: 1386 QDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFE 1445

Query: 553  EEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEA 612
            E + S  +    HN   KF N + T I   G  LS G++Q + IAR+L+++P I++LDEA
Sbjct: 1446 EVLNSEERFNSTHN---KFLNLH-TEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEA 1501

Query: 613  TSALDVESE----GAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVL 658
            TS++D +S+    G I   F     +KS TI++IAHRL ++   + +IV+
Sbjct: 1502 TSSIDYDSDHLIQGIIRSEF-----NKS-TILTIAHRLRSVIDYDRIIVM 1545

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 221/510 (43%), Gaps = 55/510 (10%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM-----CSLSPQLSILLLFF 277
            +G +I+ +  D++ VS  +   +   V+A+I  +V VG++      S    +SI+L+ F
Sbjct: 444 NLGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMF 502

Query: 278 TPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAI 337
            P     A++ GK  + T K     T Q      E L  I+ V+ F  E N        I
Sbjct: 503 -PLNFLLANLLGKFQKQTLK----CTDQRISKLNECLQNIRIVKYFAWERN-------II 550

Query: 338 RDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-VLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
            +I  +               S+   L F+T  L  G    + + +   DL A + +T  
Sbjct: 551 NEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHEDLNAPLAFTTL 610

Query: 397 TGNAVFG-----LSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDV 451
           +   +       LS   S I Q   +  R+ +   R             P +  +EFK+ 
Sbjct: 611 SLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFL-RMDDTEKYNQLTISPDKNKIEFKNA 669

Query: 452 SFSYPTRPS-VQIFK--NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           + ++    S +  FK   LN K   G    I+G +G GKS + L LL   N  +G+I++ 
Sbjct: 670 TLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVP 729

Query: 509 D----QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
                 D+   +C+ L        Q   L++ T+++NI +   Y   ++    V   C  
Sbjct: 730 SLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYN--EDRYNKVIDACGL 786

Query: 565 HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              +   P    T IG +G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I
Sbjct: 787 KRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWI 846

Query: 625 --NYTFGHLMKSKSMTIISIAHRLS-TIRRSENVIVL-----GHDGSVVEM---GKFKKL 673
             N   G LMK++  T I + H +S T+R +   IVL      + G++ E+   G FK+ 
Sbjct: 847 YENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLFKEK 904

Query: 674 YANPTSALSQLLNER-----AAPGPSDQQQ 698
           Y   +S  S  +NE+      AP  +D Q+
Sbjct: 905 YVQLSSRDS--INEKNANRLKAPRKNDSQK 932

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 139/512 (27%), Positives = 225/512 (43%), Gaps = 65/512 (12%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++   LH    FFD   +G +++R   D   V + +T  +      L+  V  + ++  +
Sbjct: 1164 LLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTMLLIAFI 1223

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQS 322
            +PQ  IL +F    + F   + G      S++L+         + +   E L GI T+++
Sbjct: 1224 TPQFLILAIF----IGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTIRA 1279

Query: 323  FVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL 378
            +  E       L + +   +  F +               SL+       V   G +++L
Sbjct: 1280 YGDEKRFMLENLHKIDENNKPFFYLWAFNRWLSFRIDMIGSLV-------VFGAGVFIIL 1332

Query: 379  Q-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP-- 429
                  S L+   LT  + +TE    A   L  FY+++     +  RL E    D++P  
Sbjct: 1333 NIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQEPYE 1388

Query: 430  ---SISPTAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGR 485
                 S        P  G +E  ++S  Y P  P  ++ KN+ F + P   V +VG +G 
Sbjct: 1389 EHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVVGRTGA 1446

Query: 486  GKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN---- 541
            GKSTI   L R+ +  TG I IDD DIT +N   LRR I I+ Q+P L SGTIR N    
Sbjct: 1447 GKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDPY 1506

Query: 542  -------ITYGLTYTPTKEEIRSVAKQCFCHNF-----ITKFPNTYDTVIGSRGTLLSGG 589
                   I   L       E  S        +      + KF N  +  I   G  LS G
Sbjct: 1507 NEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKNE-ITEGGNNLSHG 1565

Query: 590  QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI 649
            Q+Q + +AR+L++ P I++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++
Sbjct: 1566 QRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAHRLRSV 1623

Query: 650  RRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
               + ++V+       + G+ K+ Y +P S L
Sbjct: 1624 CDYDKILVM-------DAGEVKE-YDHPYSLL 1647

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 110/464 (23%), Positives = 206/464 (44%), Gaps = 38/464 (8%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSI----LLLFFT 278
            +G +I+ +  DA+ VS  +   +   V+AL+  VV + ++  L    ++    L++ F 
Sbjct: 511 NLGAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFL 569

Query: 279 PPVLFSASVFG----KQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYN 334
           P  L  A++ G    K +  T K +Q+          E    I+ ++ F  E N  +R  
Sbjct: 570 PLNLKLATLLGEYQKKSLAVTDKRIQKLN--------ETFQAIRIIKYFSWEDN-FTRDI 620

Query: 335 VAIRD-----IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
             +R+     +F+                S++   SF    A+  Y+  ++  +    TA
Sbjct: 621 ETVREKELHLLFKRSLIWAFSSFIWFITPSIVTSCSF----AFYIYVQGETLTTPVAFTA 676

Query: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFK 449
             L+T      +  LS   S ++Q   +  R+ +L   K +    +      +   + F+
Sbjct: 677 LSLFT-LLKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKET-EKYSQLTIDKNGNRIAFQ 734

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI-- 507
           + + ++  + S    ++LN    PG    ++GP+G GKS++ L LL   +   G I++  
Sbjct: 735 NATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIVPS 794

Query: 508 -DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            D +D   ++   +   I    Q   L++ T+R+NI +   Y   +    +V + C    
Sbjct: 795 LDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEAR--YNAVVEACCLKR 852

Query: 567 FITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-- 624
                     T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  
Sbjct: 853 DFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTALWIYD 912

Query: 625 NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           N   G LM+++  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 913 NCITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 954

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 148/576 (25%), Positives = 265/576 (46%), Gaps = 71/576 (12%)

Query: 141  GIVLDTLKTSSGSDFFELKIPIFSLPLYEFLSFFTVAL---LIGCAANFGRFILLRILSE 197
             I+L++  + S S++   K+   +   Y  + +F + L   ++G       F  + I + 
Sbjct: 1072 NILLNSCDSKSASEYVTQKVNNHTTKYY-LIIYFAIGLAHSILGSIKTMLSF-YVGINAS 1129

Query: 198  RVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVK---ALI 254
            R + +L   ++ K LH    FFD+  +G +++R   D   + + +T  V   V     LI
Sbjct: 1130 RKIFKL---LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYVESVVYNSVQLI 1186

Query: 255  CGVVGVGMMCS---LSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE 311
              V+ +  + +   +   L ILL +F      S S   K+  +T+K        + +   
Sbjct: 1187 ATVLLITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTK------SPIYQHFS 1240

Query: 312  EQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLA 371
            E L G+ T++++   G+E+      +  I +                  +  +  L +  
Sbjct: 1241 ETLVGVTTIRAY---GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFG 1297

Query: 372  YGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD 426
             G  +++      S L+   LT  + +TE    +   L   YS +     +  R+ E  D
Sbjct: 1298 AGVLVLMNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMD 1353

Query: 427  --RKP-SISPTAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGP 482
              ++P S       K  P  G +E  D+S  Y P+ P  ++ KN++F + P   V +VG 
Sbjct: 1354 IEQEPYSAGIVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGR 1411

Query: 483  SGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+ +P TG I ID+ DIT ++ K LR+ I I+ Q+P L +GTI+ N+
Sbjct: 1412 TGAGKSTIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL 1471

Query: 543  TYGLTYTPTK-----------------EEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTL 585
                 Y   +                  ++ SV+ +      + KF N   + I   G+ 
Sbjct: 1472 DPYNEYNDDQIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLNL-QSEISEGGSN 1525

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + K  TI++IAHR
Sbjct: 1526 LSQGQRQLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHR 1583

Query: 646  LSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
            L ++   + ++V+       + G+ K+ Y +P S L
Sbjct: 1584 LRSVIDYDKILVM-------DAGEVKE-YDHPYSLL 1611

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 127/542 (23%), Positives = 228/542 (42%), Gaps = 67/542 (12%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------- 208
           FL+  TVA+  G A  FGR I +R    I+SE     LR  V                  
Sbjct: 404 FLARATVAVSDGLALFFGRRICIRMRSIIISEIYSKALRRQVSNSSDAEKSKDDFEIDPQ 463

Query: 209 ----KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR--SMTQKVSDGVKALICGVVGVGM 262
               KK ++ D E      +G +I+ +  D + ++   +     +      I  +V +  
Sbjct: 464 EENDKKNVNGD-EKSKTANLGAIINLMAVDTFKIADIGAYMHFFAGSFIMTIIALVLLYK 522

Query: 263 MCSLSPQLSILLLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321
           +  ++  +  +LL    PV F  A++ G+  + T       T Q  +   E L  I+ ++
Sbjct: 523 LLGVAAIVGTILLLCMIPVSFKLATLLGEYQKKT----LAVTDQRIQKLNEVLQAIRIIK 578

Query: 322 SFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL--TVLAYGS---YL 376
            F  EGN          +I  +               +L G + +L  T++  GS   Y+
Sbjct: 579 FFSWEGN-------FEEEILTIREKELKILLIRSAVWALGGFVWYLTPTIVTAGSFAYYI 631

Query: 377 VLQ-SQLSI-GDLTAFMLYTEYTG--NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS 432
            +Q  QL+     TA  L++   G  + +  +++F  +         +  +  D K    
Sbjct: 632 FIQGEQLTTPVAFTALSLFSLLRGPLDQISDMASFVIQSKVSLDRIQKFLDEDDTKKYEQ 691

Query: 433 PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIAL 492
            + G+K       +  ++V+ S+  +      +NLN     G    ++GP+G GK+++ +
Sbjct: 692 LSLGNK-------ISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLM 744

Query: 493 LLLRYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
            LL   +   G I +   D +     +   L   +    Q   L++ T+++NI +   Y 
Sbjct: 745 ALLGEMHLLEGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEY- 803

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILIL 609
             +E   +V   C              T IG RG  LSGGQKQRI++ARAL      ++L
Sbjct: 804 -NEERYLAVISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILL 862

Query: 610 DEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLS-TIRRSENVIVLGHDGSVVE 666
           D+  SA+D  +   I  N   G LM+++  T I ++H ++ T++ +E VI++  +G +  
Sbjct: 863 DDCLSAVDSHTAAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMID-NGKISH 919

Query: 667 MG 668
           +G
Sbjct: 920 IG 921

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 232/510 (45%), Gaps = 63/510 (12%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ K LH +  FFD+  +G +++R   D   V + +   +   +  +I     + ++  +
Sbjct: 1144 LLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLITYI 1203

Query: 267  SPQLSILL-----LFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGI 317
            +P+  I+      L++   VL+ A          S++L+         + +   E L G+
Sbjct: 1204 TPEFLIIAILVAGLYYAIGVLYLAG---------SRELKRFDSITKSPIYQHFSETLVGV 1254

Query: 318  KTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV 377
             TV+++  E     R N+ + D  +                  +  +  L +   G +++
Sbjct: 1255 TTVRAYGDEA-RFMRENLKMID--ENNKPFFYLWVSNRWLAFRIDVVGALVIFGSGVFVL 1311

Query: 378  LQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL--TDRKPS 430
            L      S L+   L+  + +TE    +   L   YS +     +  RL E    +++P 
Sbjct: 1312 LNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEVEQEPY 1367

Query: 431  IS-----PTAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSG 484
             S     P++     P  G +E  DVS  Y P  P  ++ KN  F + P   V IVG +G
Sbjct: 1368 KSSSLDVPSSW----PEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVGRTG 1421

Query: 485  RGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 544
             GKSTI   L R+ +P TG+I ID+ DI+ +  K LRR I I+ Q+P L SGTI+ N+  
Sbjct: 1422 AGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDP 1481

Query: 545  GLTYTP-------------TKEEIRS--VAKQCFCHNFITKFPNTYDTVIGSRGTLLSGG 589
               Y+              T++E+ S    +Q        KF N  +  I   G+ LS G
Sbjct: 1482 YDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNV-NNEISEGGSNLSQG 1540

Query: 590  QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI 649
            Q+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  +  +    TI++IAHRL T+
Sbjct: 1541 QRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRLRTV 1598

Query: 650  RRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
               + ++V+   G V E      L  N  S
Sbjct: 1599 IDYDKILVMDA-GEVKEFDHPYSLLLNKNS 1627

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 124/561 (22%), Positives = 239/561 (42%), Gaps = 89/561 (15%)

Query: 167 LYEFLSFFTVALLIGCAAN---FGRFILLRILSERVVARLRAHVIKKTL----------- 212
           LY FL FF   ++  C+     FGR + +R+ S  +V+ + +  +K+ +           
Sbjct: 398 LYVFLMFFCRVIVAACSGQALFFGRRVCVRMRS-ILVSEIYSKALKRKISNDKSASLKDL 456

Query: 213 ----------HQDAEFFDNHK------VGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256
                       D E  D  +      +G +I+ +  D + V+  +   +   V+A++  
Sbjct: 457 NEQEEVDPQIENDLENIDGDEESKSSNLGSIINLMAVDTFKVA-DICAYLHHFVEAVVMT 515

Query: 257 VVGVGMMCSLSPQLSIL---LLFFTPPVLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEE 312
           +V + ++  L    +I+   L+    P+ F  AS+ GK      K   E T +  +   E
Sbjct: 516 IVALILLFKLLGVAAIVGASLIIALLPLNFKLASLLGKY----QKKSLEVTDKRIQKLNE 571

Query: 313 QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVL-- 370
               I+ ++ F  E N         +DI +V               ++   + F+T    
Sbjct: 572 AFQAIRIIKFFSWEDN-------FEKDILEVRERELRMILIRSIVWAISSFVWFVTPTIV 624

Query: 371 ---AYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL--------STFYSEIMQGAGAAS 419
              ++  Y+ +Q ++         +   +T  ++F L        S   S ++Q   +  
Sbjct: 625 TGASFTYYVYVQGEV-------LTIPVAFTALSLFALLKIPLDTFSDMLSFVIQSKVSLD 677

Query: 420 RLFELTDRKPSISPTAGHKYK-----PHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPG 474
           R+ E  + + +       KY+      ++  + FK+ + ++         +N++     G
Sbjct: 678 RIQEFLEEEDT------KKYEQLTVDKYQNKIAFKNATTTWNKEKQDFKLRNIDIDFKIG 731

Query: 475 SSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEP 531
               I+GP+G GK+++ + LL   +   G I++   D ++  K++   L   I    Q  
Sbjct: 732 KLNVIIGPTGSGKTSLLMALLGEMDLIDGEIIVPCLDPREDLKLDANGLTNSIAYCSQAA 791

Query: 532 VLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD-TVIGSRGTLLSGGQ 590
            L++ T+R+NI +    +P  EE  +   +        +  N  D T IG RG  LSGGQ
Sbjct: 792 WLLNDTVRNNILFN---SPYCEERYNAVVEASGLKRDFEILNAGDMTEIGERGITLSGGQ 848

Query: 591 KQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLST 648
           KQR+++ARAL      L+LD+  SA+D  +   I  N   G LM+++  T I ++H ++ 
Sbjct: 849 KQRVSLARALYSNSKHLLLDDCLSAVDSHTATWIYDNCISGPLMENR--TCILVSHNIAL 906

Query: 649 IRRSENVIVLGHDGSVVEMGK 669
             R+ + +V   +G +VE G+
Sbjct: 907 TLRNADYVVKLENGKIVEHGE 927

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 142/574 (24%), Positives = 237/574 (41%), Gaps = 82/574 (14%)

Query: 156  FELKIPIFSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRAH 206
            FE +   F + LY F  F         FT+   IG  A+                 L   
Sbjct: 927  FENRSESFYMGLYSFFVFGAYIFMTSQFTILCYIGIGAS---------------KNLNIQ 971

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
             +K+ +H    F D   +G +++R   D   +   + + V   V      +VGV +MC +
Sbjct: 972  ALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQF-ANIVGVCVMCIV 1030

Query: 267  S-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
              P  +I + F     +F  + +    R   +        +     E L G+ T++ + +
Sbjct: 1031 YLPWFAIAVPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFNEILGGMDTIKFYKS 1090

Query: 326  EGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL--- 382
            E   +++ +  I  + + G               ++  ++F  ++   + L +  Q    
Sbjct: 1091 EERYIAKSDYLIDKMNEAGYLTVCVQRWVAILVDMIA-VAFALII---TLLCVTRQFHIS 1146

Query: 383  --SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL--------FELTDRKPSIS 432
              S+G L  ++L      N    L    S++     +  RL         E    KP  +
Sbjct: 1147 ASSVGVLLTYVLQLPGLFNT---LLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPETA 1203

Query: 433  PTAGHKYKPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIA 491
            P       P  G ++F++V F+Y  RP + I  KN+N +I     + I G +G GKSTI 
Sbjct: 1204 PPESW---PEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIM 1258

Query: 492  LLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN---------- 541
              L R    ++G+I+IDD DI K+    LR+ + I+ Q+PVL  G IR N          
Sbjct: 1259 TALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDE 1318

Query: 542  -----ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTY--DTVIGSRGTLLSGGQKQRI 594
                 +  G    P  E++     Q    +  +   + +  D V+   G   S G++Q +
Sbjct: 1319 ELWDVLVRGGAIAP--EDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQIL 1376

Query: 595  AIARALIKKPTILILDEATSALDVESEGAIN----YTFGHLMKSKSMTIISIAHRLSTIR 650
            A+ RAL++   ILILDEATS++D E++  I       F H       TI+ IAHRL TI 
Sbjct: 1377 ALTRALVRNTKILILDEATSSVDYETDRKIQERIATAFSHC------TILCIAHRLKTIL 1430

Query: 651  RSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
              + ++VL H G V E      L+ + T+    +
Sbjct: 1431 NYDRILVLEH-GEVAEFDTPMNLFKDETTIFHNM 1463

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 108/206 (52%), Gaps = 20/206 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F NLNF+I  G  V I GP G GK+++      +   ++GTI I+  D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
             ++   P + + T+RDNI +G  Y   K   + V + C   + +   P    T IG RG
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEEDK--YKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKSMTIISI 642
             LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++     L+ +K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMG 668
            H+LS I ++  +IVLG+DGS VE+G
Sbjct: 775 -HQLSLIDKASRIIVLGNDGS-VEIG 798

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 128/503 (25%), Positives = 225/503 (44%), Gaps = 49/503 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++KK L+    FFD+  +G +++R   D   V + +T  V     +L+  +  V ++  +
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326
            +P    + +F           +    R   +    +   + +   E L GI T+++F   
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAF--- 1249

Query: 327  GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-----SQ 381
            G+E       +  I +                  +  +    + A G +++L      S 
Sbjct: 1250 GDERRFMQENLTKIDENNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSG 1309

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK--- 438
            L+   LT  + +TE        L   YS +     +  RL E  + +      + H    
Sbjct: 1310 LAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHNPPP 1365

Query: 439  YKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
              P +G +E  D+S  Y P+ P  ++ KN+ F + P   V IVG +G GKSTI   L R+
Sbjct: 1366 EWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTIITALFRF 1423

Query: 498  YNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP------- 550
             +P +G I ID+ DIT +  K LR+ I I+ Q+P L +GT++ N+     Y+        
Sbjct: 1424 LDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDKQIFEAL 1483

Query: 551  ------TKEEIRSVAK------QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIAR 598
                  T+EE+   A            N + KF    +  I   G+ LS GQ+Q + +AR
Sbjct: 1484 KRVNLVTQEELDHAANPSPDNASAVSEN-VNKFL-FLENEISEGGSNLSQGQRQLVCLAR 1541

Query: 599  ALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVL 658
            +L++ P +++LDEAT+++D +S+  I  T     +    TI++IAHRL +I   + ++V+
Sbjct: 1542 SLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLRSIIDYDKILVM 1599

Query: 659  GHDGSVVEMGKFKKLYANPTSAL 681
                   + G+ K+ Y +P S L
Sbjct: 1600 -------DAGEVKE-YDHPYSLL 1614

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 107/468 (22%), Positives = 202/468 (43%), Gaps = 38/468 (8%)

Query: 224 VGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL---SPQLSILLLFFTPP 280
           +G +I+ +  DA+ VS  +   +   V+AL+  +V + ++  L   S  +  LL+    P
Sbjct: 472 LGAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKLLGWSAIIGALLIVAILP 530

Query: 281 VLFS-ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD 339
           + F  A++ GK      K+    T +  +   E    I+ ++ F  E N         +D
Sbjct: 531 LNFRLATLIGK----LQKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN-------FEKD 579

Query: 340 IFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVLQSQLSIG--DLTAFML 392
           I  +               +L   + F+T      +++  Y+ +Q ++       TA  L
Sbjct: 580 IQSIRDQELKMLVKRSVAWALTAFVWFITPTIVTSVSFAFYIYVQGEVLTTPVAFTALSL 639

Query: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVS 452
           +T    N +  LS   S ++Q   +  R+    +           +   HR  + F++ +
Sbjct: 640 FT-LLRNPLDMLSDMLSYVIQSKVSLDRV---QEFLEEEETEKYEQITVHRNKIGFENAT 695

Query: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIM---IDD 509
           FS+  +      KN+N     G    ++GP+G GK+++ + LL   +   G +    +D 
Sbjct: 696 FSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDP 755

Query: 510 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKE-EIRSVAKQCFCHNFI 568
           ++   +    +   I    Q   L++ T+++NI +    +P  E    +V + C      
Sbjct: 756 REDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVIEACGLKRDF 812

Query: 569 TKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NY 626
                   T IG +G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N 
Sbjct: 813 EILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENC 872

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
             G LM+ +  T I ++H ++   ++   +V   +G V + G+  +LY
Sbjct: 873 ISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 142/560 (25%), Positives = 256/560 (45%), Gaps = 71/560 (12%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A      G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LS+     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     L S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNINNLDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK-----YKPHRGVVEFKDV 451
                   L   YSE+     +  R+ E  + +    P   HK       P  G +E  D+
Sbjct: 1332 ---GALWLVRLYSEVEMNMNSVERVKEYMEIEQE--PYNEHKEIPPPQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQ 510
            S  Y P  P  ++ KN++F +   S + IVG +G GKSTI   L R+  P TG I ID+ 
Sbjct: 1387 SLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP-------------TKEEI-- 555
            DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++              ++E++  
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQ 1504

Query: 556  ---RSVAKQCFCHNF--ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
               R  + +    N   + KF +   + I   G+ LS GQ+Q + +AR+L++ P I++LD
Sbjct: 1505 GATRETSNEASSTNSENVNKFLDL-SSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLD 1563

Query: 611  EATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+++D  S+  I  T     + +  TI++IAHRL ++   + ++V+       + G+ 
Sbjct: 1564 EATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEV 1614

Query: 671  KKLYANPTSALSQLLNERAA 690
            K+ Y +P S    LLN+++A
Sbjct: 1615 KE-YDHPYSL---LLNKQSA 1630

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 115/536 (21%), Positives = 219/536 (40%), Gaps = 56/536 (10%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRLLGF 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +I+ +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN- 578

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLT-----VLAYGSYLVLQSQLSI 384
                   +DI  +               S+   L F+T       ++  Y+ +Q ++  
Sbjct: 579 ------FEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQGEVLT 632

Query: 385 G--DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYK-- 440
                TA  L+T    + +  LS   S ++Q   +  R+ +  +   +       KY   
Sbjct: 633 TPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDT------KKYDQL 685

Query: 441 ---PHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRY 497
              P+     F++ + S+         K+LN +   G    ++GP+G GK+++ + LL  
Sbjct: 686 TIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGE 745

Query: 498 YNPSTGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE 554
                G +++   + +    ++       I    Q   L++ T+++NI +   +   +  
Sbjct: 746 MYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEAR-- 803

Query: 555 IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
            ++V + C              T IG +G  LSGGQKQR+++ARAL      ++LD+  S
Sbjct: 804 YKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLS 863

Query: 615 ALDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           A+D  +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 864 AVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 139/538 (25%), Positives = 240/538 (44%), Gaps = 47/538 (8%)

Query: 180  IGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 237
            +G AA  N    ++L   S R   +L  ++ K  +     FF+   VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDA 1088

Query: 238  VSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSK 297
            V  S+    S   K+++  +V V ++    P   +  +F     ++  + +    R   +
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQTFYIVLSRELKR 1148

Query: 298  DLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRDIFQVGXXXXXXX 351
             +  +   +  +  E L+G   + +      F+    E  +YN+     F+         
Sbjct: 1149 LISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVR 1208

Query: 352  XXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAVFGLSTFYSE 410
                    +L      T +   + +  + QLS G +   M Y+ E TG+  + + T    
Sbjct: 1209 LQTIGATIVLA-----TAMLALTTMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVM- 1262

Query: 411  IMQGAGAASRLFE---LTDRKPSISP-TAGHKYKPHRGVVEFKDVSFSYPTRPSVQ-IFK 465
            I     +  R+ E   L     SI+P     +  P +G +EFK+ S  Y  R ++  + K
Sbjct: 1263 IETNIVSVERIVEYCELPSEARSINPENRPDESWPSKGSIEFKNYSTKY--RENLDPVLK 1320

Query: 466  NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIG 525
            ++N +I P   + IVG +G GKST++L L R   P+ G+I+IDD +I+ +    LR H+ 
Sbjct: 1321 DINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLA 1380

Query: 526  IVQQEPVLMSGTIRDNITYGLTYTPTK-------------------EEIRSVAKQCFCHN 566
            I+ Q+     GT+R N+     Y+  +                    EIR        + 
Sbjct: 1381 IIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENG 1440

Query: 567  FITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
             ++   N     I   GT LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E++  I  
Sbjct: 1441 NVSDVLNVK---INENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQD 1497

Query: 627  TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
            T     K +  TI++IAHR+ T+  S+ +IVL  +G+V E     KL ++  S    L
Sbjct: 1498 TIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLSDKASIFYSL 1552

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 155/330 (46%), Gaps = 50/330 (15%)

Query: 398 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTAGHKYKPHRGVVEFKD 450
            +A++ + +  + I++ + +  RL  F L+D         I P+   +  P   V+E  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP---VIEMNN 619

Query: 451 VSFSYPTRPSV--------------------QI-FKNLN-FKIAPGSSVCIVGPSGRGKS 488
           ++F + ++ ++                    QI  KN++ F+   G  VC+VG  G GKS
Sbjct: 620 ITFLWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKS 679

Query: 489 TI---ALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG 545
           T     L  L   + S G+I        K+  ++    +    QE  +M+ ++R+NI +G
Sbjct: 680 TFLKGILGQLPCMSGSKGSIP------PKLIIRA--SSLAYCSQESWIMNSSVRENILFG 731

Query: 546 LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPT 605
             +     ++    K C     +   P+  +T++G +G  LSGGQK R+++ARA+  +  
Sbjct: 732 HKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRAD 789

Query: 606 ILILDEATSALDVE-SEGAINYTF-GHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGS 663
           I +LD+  SA+D E S+  + Y   G     K+ TII   + +  ++ S+ +  L  +G 
Sbjct: 790 IYLLDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYAL-ENGE 848

Query: 664 VVEMGKFKKLY--ANPTSALSQLLNERAAP 691
           ++E G ++ +    N  S L +LL E  +P
Sbjct: 849 IIEQGNYEGVMNRENTNSKLKKLLEEFDSP 878

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 128/504 (25%), Positives = 232/504 (46%), Gaps = 50/504 (9%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ + ++    FFDN  +G +++R   D  V+   +   +       I  V  + ++  +
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQS 322
            +P+  I+ +F    ++ S+   G      S++L+  E++ +  + +   E LSG+ T+++
Sbjct: 1199 TPKFLIIAIF----IICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRA 1254

Query: 323  FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQ- 381
            F   GNE+      +  I +                  +  L  +TV   G++++L +  
Sbjct: 1255 F---GNEIKFLKENLDFIDENNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILLNADK 1311

Query: 382  ----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP-------S 430
                L+   LT  + +TE+       +  FYS +     +  RL E  + +        +
Sbjct: 1312 IDAGLAGISLTYAVTFTEF----CLWMVKFYSTVEMSMNSVERLKEYMEIEEEALADPGA 1367

Query: 431  ISPTAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKST 489
            I+P+      P +G + F + S  Y P  P V   K LN KI  GS + +VG +G GKST
Sbjct: 1368 ITPSENW---PVQGAITFANYSLRYAPKLPDV--LKQLNLKIDGGSKIGVVGRTGAGKST 1422

Query: 490  IALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
            I   L R+ + S+G I+IDD DI+++N + LR  + I+ Q+P L  GTIR N+     Y 
Sbjct: 1423 IISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYE 1482

Query: 550  PTKEEIRSVAKQCFCHNFITKF-----------PNTY---DTVIGSRGTLLSGGQKQRIA 595
                    V       +++               N +   D+ I   G  LS GQ+Q I 
Sbjct: 1483 NKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLIC 1542

Query: 596  IARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENV 655
            +AR+++    I++LDEAT+++D +S+  +  T  +    K  TI++IAHR+ ++   + +
Sbjct: 1543 LARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKI 1600

Query: 656  IVLGHDGSVVEMGKFKKLYANPTS 679
            +VL   G  +E      L  N +S
Sbjct: 1601 LVLDA-GQALEFDHPYVLLQNKSS 1623

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 119/474 (25%), Positives = 213/474 (44%), Gaps = 60/474 (12%)

Query: 225 GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL----LLFFTPP 280
           G +I+ + +DA  V   +   +   ++ALI  VV V ++  +    + +    ++FF P 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIPF 554

Query: 281 VLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
            +F   +  +  R T       T Q  +   E    I+ ++SF  E N + +    I  +
Sbjct: 555 NVFLTKLIARFQRET----LTFTDQRIQNLNETFQSIRIIKSFGWENNIIQK----ILGL 606

Query: 341 FQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398
                             +L+  LS   +T L++  Y+++  Q    DLT       +T 
Sbjct: 607 RNKEISVLKRNSITWSINALVWYLSPTIITTLSFSYYILVDKQ----DLTT---PVAFTA 659

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVS------ 452
            A+F L    + + Q +   + L   T  K S+      K+   +   +F+++S      
Sbjct: 660 LALFNL--LKAPLDQLSNTINFL---TQSKVSLDRI--EKFLSVKETTKFENLSVDSSQN 712

Query: 453 ---FSYPT------RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTG 503
              FS  T      + S Q+ +N+N +   G    ++GP+G GK+++ + LL   +  +G
Sbjct: 713 RLAFSGATLGWCGNKKSFQL-RNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSG 771

Query: 504 TIMIDDQDITKMNC----KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
            + + + + +K N      +L   I    Q P + + TIR+NI + + Y   K+   +V 
Sbjct: 772 KVFVPNLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVV 828

Query: 560 KQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
             C              T++G +G+ LSGGQKQRI++ARAL  K   LILD+  SA+D  
Sbjct: 829 IACGLERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSH 888

Query: 620 SEGAINYTF---GHLMKSKSMTIISIAHRLS-TIRRSENVIVLGHDGSVVEMGK 669
           S   I Y     G LM+ +  T I ++H +S TI+++  V ++  +G +V  G+
Sbjct: 889 SAKWI-YNVCITGPLMQGR--TCILVSHNVSLTIKKASKVFMI-ENGYIVASGR 938

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 138/550 (25%), Positives = 248/550 (45%), Gaps = 66/550 (12%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL  +       ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLILYLIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LS+     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     L S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNINHLDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK-----YKPHRGVVEFKDV 451
                   L   Y+E+     +  R+ E  + +    P   HK       P  G +E  D+
Sbjct: 1332 ---GALWLVRLYAEVEMNMNSVERVKEYMEIEQE--PYNQHKEVPPPQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQ 510
            S  Y P  P  ++ KN++F +   S + IVG +G GKSTI   L R+  P TG I ID+ 
Sbjct: 1387 SLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSV---------- 558
            DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++  K  E ++ V          
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQ 1504

Query: 559  --AKQCFCHNFITKFPNT-----YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDE 611
               ++    N  T   N        + +   G+ LS GQ+Q + +AR+L++ P I++LDE
Sbjct: 1505 GTTREADNDNSSTNSENVNKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDE 1564

Query: 612  ATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
            AT+++D  S+  I  T     + +  TI++IAHRL ++   + ++V+       + G+ K
Sbjct: 1565 ATASIDYGSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVK 1615

Query: 672  KLYANPTSAL 681
            + Y +P S L
Sbjct: 1616 E-YDHPYSLL 1624

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 115/531 (21%), Positives = 221/531 (41%), Gaps = 46/531 (8%)

Query: 170 FLSFFTVALLIGCAANFGRFILLR----ILSERVVARLRAHVI----------------K 209
           F+    VA+    A  FGR + +R    I+SE     LR  +                 +
Sbjct: 401 FVGRILVAICQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPINEDPQEINDQ 460

Query: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269
           K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++  L   
Sbjct: 461 KSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRLLGF 519

Query: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
            +I+ +     +L       K I +  K     T    +   E    I+ ++ F  E N 
Sbjct: 520 AAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENF 579

Query: 330 LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG--DL 387
               N AIR+  ++                     + +T  ++  Y+ +Q ++       
Sbjct: 580 EKDIN-AIRE-NELSLLLMRSIVWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPVAF 637

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYK-----PH 442
           TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       KY      P+
Sbjct: 638 TALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT------KKYDQLTIDPN 690

Query: 443 RGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPST 502
                F++ + S+         K+LN +   G    ++GP+G GK+++ + LL      +
Sbjct: 691 GKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLS 750

Query: 503 GTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
           G +++   + +    ++       I    Q   L++ T+++NI +   +   +   ++V 
Sbjct: 751 GKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEAR--YKAVV 808

Query: 560 KQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
           + C              T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+D  
Sbjct: 809 EACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSH 868

Query: 620 SEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
           +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 869 TASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 144/550 (26%), Positives = 234/550 (42%), Gaps = 58/550 (10%)

Query: 173  FFTVALLIGCAANFGR----FILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            F  + +LI   A F       +LL + S R   +L   +    L     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPV--LFSAS 286
            +R  SD           V D V+     V+   ++  L   + ++++ +  P+  L +A+
Sbjct: 1076 NRFSSD--------MNSVDDNVQY----VISFFLISILDYVVVVVIIGYQVPLFLLVNAA 1123

Query: 287  VFGKQI----------RNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336
            + G  +          R   + +  +   +  +  E L+G   + +F    N  SR++  
Sbjct: 1124 LLGIYLYYQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----NHFSRFDYL 1179

Query: 337  IRDIFQVGXXXXXXXXXXXXXXSL----LGDLSFLT-VLAYGSYLVLQSQLSIGDLTAFM 391
              +  Q                S+    +G L  LT  L   +       LS G +   M
Sbjct: 1180 NIEAVQFNINCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTGDKALSTGMVGLLM 1239

Query: 392  LYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAG----HKYKPHRGVVE 447
             Y     N +  +     ++     +  R+ E  D  P   P        K  P +G V 
Sbjct: 1240 SYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVV 1299

Query: 448  FKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIM 506
            FKD S  Y  R ++  + K LN +I P   + IVG +G GKST++L L R   P  GTI+
Sbjct: 1300 FKDYSARY--RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIV 1357

Query: 507  IDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            ID  DITK+    LR H+ I+ Q+     G++R N+     Y  + +EI    +      
Sbjct: 1358 IDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQY--SDDEIWRALELSHLKP 1415

Query: 567  FITKFPNT---------YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
             I K  N           +T I   G+ LS GQ+Q + ++RAL+ +  IL+LDEAT+A+D
Sbjct: 1416 HILKMANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVD 1475

Query: 618  VESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANP 677
             E++  I  T     K +  TI++IAHR+ T+  S+ ++VL   G V E      L A+ 
Sbjct: 1476 SETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVLDQ-GEVKEFDSPSNLLADK 1532

Query: 678  TSALSQLLNE 687
             +    L ++
Sbjct: 1533 NTIFYNLCSQ 1542

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 120/232 (51%), Gaps = 20/232 (8%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN--CKSL 520
            KN++ F+   G  VC+VG  G GKST    LL      + +    DQ   KM+  C S 
Sbjct: 652 LKNIDGFQALKGQLVCVVGRVGAGKSTFLHALLGQLPCISSS---HDQATPKMHFRCDS- 707

Query: 521 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              + +  Q+  +++ +++ N+ +G  Y   +   ++  + C     +    +  +T++G
Sbjct: 708 ---VALCSQQAWILNASVKYNVLFGHKYD--EASYKATIEACQLLPDLGILADGDETLVG 762

Query: 581 SRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGH---LMKSKS 636
            +G  LSGGQK RI++ARA+  +  + +LD+  SA+D E  +  I++       L+K+K 
Sbjct: 763 EKGISLSGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK- 821

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYA-NPTSALSQLLNE 687
            T+I   + +S ++ S+++  L  +G +VE G F ++ + +  S L  L+ E
Sbjct: 822 -TVILTTNSISVLKHSQSIYAL-ENGEIVERGSFDEIMSKDAESKLKTLIAE 871

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 125/483 (25%), Positives = 217/483 (44%), Gaps = 27/483 (5%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    V+ R+ +Q   + VK     +V    +C  + Q    
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIV----ICFTTWQF--- 1090

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNE 329
             +F   P+      + +    TS++L+         +    +E L GI T++ +  +   
Sbjct: 1091 -IFIIIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGYQQQHRF 1149

Query: 330  LSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389
                   + +                     +G L  L       + + Q  L+ G +  
Sbjct: 1150 THINQCRVDNNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVGL 1209

Query: 390  FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFK 449
             + Y      ++  +     E+     +  R+ E +D K S +P     ++P     +  
Sbjct: 1210 SLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLK-SEAPAVIEDHRPAETWPDEG 1268

Query: 450  DVSFSYPT---RPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI 505
            D+ F + +   RP +  I K++N  I P   V IVG +G GKS++ L L R    S+G I
Sbjct: 1269 DIKFEHYSTRYRPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSGRI 1328

Query: 506  MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 565
            +ID+  I ++    LR  + I+ Q+  +  GT+R+NI     Y  T E+I +V       
Sbjct: 1329 VIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEY--TDEQIWNVLALSHLK 1386

Query: 566  NFITKFPNT-YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
            + I    +   +  +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I
Sbjct: 1387 DHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDKVI 1446

Query: 625  NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
              T     K +  TI++IAHR++TI  S+ +IVL  +G++ E    +KL  NP+S    L
Sbjct: 1447 QETIRTAFKDR--TILTIAHRINTIMDSDRIIVLD-NGTIKEFDSPEKLLENPSSLFYSL 1503

Query: 685  LNE 687
              E
Sbjct: 1504 CQE 1506

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 122/244 (50%), Gaps = 26/244 (10%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 628 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSIL------------- 674

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++  ++  V Q   +M+GT+++NI +G  Y   ++  +   K C     
Sbjct: 675 -GDLFRVKGFATIHGNVAYVSQVAWIMNGTVKENILFGHKYD--EDFYQKTIKACALTID 731

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           +    +   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   E    + 
Sbjct: 732 LAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVD---EHVARHL 788

Query: 628 FGHLMKSKSM----TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
             H++    +    T +   +++S +  +++V +L  +G +V+ G + ++  + +S LS+
Sbjct: 789 VEHVLGPNGLLHTKTKVLATNKVSVLSIADSVSLL-ENGEIVQQGTYDEIMKDDSSPLSK 847

Query: 684 LLNE 687
           L+ E
Sbjct: 848 LITE 851

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 144/562 (25%), Positives = 246/562 (43%), Gaps = 92/562 (16%)

Query: 163  FSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
            F + LY F  F         FT+   IG  A+                +L    +++ LH
Sbjct: 918  FYMGLYSFFVFGGYIFMTSQFTIVCFIGVNAS---------------KKLNLSAVRRILH 962

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSI 272
                F D   +G +++R   D   +   +T+ V   + A    ++GV +MC +  P  +I
Sbjct: 963  TPMAFLDTTPLGRILNRFTKDTDSLDNELTENVR-LMLAQFANIIGVCVMCIIYLPWFAI 1021

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGN 328
             +    P +L    +     ++  ++++  EA  +  +     E L G+ T++ + +E  
Sbjct: 1022 AI----PFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGMDTIRFYNSEER 1077

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL-----S 383
             +++ +  I  + + G               ++  + F  ++A    L +  Q      S
Sbjct: 1078 FMAKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIA-VCFALIIAL---LCVTRQFHISASS 1133

Query: 384  IGDLTAFMLY--------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
            +G L  ++L               TE   N+V  L ++ +E+   A           RKP
Sbjct: 1134 VGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAY---------RKP 1184

Query: 430  SISPTAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKS 488
              SP       P  G ++F++VSF+Y P  P+V   KNL+  I  G  + I G +G GKS
Sbjct: 1185 ESSPDPSW---PQEGKIDFEEVSFAYRPGLPAV--LKNLSMSINGGEKIGICGRTGAGKS 1239

Query: 489  TIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YGLT 547
            TI   L R     +G I+ID  +I+ +    LRR + I+ Q+PVL  GTIR N+  +G  
Sbjct: 1240 TIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGER 1299

Query: 548  Y------------TPTKEEIRSVAKQCFCHNFITKFPNTY--DTVIGSRGTLLSGGQKQR 593
                         +  KE +  V  Q    N   +  + +  D  +   G+  S G++Q 
Sbjct: 1300 SDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQL 1359

Query: 594  IAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKS-MTIISIAHRLSTIRRS 652
            +A+ARAL++   +LILDEATS++D E++  I      ++++ S  TI+ IAHRL TI   
Sbjct: 1360 LALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNY 1416

Query: 653  ENVIVLGHDGSVVEMGKFKKLY 674
            + ++VL   G + E      LY
Sbjct: 1417 DRILVL-EKGEIAEFDSPYNLY 1437

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 104/211 (49%), Gaps = 20/211 (9%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           FK++N +I  G  + I GP G GK+++   +      + G++ I+ +             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
             ++   P + + T+RDNI +G  +  +K  +  V K C     +   P    T IG RG
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI-NYTFGHLMKSKSMTIISI 642
             LSGGQK RI +AR + K   I + D+  SA+D      I +     L+  K+  + + 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLAT- 766

Query: 643 AHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
            H+LS +  +  VIVLG+DGS V++G  ++L
Sbjct: 767 -HQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  135 bits (340), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 140/551 (25%), Positives = 246/551 (44%), Gaps = 68/551 (12%)

Query: 171  LSFFTVALLIGCAANF---GRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDL 227
            + +  + L+IG A +    G+ IL          ++   ++ K LH    FFD    G +
Sbjct: 1102 MYYLILYLIIGLAQSLLGAGKTILNFAAGINASRKIFNMILNKVLHSKIRFFDATPTGRI 1161

Query: 228  ISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ-LSI-----LLLFFTPPV 281
            ++R   D   + + +T  +     +LI  +  V ++  ++PQ LSI     +L +F    
Sbjct: 1162 MNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSIAIVVSILYYFVGYF 1221

Query: 282  LFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
              + S   K+  + S+        + +   E L G+ T+++F  EG  +      I +  
Sbjct: 1222 YMAGSRELKRFESISR------SPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENN 1275

Query: 342  QVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLV-----LQSQLSIGDLTAFMLYTEY 396
            +                 ++G L    +   G +++     + S ++   LT  + +TE 
Sbjct: 1276 KPFFYLWVANRWLAFRIDMIGSL---VIFGAGLFILFNIDHIDSGMAGISLTYAISFTE- 1331

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK-----YKPHRGVVEFKDV 451
                   L   YSE+     +  R+ E    K    P   HK       P  G +E  D+
Sbjct: 1332 ---GALWLVRLYSEVEMNMNSVERVKEYM--KIEQEPYNQHKEVPPSQWPQDGKIEVNDL 1386

Query: 452  SFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQ 510
            S  Y P  P  ++  N++F +   S + IVG +G GKSTI   L R+  P TG I ID+ 
Sbjct: 1387 SLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNI 1444

Query: 511  DITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK------------EE---- 554
            DI+ ++ + LRR I I+ Q+P L SGTI+ N+     ++  K            EE    
Sbjct: 1445 DISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKKIFEALKRVNLISEEQSHQ 1504

Query: 555  --IRSVAKQCFCHNF--ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
              +R        ++   I KF +   + +   G+ LS GQ+Q + +AR+L++ P I++LD
Sbjct: 1505 GAVREADNDTSSNSSENINKFLDL-SSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLD 1563

Query: 611  EATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+++D  S+  I  T     + +  TI++IAHRL ++   + ++V+       + G+ 
Sbjct: 1564 EATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILVM-------DAGEV 1614

Query: 671  KKLYANPTSAL 681
            K+ Y +P S L
Sbjct: 1615 KE-YDHPYSLL 1624

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 101/472 (21%), Positives = 198/472 (41%), Gaps = 26/472 (5%)

Query: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSP 268
           +K+++ D E   +  +G +I+ +  DA+ VS  +   +   ++A +  VV + ++  L  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHLLG 518

Query: 269 QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN 328
             +I+ +     +L       K I +  K     T    +   E    I+ ++ F  E N
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN 578

Query: 329 ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG--D 386
                N  IR+  ++                     + +T  ++  Y+ +Q ++      
Sbjct: 579 FEKEIN-TIRE-NELSLLLMRSIIWSISSFVWFVTPTIVTAASFAYYIYVQGEVLTTPVA 636

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYK-----P 441
            TA  L+T    + +  LS   S ++Q   +  R+ +  + K +       KY      P
Sbjct: 637 FTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNEKDT------KKYDQLTIDP 689

Query: 442 HRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
           +      ++ + S+         K+LN +   G    ++GP+G GK+++ + LL      
Sbjct: 690 NGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLL 749

Query: 502 TGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSV 558
            G I++   + +    ++       I    Q   L++ TI+ NI +   +   +   ++V
Sbjct: 750 NGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFNEAR--YKAV 807

Query: 559 AKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            + C              T IG +G  LSGGQKQR+++ARAL      ++LD+  SA+D 
Sbjct: 808 VEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVDS 867

Query: 619 ESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            +   I  N   G LM+ +  T I ++H ++   R+  ++VL  DG + + G
Sbjct: 868 HTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQG 917

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 152/588 (25%), Positives = 245/588 (41%), Gaps = 89/588 (15%)

Query: 156 FELKIPIFSLPLYEFLSF---------FTVALLIGCAANFGRFILLRILSERVVARLRAH 206
           F+ + P F + LY F  F         FTV   +G  A+  +F+ L+             
Sbjct: 441 FKNRSPSFYMGLYSFFVFGQYMFMNIQFTVLCFLGVTAS--KFLNLK------------- 485

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMM 263
            +K  LH    F D   +G +++R   D    + SM  ++++ ++ +   +  ++GV +M
Sbjct: 486 AVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDIRLMMFQLGNIIGVIVM 541

Query: 264 CSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 322
           C +  P  +I + F     +  A  +    R   +        +     E L G+ T+++
Sbjct: 542 CIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLDTIRA 601

Query: 323 FVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQL 382
           + ++   L + +  I  + + G               +L  +  L +    + L +  Q 
Sbjct: 602 YRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFALII----TLLCVTRQF 657

Query: 383 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQ---GAGAASRLF--------ELTDRKPSI 431
            I   +  +L T Y       L+T    + Q   G  +A RL         E   R+P +
Sbjct: 658 KISPSSTGVLLT-YVLQLPGLLNTVLRALTQAENGMNSAERLVTYALDLPQEAEYRRPEM 716

Query: 432 SPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTI 490
           SP       P RG ++F+ VSF+Y  RPS+  + KN +  I  G  + I G +G GKSTI
Sbjct: 717 SPPENW---PDRGEIKFEGVSFAY--RPSLPPVLKNFSLNIGSGEKIGICGRTGAGKSTI 771

Query: 491 ALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI-------- 542
              L R      G I ID+ +I  +    LR  + I+ Q+PVL  GTI+ N+        
Sbjct: 772 MSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEKTD 831

Query: 543 -------TYGLTYTPTKEEIRSVAKQ----CFCHNFITKFPNTYDTVIGSRGTLLSGGQK 591
                    G    P  E+I     Q       H+ + KF    +  +   G   S G+K
Sbjct: 832 QELWESLVRGGAIAP--EDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLGEK 887

Query: 592 QRIAIARALIKKPTILILDEATSALDVESEGAIN----YTFGHLMKSKSMTIISIAHRLS 647
           Q +A+ RAL++   ILILDEATS++D E++  I       FG        TI+ IAHRL+
Sbjct: 888 QLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG------DCTILCIAHRLN 941

Query: 648 TIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSD 695
           TI   + ++VL   G V E      L+         +  ERA    SD
Sbjct: 942 TILNYDRILVL-EQGEVAEFDTPWNLFTKEDGIFKSMC-ERANIKKSD 987

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 122/245 (49%), Gaps = 22/245 (8%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           + S + F+NLNF I  G  + + GP G GK+++   +  +   S G++ ++ +    ++C
Sbjct: 100 KTSFKGFQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGR---LLSC 156

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  Y   K   R V K C   + +   P    T
Sbjct: 157 GY-----------PWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILPAGDMT 203

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKS 636
            IG RG  LSGGQK RI +AR + K   I + D+  SA+D    +  ++     L+  K 
Sbjct: 204 EIGERGINLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK- 262

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS--ALSQLLNERAAPGPS 694
            T I   H+L+ I ++  +IVLG+DGS   +G +++L  + +    L Q  ++++    +
Sbjct: 263 -TRILATHQLALIEKATRLIVLGNDGSFT-IGTYEELQKSNSQLKKLLQFTSDKSEEDDN 320

Query: 695 DQQQQ 699
           DQ+Q 
Sbjct: 321 DQKQN 325

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 146/572 (25%), Positives = 239/572 (41%), Gaps = 83/572 (14%)

Query: 168  YEFLSF-FTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGD 226
            Y F+S  FT+   IG AA+                 L    +K+ LH    F D   +G 
Sbjct: 907  YFFMSLQFTILCYIGLAAS---------------KWLNLKAVKRLLHTPMSFMDTTPLGR 951

Query: 227  LISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSILLLFFTPPVLFSA 285
            +++R   D   +   +T+ V   V      + GV +MC +  P  +I + F     +  A
Sbjct: 952  VLNRFTKDTDTLDNELTESVRLFVYQ-TANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVA 1010

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
              +    R   +        +     E LSG+ T++++ +E   L + +  I  + + G 
Sbjct: 1011 DHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINRMSEAGY 1070

Query: 346  XXXXXXXXXXXXXSLLG----------------DLSFLTVLAYGSYLVLQSQLSIGDLTA 389
                          ++                 D+S  +V    +Y VLQ    +  L  
Sbjct: 1071 LVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTY-VLQLPGLLNGLLR 1129

Query: 390  FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFK 449
             M   E   N+V  +  + +E+ Q A           RKP ++P    +  P  G V F 
Sbjct: 1130 AMTQAENDMNSVERIVNYATELPQEAAY---------RKPEMTP---QEPWPSNGEVVFD 1177

Query: 450  DVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
            +VS SY  RP +  + K ++  I  G  + I G +G GKSTI   L R    + G ++ID
Sbjct: 1178 NVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNEGRVLID 1235

Query: 509  DQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT-YG------------LTYTPTKEEI 555
              D +K+    LRR + I+ Q+PVL  G+IR N+  +G             + T   EE+
Sbjct: 1236 GVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGTIEAEEV 1295

Query: 556  RSVAKQ--------CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTIL 607
              V  Q           H F        D  +   GT  S G++Q +A+ RAL+++  IL
Sbjct: 1296 EKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNFSLGERQLLALTRALVRQSKIL 1349

Query: 608  ILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ILDEATS++D E++  I        +    TI+ IAHRL TI   + ++VL  +G+V E 
Sbjct: 1350 ILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVL-DNGTVKEF 1406

Query: 668  GKFKKLYANPTSALSQLLNE---RAAPGPSDQ 696
               + L+    +   ++ ++   +A   P +Q
Sbjct: 1407 DTPRSLFRIKDTIFREMCDKSGIKAEDFPGEQ 1438

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 129/281 (45%), Gaps = 26/281 (9%)

Query: 422 FELTDRKPSISPTA-GHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
           FE+ D K +        + KP    V+    +F+   + S   FKNLNF+I  G  V I 
Sbjct: 532 FEVEDAKETAKEKGEAFEEKPKGANVD----AFASSEKASFSGFKNLNFQIQKGELVIIT 587

Query: 481 GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
           G  G GKS++   L  +   + G I    ++ + + C             P + + T+RD
Sbjct: 588 GSIGTGKSSLLNALAGFMKKTEGDIF---KNGSLLLCGY-----------PWIQNTTVRD 633

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARAL 600
           NI +G ++   +   + V + C     +   P    T IG RG  LSGGQK RI +AR++
Sbjct: 634 NILFGSSFDDVR--YKEVIRVCALQADLDILPAGDFTEIGERGITLSGGQKARINLARSV 691

Query: 601 IKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLG 659
            K   I + D+  SA+D    +  ++     ++  K  T I   H+LS I R+  VI LG
Sbjct: 692 YKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGK--TRILATHQLSLIERASRVIFLG 749

Query: 660 HDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSDQQQQI 700
             GS  ++G  ++L     S   +L+        ++Q++++
Sbjct: 750 AGGS-FDIGTVEEL-KERNSGFVKLMEFSTQTKSANQREEV 788

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 141/549 (25%), Positives = 243/549 (44%), Gaps = 64/549 (11%)

Query: 164  SLPLYEFL-SFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            S   YE L S F V   I     F     + + S +   +L    + K LH    F ++ 
Sbjct: 519  SASFYEGLYSLFIVLFFIFLVCQFCVCFFVGLNSSK---KLNLRAVHKVLHTPMSFIEST 575

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKAL---ICGVVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + ++  ++ D V+     +  + G+ +MC +  P  +I++ F  
Sbjct: 576  PIGRIMNRFTKD----TDNLDGQILDNVRLTFYHMSTMFGICIMCIVYLPWFAIVIPFLI 631

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338
              ++F  + +    R   +        +     + L G+  ++++  +   + + +  I 
Sbjct: 632  FTIVFIFNFYQGSSREIRRLEAVRRSFIFNNINDVLGGLDIIKAYQVQNRFIFKSDYLIN 691

Query: 339  DIFQVGXXXXXXXXXXXXXXSLLGDL-----SFLTVL------AYGSYLVLQSQLSIGDL 387
               +                S++G L     S L V          + ++L   L I ++
Sbjct: 692  KTNEASYLYTGVQLWNNILVSIIGVLFALIISLLCVTKQFKISGSSTGVLLTYVLQIPNI 751

Query: 388  TAFMLYT----EYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHR 443
              ++L T    E   N+V  L T+ + + Q         E T  KP  SP  GH + P  
Sbjct: 752  LNYLLDTLKKAENDMNSVERLVTYATNLPQ---------ERTSSKPETSP--GHIW-PEN 799

Query: 444  GVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTG 503
            G ++FKD +F Y     + I KN N  +  G  + I G +G GKSTI   L R    + G
Sbjct: 800  GKIQFKDANFRYKEGLPL-ILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDELTDG 858

Query: 504  TIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI---TYGLTYTPTKEEIRS--V 558
             I IDD DI+ +    LR+++ I+ Q+P+L  GTIR N+   +Y    T  +  I S  +
Sbjct: 859  AIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILSGFI 918

Query: 559  AKQCFCH--------NFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
             +  F H          +TKF  T    +   GT  S G+KQ +A  RA+I    +++LD
Sbjct: 919  DRDTFGHFSEKPVNNKELTKFHLT--AHVEEDGTNYSLGEKQLLAFTRAIIHHSKVVVLD 976

Query: 611  EATSALDVESEGAINYTFGHLMKSKSM---TIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
            EA+S++D E++  I       + SK     TI+ IAHRL+TI + + ++VL H G+++  
Sbjct: 977  EASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRLNTILKYDRILVLDH-GNIIGF 1030

Query: 668  GKFKKLYAN 676
               + L+ N
Sbjct: 1031 ENPRVLFEN 1039

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 105/214 (49%), Gaps = 26/214 (12%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F NLNF I  G  + I GP G GK+++   +        GTI ID               
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEID--------------- 248

Query: 524 IGIVQ--QEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS 581
            G +Q    P + + T+RDNI +G  Y   KE+   V + C     +  F     T IG 
Sbjct: 249 -GNLQLCGYPWVQNTTVRDNIIFGSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGE 305

Query: 582 RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGHLMKSKSMTI 639
            G  LSGGQK RI +ARA+ K   I + D+  SA+D      I  N   G L   K+  I
Sbjct: 306 LGITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXI 364

Query: 640 ISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
           ++  H+LS I++++ ++VLG+D S  E+G +K+L
Sbjct: 365 LA-THQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 135/548 (24%), Positives = 245/548 (44%), Gaps = 42/548 (7%)

Query: 167  LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
            ++ F+  +++ L +G AA  N    I+L   S R   +L  ++ K  +     FF+   V
Sbjct: 1017 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +I+R  SD   V  S+    S   K+++  +V + ++    P   +  +F     ++ 
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 1135

Query: 285  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQ-- 342
             + +    R   + +  +   +  +  E L+G   + ++    N   R+     D  Q  
Sbjct: 1136 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSN 1191

Query: 343  ---VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
               V               ++   +   T L   + +  ++QLS G +   M Y+    +
Sbjct: 1192 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 1251

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTAG-HKYKPHRGVVEFKDVSFSY 455
            ++  +      I     +  R+ E  +  P   SI+P     +  P  G +EFK+ S  Y
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY 1311

Query: 456  PTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITK 514
              R ++  + K++N  I P   + IVG +G GKST++L L R   PS G I+IDD +I++
Sbjct: 1312 --RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISE 1369

Query: 515  MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 571
            +    LR ++ I+ Q+     GT+R N+     Y  +++E++   +     + + K    
Sbjct: 1370 LGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLGN 1427

Query: 572  ---------------PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
                            +  D  I   G+ LS GQ+Q + +ARAL+    IL+LDEAT+++
Sbjct: 1428 EAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASV 1487

Query: 617  DVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676
            D+E++  I  T     K +  TI++IAHR+ T+  S+ +IVL   G+V E     KL ++
Sbjct: 1488 DMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDK-GNVKEFDSPSKLLSD 1544

Query: 677  PTSALSQL 684
              S    L
Sbjct: 1545 KGSIFYSL 1552

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 118/233 (50%), Gaps = 13/233 (5%)

Query: 464 FKNL-NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRR 522
            KN+ +F+   G  +C+VG  G GKST    +L      +G+    +    K+  ++   
Sbjct: 654 LKNIEHFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGS---KESLAPKLIIRA--S 708

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSR 582
            +    QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G +
Sbjct: 709 SLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEK 766

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GHLMKSKSMTII 640
           G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G     K+ TII
Sbjct: 767 GISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTII 826

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY--ANPTSALSQLLNERAAP 691
              + +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P
Sbjct: 827 LTTNTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTP 878

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 129/486 (26%), Positives = 219/486 (45%), Gaps = 33/486 (6%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK +      + ++C+ + Q    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVIFT----ITVICATTWQF--- 1093

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1094 -IFIIIPLGVCYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1150

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G  
Sbjct: 1151 RFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMA 1210

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPT-AGH---KYKPHR 443
               + Y       +  +     E+     +  R+ E  D K     T  GH   K  P +
Sbjct: 1211 GISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQ 1270

Query: 444  GVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPST 502
            G ++F + S  Y  RP +  + K++N  I P   + IVG +G GKS++ L L R    S 
Sbjct: 1271 GDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASA 1328

Query: 503  GTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQ 561
            G I+ID   I ++    LR  + I+ Q+  +  G++R+NI     Y  T E I R++   
Sbjct: 1329 GNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENIDPTNQY--TDEAIWRALELS 1386

Query: 562  CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                + ++   +  D  +   G  LS GQ+Q + +ARA++    ILILDEAT+A+DVE++
Sbjct: 1387 HLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETD 1446

Query: 622  GAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
              +  T     K +  TI++IAHRL+TI  S+ +IVL  +G+V E     +L +N  S  
Sbjct: 1447 KVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGTVAEFDSPSQLLSNSESLF 1503

Query: 682  SQLLNE 687
              L  E
Sbjct: 1504 HSLCAE 1509

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 122/242 (50%), Gaps = 22/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G   C+VG  G GK+  ALL          + M+ 
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKT--ALL----------SCMLG 679

Query: 509 DQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
           D    K    ++   +  V Q P +M+GT+ +NI +G  Y    E      K C     +
Sbjct: 680 DLFRVK-GFATVHGSVAYVSQVPWIMNGTVMENILFGHKYDV--EFYEKTIKACALTIDL 736

Query: 569 TKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYT 627
               +   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I + 
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHV 796

Query: 628 FG--HLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLL 685
            G   L+ +K+  + +  +++S +  +++V +L  +G +++ G + ++  +  S L +LL
Sbjct: 797 LGPNGLLHTKTRLLAT--NKVSALSIADSVALLD-NGEIIQKGTYDEITKDADSPLWKLL 853

Query: 686 NE 687
           N+
Sbjct: 854 ND 855

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  132 bits (333), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 137/549 (24%), Positives = 246/549 (44%), Gaps = 44/549 (8%)

Query: 167 LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
           ++ F+  +++ L +G AA  N    I+L   S R   +L  ++ K  +     FF+   V
Sbjct: 446 VWMFVGVYSL-LGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 504

Query: 225 GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
           G +I+R  SD   V  S+    S   K+++  +V + ++    P   +  +F     ++ 
Sbjct: 505 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 564

Query: 285 ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 344
            + +    R   + +  +   +  +  E L+G   + ++    N   R+     D  Q  
Sbjct: 565 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAY----NHYERFIYLNYDKIQSN 620

Query: 345 XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSY-----LVLQSQLSIGDLTAFMLYT-EYTG 398
                         S+       T++   +      +  ++QLS G +   M Y+ E T 
Sbjct: 621 IDLVFNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 680

Query: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTAG-HKYKPHRGVVEFKDVSFS 454
           +  + + T    I     +  R+ E  +  P   SI+P     +  P  G +EFK+ S  
Sbjct: 681 SLTWIVRTTVM-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTK 739

Query: 455 YPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDIT 513
           Y  R ++  + K++N  I P   + IVG +G GKST++L L R   PS G I+IDD +I+
Sbjct: 740 Y--RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNIS 797

Query: 514 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-- 571
           ++    LR ++ I+ Q+     GT+R N+     Y  +++E++   +     + + K   
Sbjct: 798 ELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLG 855

Query: 572 ----------------PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
                            +  D  I   G+ LS GQ+Q + +ARAL+    IL+LDEAT++
Sbjct: 856 NEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATAS 915

Query: 616 LDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYA 675
           +D+E++  I  T     K +  TI++IAHR+ T+  S+ +IVL   G+V E     KL +
Sbjct: 916 VDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDK-GNVKEFDSPSKLLS 972

Query: 676 NPTSALSQL 684
           +  S    L
Sbjct: 973 DKGSIFYSL 981

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 118/233 (50%), Gaps = 13/233 (5%)

Query: 464 FKNL-NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRR 522
            KN+ +F+   G  +C+VG  G GKST    +L      +G+    +    K+  ++   
Sbjct: 83  LKNIEHFEAKRGDLICVVGRVGAGKSTFLKAILGQLPCMSGS---KESLAPKLIIRA--S 137

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSR 582
            +    QE  +M+ ++R+NI +G  +     ++    K C     +   P+  +T++G +
Sbjct: 138 SLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEK 195

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTF-GHLMKSKSMTII 640
           G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G     K+ TII
Sbjct: 196 GISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTII 255

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY--ANPTSALSQLLNERAAP 691
              + +S ++ S+ +  L  +G +VE G ++ +    N +S L +LL E   P
Sbjct: 256 LTTNTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTP 307

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 145/545 (26%), Positives = 245/545 (44%), Gaps = 46/545 (8%)

Query: 173  FFTVALLIGCAA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            F  V  LIG A+    N    ++L   S R   +L   + K  +     FF+   VG +I
Sbjct: 1020 FVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRII 1079

Query: 229  SRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVF 288
            +R  SD   V  ++    S   K+++  +V V ++    P   +  +F     ++  + +
Sbjct: 1080 NRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFY 1139

Query: 289  GKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV------QSFVAEGNELSRYNVAIRDIFQ 342
                R   + +  +   +  +  E L+G   +      + F+    E  +YNV     F+
Sbjct: 1140 IVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFR 1199

Query: 343  VGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT-EYTGNAV 401
                             +L       +LA  + +  + QLS G +   M Y+ E TG+  
Sbjct: 1200 STNRWLSVRLQTIGATIVLAT----AILALAT-MNTKRQLSSGMVGLLMSYSLEVTGSLT 1254

Query: 402  FGLSTFYSEIMQGAGAASRLFELTDRKP---SISPTAG-HKYKPHRGVVEFKDVSFSYPT 457
            + + T  + I     +  R+ E  +  P   SI+P     +  P +G +EFK+ S  Y  
Sbjct: 1255 WIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKY-- 1311

Query: 458  RPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
            R ++  +  N+N KI P   V IVG +G GKST++L L R   P+ G I+ID  DI+ + 
Sbjct: 1312 RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIG 1371

Query: 517  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF----- 571
               LR H+ I+ Q+     GT++ N+     Y  +++E++   +Q      + K      
Sbjct: 1372 LFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKRAVEQAHLKPHLEKMLHSKP 1429

Query: 572  ------------PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                         +  D  I   G+ LS GQ+Q + +ARAL+ +  IL+LDEAT+++D+E
Sbjct: 1430 RGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDME 1489

Query: 620  SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
            ++  I  T     K +  TI++IAHR+ T+  S+ +IVL   GSV E     KL ++ TS
Sbjct: 1490 TDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDQ-GSVREFDSPSKLLSDKTS 1546

Query: 680  ALSQL 684
                L
Sbjct: 1547 IFYSL 1551

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 90/339 (26%), Positives = 159/339 (46%), Gaps = 48/339 (14%)

Query: 398 GNAVFGLSTFYSEIMQGAGAASRL--FELTDRKPS-----ISPTAGHKYKPHRGVVEFKD 450
            +A++ + +  + I++ + +  RL  F L+D         I P+A  +  P    +E  +
Sbjct: 563 NSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSADERALP---AIEMNN 619

Query: 451 VSFSYPTRP--------------------SVQI-FKNLN-FKIAPGSSVCIVGPSGRGKS 488
           ++F + ++                     S QI  KN++ F+   G  VC+VG  G GKS
Sbjct: 620 ITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKS 679

Query: 489 TIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY 548
           T    +L      +G+    D    K+  +S    +    QE  +M+ ++R+NI +G  +
Sbjct: 680 TFLKAILGQLPCMSGS---RDSIPPKLIIRS--SSVAYCSQESWIMNASVRENILFGHKF 734

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI 608
                ++    K C     +   P+  +T++G +G  LSGGQK R+++ARA+  +  I +
Sbjct: 735 DQDYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYL 792

Query: 609 LDEATSALDVE-SEGAINYTF-GHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVE 666
           LD+  SA+D E S+  I Y   G     K+ TII   + +S ++ S+ +  L  +G +VE
Sbjct: 793 LDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVE 851

Query: 667 MGKFKKLY--ANPTSALSQLLNERAAP----GPSDQQQQ 699
            G ++ +    N TS L +LL E  +P      SD Q +
Sbjct: 852 QGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDVQTE 890

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  132 bits (333), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 140/546 (25%), Positives = 238/546 (43%), Gaps = 62/546 (11%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C  +  ++             L + ++   L     FF+   +G +++R  +D
Sbjct: 1018 TVVLWVFCTIHGSKY-------------LHSSMVSSILRAPMTFFETTPIGRILNRFSND 1064

Query: 235  AY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    V+ RS +Q   + VK     +V    +C  + Q  +L++    P+      + +
Sbjct: 1065 VYKIDEVLGRSFSQFFVNAVKVSFTILV----ICWNTWQFILLVI----PMGVLYLYYQQ 1116

Query: 291  QIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
                TS++L+         +    +E L G+ T++     G E  +  + I    +V   
Sbjct: 1117 YYLRTSRELRRLDSITKSPIYAHFQESLGGLATIR-----GYEQQKRFIHINQA-RVDNN 1170

Query: 347  XXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFML-----YTEYTGNA 400
                         L   L FL +++ +G+  +   +L  G LTA M+     Y      +
Sbjct: 1171 MSAYYPSINSNRWLAYRLEFLGSLIIFGAASLSILKLRDGTLTAGMIGLSLSYALQVTQS 1230

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTAGHKYKPHRGVVEFKDVSFSYP 456
            +  +     E+     +  R+ E  + K      I      +  P RG ++F++ S  Y 
Sbjct: 1231 LNWIVRMTVEVETNIVSVERIKEYAELKSEAPLIIEEKRPSENWPERGAIKFENYSTRY- 1289

Query: 457  TRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKM 515
             RP +  + KN++  I P   V IVG +G GKS++ L L R    + G+I++D  +I+++
Sbjct: 1290 -RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIVDGLNISEI 1348

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF---- 571
                LR  + I+ Q+  +  GTIR+NI     Y  T E+I +  +       I +     
Sbjct: 1349 GLYDLRHKLSIIPQDSQVFEGTIRENIDPTNIY--TDEQIWNALELSHLKQHILRMNEES 1406

Query: 572  -----PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
                  N   T +   G  LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  
Sbjct: 1407 VNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDSLIQE 1466

Query: 627  TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
            T     K +  TI++IAHRL+TI  S+ ++VL   G V E    + L  N  S    L  
Sbjct: 1467 TIRTAFKDR--TILTIAHRLNTIMDSDKIVVLDK-GEVAEFDTPQNLLKNTESLFYSLCE 1523

Query: 687  ERAAPG 692
            +    G
Sbjct: 1524 QSGLNG 1529

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 126/243 (51%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           + +F +  +P  ++  KN+ F+   G   CIVG  G GKS     +L             
Sbjct: 632 NATFLWKRKPEYKVALKNIEFQAKKGELACIVGKVGSGKSAFIQSIL------------- 678

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++  ++  V Q P +M+GT++DNI +G  Y   +E      + C     
Sbjct: 679 -GDLFRVKGFATIHGNVAYVSQLPWIMNGTVKDNILFGHKYN--QEFYEKTLRACALTID 735

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++  P+   T++G +G  LSGGQK R+++ARA+  +  + +LD+  +A+D   S+  I +
Sbjct: 736 LSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQH 795

Query: 627 TFG--HLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
             G   L+ +K+  + +  +++S +  ++N+ +L  DG +V+ G + ++  N  S L +L
Sbjct: 796 VIGPNGLLHTKTRVLAT--NKISVLSIADNITLLD-DGEIVQQGTYNEVTDNINSPLCKL 852

Query: 685 LNE 687
           ++E
Sbjct: 853 ISE 855

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  132 bits (332), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 131/510 (25%), Positives = 227/510 (44%), Gaps = 57/510 (11%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ K LH    FFD+  +G +++R   D   + + +         + I  +  + ++  +
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 267  SPQ-LSI-----LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320
            +PQ LS+     +L +       + S   K++ + +K        + +   E L G+ T+
Sbjct: 1194 TPQFLSVAIIVGMLYYMIGYFYLTGSRELKRLDSITK------SPIYQHFSETLVGVTTI 1247

Query: 321  QSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQS 380
            ++F  E   L    + I +  +                 ++G L     + +GS + + +
Sbjct: 1248 RAFGDESRFLRENLLKIDENNRPFFYLWVANRWLSFRIDVIGAL-----VVFGSGIFILT 1302

Query: 381  QLSIGD-------LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DRKP-- 429
             ++  D       LT  + +TE        L  FYSE+     +  R+ E    +++P  
Sbjct: 1303 NINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYD 1358

Query: 430  --SISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGK 487
               +S +      P  G +E  D+S  Y      ++ KN+ F + P + V +VG +G GK
Sbjct: 1359 EVQVSDSKVPADWPEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGRTGAGK 1417

Query: 488  STIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT 547
            STI   L R+    TG I ID  DIT +N   LRR I I+ Q+P L SGTI+ N+     
Sbjct: 1418 STIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDE 1477

Query: 548  YTP-------------TKEEIRSVAKQ-----CFCHNFITKFPNTYDTVIGSRGTLLSGG 589
            Y               T+EE+ S  +            I +F +  ++ I   GT  S G
Sbjct: 1478 YKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLDL-ESEIAEGGTNFSQG 1536

Query: 590  QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI 649
            Q+Q I +AR+L++ P IL+LDEAT+++D +S+  +  T     +    TI++IAHRL ++
Sbjct: 1537 QRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIR--TEFSESTILTIAHRLRSV 1594

Query: 650  RRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
               + ++V+G  G V E      L  N  S
Sbjct: 1595 IDYDKILVMGA-GEVKEYDHPYSLLLNKNS 1623

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 116/233 (49%), Gaps = 11/233 (4%)

Query: 442 HRGVVEFKDVSFSYP-TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
           ++  + FK+ + ++  +R S ++ +NLN     G    I+GP+G GK+++ + LL   N 
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKL-RNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNL 755

Query: 501 STGTIMI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRS 557
             G I++   + +    +        I    Q   L++ T+R+NI +   Y  T+    +
Sbjct: 756 LEGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YHN 813

Query: 558 VAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
           V + C              T IG +G  LSGGQKQRI++ARAL      ++LD+  SA+D
Sbjct: 814 VVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVD 873

Query: 618 VESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
             +   +  N   G LM+ +  T I ++H ++   R+ +++V+  DG V + G
Sbjct: 874 AHTALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVMLEDGQVKDQG 924

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  132 bits (332), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 144/556 (25%), Positives = 237/556 (42%), Gaps = 64/556 (11%)

Query: 156  FELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQD 215
            F+ K   F + +Y F  FF   +         +F L+  +      RL    +++ LH  
Sbjct: 935  FKHKKTPFYMGMYTFFVFFNYFVTTS------QFSLICYIGLSAAKRLNLKAVQRLLHTP 988

Query: 216  AEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLL 275
              F D   +G +++R   D   V   +T+ V   V  L   +VGV +MC       I L 
Sbjct: 989  MSFLDTTPIGRVLNRFTKDTDTVDTELTESVRLFVFQL-SNIVGVIVMCI------IYLP 1041

Query: 276  FFTPPVLFSASVF---GKQIRNTSKDLQEATG-QLTRVAE---EQLSGIKTVQSFVAEGN 328
            +F   V F   VF       +++S++++     Q + V     E L G+ T++++  E  
Sbjct: 1042 WFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERR 1101

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388
             L++ +     + + G               ++  ++F  ++   + L +  Q  I   +
Sbjct: 1102 FLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIA-MAFALIV---TLLCVTRQFHISAAS 1157

Query: 389  AFMLYTEYTGNAVFGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTAGH 437
              +L T Y       L+     + QG     +  RL         E   R+P +SP A  
Sbjct: 1158 VGVLLT-YVLQLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAEW 1216

Query: 438  KYKPHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
               P  G +EF  VS +Y  RP +  + K++   +A G  + I G +G GKSTI   L R
Sbjct: 1217 ---PTDGRIEFDHVSLAY--RPGLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYR 1271

Query: 497  YYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK---- 552
                  G+I ID  DI+ +    LR  + I+ Q+PV+  G +R N+      T  +    
Sbjct: 1272 MCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHA 1331

Query: 553  ---------EEIRSVAKQCFCHNFITKFPNTY----DTVIGSRGTLLSGGQKQRIAIARA 599
                     E + +V  Q   H       N +       +   GT  S G++Q +A+ RA
Sbjct: 1332 LVRGGAIPAESLATVRAQ--THENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRA 1389

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLG 659
            L+++  ILILDEATS++D E++  I      +    + TI+ IAHRL+TI   + ++VL 
Sbjct: 1390 LVRQSKILILDEATSSVDYETDAKIQTRI--VEAFSNCTILCIAHRLNTILDYDRILVLD 1447

Query: 660  HDGSVVEMGKFKKLYA 675
              G V E      LYA
Sbjct: 1448 Q-GRVCEFDTPAALYA 1462

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 99/216 (45%), Gaps = 30/216 (13%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F NLN +I  G  V + G  G GKS++   L  +   + G I    +D T + C      
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIY---KDGTMLLCGY---- 655

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
                  P + + T+RDNI +G  Y   +     + + C     +   P    T IG RG
Sbjct: 656 -------PWIQNATVRDNILFGSPYNEAR--YNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLM------KSKSM 637
             LSGGQK RI +ARA+ KK  I + D+  SA+D            H+M      K +  
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDAR-------VGKHIMDECLMGKLEGS 759

Query: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
           T +   H+LS I R+  VI +  DGS V++G  ++L
Sbjct: 760 TRVLATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  132 bits (332), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 99/321 (30%), Positives = 154/321 (47%), Gaps = 22/321 (6%)

Query: 382  LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGH---- 437
            LS G +   M Y     N +  +     ++     +  R+ E  D  P   P        
Sbjct: 1221 LSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPP 1280

Query: 438  KYKPHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
            K  P +G++ FK+ S  Y  R ++  + ++L+ +I P   + IVG +G GKST++L L R
Sbjct: 1281 KNWPSQGLIRFKNYSTRY--RANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFR 1338

Query: 497  YYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556
               PS GTI ID  DI+K+  K LR ++ I+ Q+     GT+R N+     Y  + EEI 
Sbjct: 1339 ILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIW 1396

Query: 557  SVAKQCFCHNFITKFP----------NTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTI 606
               +       I K            +   T I   G+ LS GQ+Q + ++RAL+ +  I
Sbjct: 1397 KALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRI 1456

Query: 607  LILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVE 666
            L+LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL   G V E
Sbjct: 1457 LVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVLDK-GEVKE 1513

Query: 667  MGKFKKLYANPTSALSQLLNE 687
                  L A   S    L ++
Sbjct: 1514 FDSPSNLLAQKDSIFYNLCDQ 1534

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 124/257 (48%), Gaps = 44/257 (17%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYY-----NPSTGTIMIDDQDITKMNC 517
            KN++ F++  G  VC+VG  G GKST    LL        +PS  +  +  +       
Sbjct: 643 LKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALLGQLPCISNSPSHASPTVHFR------- 695

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYG-----LTYTPTKEEIRSVAKQCFCHNFITKFP 572
                 + +  Q+  +M+ +++DN+ +G      TY  T E  + V         +    
Sbjct: 696 ---ANSVALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILA 745

Query: 573 NTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES-----EGAINYT 627
           +  +T++G +G  LSGGQK R+++ARA+  +  + +LD+  SA+D E      E  ++  
Sbjct: 746 DGDETLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKK 805

Query: 628 FGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY-ANPTSALSQLL- 685
            G L+K+K  T+I   + +S ++ S+++  L  DG +VE G F  +   + +S L +L+ 
Sbjct: 806 TG-LLKNK--TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIV 861

Query: 686 -----NERAAPGPSDQQ 697
                N +A   P D +
Sbjct: 862 ECESENTKAKIEPVDSE 878

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 215/485 (44%), Gaps = 31/485 (6%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+ +Q   + VK     V  + ++C+ + Q    
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKV----VFVMAVICATTWQF--- 1091

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L GI T++ +  E  
Sbjct: 1092 -IFVIIPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGITTIRGYNQEKR 1149

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLS---IG 385
                    + +                    L+G +  L       + + +  L+   +G
Sbjct: 1150 FGHINQCRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMVG 1209

Query: 386  DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSI-SPTAGHKYKPHRG 444
               ++ L    T N +  ++      +          +L    P I       +  P  G
Sbjct: 1210 LSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEG 1269

Query: 445  VVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTG 503
             ++F++ S  Y  RP +  + KN+N  I P   V IVG +G GKS++ L L R    + G
Sbjct: 1270 DIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAG 1327

Query: 504  TIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
             I+ID   I ++    LR  + I+ Q+  +  GT+R+NI    T   T EEI  V +   
Sbjct: 1328 NIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLELSH 1385

Query: 564  CHNFITKF-PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +     +  D  +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++ 
Sbjct: 1386 LKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDK 1445

Query: 623  AINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALS 682
             +  T     K +  TI++IAHRL+TI  S+ +IVL   G +VE     +L A P S   
Sbjct: 1446 IVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-KGEIVEFDTPDELLAKPESLFY 1502

Query: 683  QLLNE 687
             L NE
Sbjct: 1503 SLCNE 1507

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 122/241 (50%), Gaps = 20/241 (8%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           + +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 628 NATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSIL------------- 674

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++  ++  V Q P +M+GT+++NI +G  Y   +E      K C     
Sbjct: 675 -GDLFRVKGFATVHGNVAYVSQVPWIMNGTVKENILFGHKYD--QEFYEKTIKACALTID 731

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +    +   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   S+  + +
Sbjct: 732 LGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEH 791

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
             G      S T +   +++S +  ++++ +L  +G +V+ G ++++ ++  S L +L+ 
Sbjct: 792 VLGPTGLLHSKTKVLCTNKISVLSIADSITLL-ENGEIVQQGSYEEVNSDEDSPLFKLIK 850

Query: 687 E 687
           E
Sbjct: 851 E 851

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 134/505 (26%), Positives = 226/505 (44%), Gaps = 56/505 (11%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            V+ K LH    FFD    G +++RL  D   V + +         A++  +  + ++  +
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 267  SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQ 321
            +PQ  I+ +F    + F  ++ G     TS++L+     +TR        E L GI +++
Sbjct: 1174 TPQFLIMAIF----IGFLYALIGYFYVTTSRELKRFE-SITRSPIYQHFSETLVGITSIR 1228

Query: 322  SFVAEG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLS--FLTVLAYGSY 375
            ++  E       LSR +   R  F +                LLG L   F  +  Y + 
Sbjct: 1229 AYGDERRFMLENLSRIDDNNRPFFYLWIANRWLAFRV----DLLGALVTFFSGLFIYLNI 1284

Query: 376  LVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL---FELTDRKPSIS 432
              L + L+   LT  + +TE            YS +     +  RL    E+     + +
Sbjct: 1285 GKLDAGLAGISLTYAIFFTE----GALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNEN 1340

Query: 433  PTAGHKYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIA 491
                    P  G ++  D+S  Y P  P  ++ KN+NF + P   V IVG +G GKSTI 
Sbjct: 1341 AQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTII 1398

Query: 492  LLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT 551
              + R+ +P TG + ID+ DIT +    LR+ I I+ Q+P L +GT++  +     Y+  
Sbjct: 1399 TAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDK 1458

Query: 552  K--EEIRSV-------------AKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAI 596
            +  E ++ V                      I KF +  + V    G  LS GQ+Q + +
Sbjct: 1459 QIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLDLNNEVTEG-GANLSQGQRQLVCL 1517

Query: 597  ARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVI 656
            AR+L++ P I++LDEAT+++D  S+  I  T     + +  TI++IAHRL +I   + V+
Sbjct: 1518 ARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVL 1575

Query: 657  VLGHDGSVVEMGKFKKLYANPTSAL 681
            V+       + G+ K+ Y +P S L
Sbjct: 1576 VM-------DAGEVKE-YDHPYSLL 1592

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 106/229 (46%), Gaps = 9/229 (3%)

Query: 446 VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI 505
           + F++ + ++   PS    +N++ +   G      GP+G GKS++ L LL       G I
Sbjct: 672 LAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKI 731

Query: 506 MI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            +   D ++   +    L   I    Q   L++ T R NI +   Y   ++    V + C
Sbjct: 732 YVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYN--EQRYNDVLEAC 789

Query: 563 FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                         T IG +G  LSGGQKQRI++ARAL      L+LD+  SA+D  +  
Sbjct: 790 GLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTAL 849

Query: 623 AI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            I  N   G LM+ ++  ++S  H ++   R+ + +V+  +G V   G+
Sbjct: 850 LIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 130/540 (24%), Positives = 233/540 (43%), Gaps = 36/540 (6%)

Query: 170  FLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLIS 229
            ++  + + +L   A  F +FI + +L       L    +++ LH    F D   +G +++
Sbjct: 911  YMGLYILFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMN 970

Query: 230  RLGSDAYVVSRSMTQKVSDGVKALICGVVGV----GMMCSLSPQLSILLLFFTPPVLFSA 285
            R   D    + ++  ++++ V+ LI  +  +     +     P  +I + F     +F A
Sbjct: 971  RFTKD----TDTLDNEITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVA 1026

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGX 345
              +    R   +        +     E L G+ T++++ +E   L + +  I  + + G 
Sbjct: 1027 DHYQASGREIKRMDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGY 1086

Query: 346  XXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
                          +L  + F  ++A    +  Q  +S G +   + Y       +  L 
Sbjct: 1087 LVTSIQRWVAISLDMLA-VIFALIIALLC-VTRQFHVSAGSVGVMVTYVLQLPGLLNALL 1144

Query: 406  TFYSEIMQGAGAASRLFELT-----DRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPS 460
               ++      +A RL         + K  I  T   +  P  G ++F++VS +Y  RP 
Sbjct: 1145 RSQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAY--RPE 1202

Query: 461  VQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKS 519
            + +  KN++  I     + I G +G GKSTI   L R     TG I IDD DI+ +    
Sbjct: 1203 LPVALKNVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYE 1262

Query: 520  LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT-------------KEEIRSVAKQCFCHN 566
            LR  + I+ Q+PVL  G IR N+      T               ++++ S+  Q    N
Sbjct: 1263 LRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDAN 1322

Query: 567  FIT--KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
             ++   F    D ++   G+  S G++Q +A+ RAL++   ILILDEATS++D  ++  I
Sbjct: 1323 GLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKI 1382

Query: 625  NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
                  + +  + TI+ IAHRL TI     ++VL   G VVE    KKLY +  S  +++
Sbjct: 1383 QSRI--VEEFSNCTILCIAHRLKTILAYNRILVLDQ-GQVVEFDTPKKLYNDRDSIFNEM 1439

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 109/240 (45%), Gaps = 24/240 (10%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           F  LNF +     + I GP G GKS++   L  +   S+G++ I   D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
             ++   P + + T++DNI +G  +   K + + V + C     +   P    T IG RG
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFD--KPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGHLMKSKSMTIIS 641
             LSGGQK RIA+AR++ K   I + D+  SA+D      I      G+L   K  T I 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYL---KQKTRIL 752

Query: 642 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT--SALSQLLNERAAPGPSDQQQQ 699
             H+LS I ++  VI LG DGS  ++G   +L    T  S L Q  N   A    D   +
Sbjct: 753 ATHQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQFQNSAPAEELEDDDTK 811

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/249 (34%), Positives = 133/249 (53%), Gaps = 9/249 (3%)

Query: 441  PHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            P +G ++F++ S  Y  RP +++  K++N  I P   + IVG +G GKS++ L L R   
Sbjct: 1253 PSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIE 1310

Query: 500  PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
             ++G I ID   I  +  + LR H+ I+ Q+  L  GTIR+NI     Y  T E+I    
Sbjct: 1311 AASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEY--TDEQIWRAL 1368

Query: 560  KQCFCHNFITKF-PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +     + +        D  +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DV
Sbjct: 1369 ELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1428

Query: 619  ESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT 678
            E++  I  T     K++  TI++IAHR++TI  S+ ++VL   G V E      L  NP 
Sbjct: 1429 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPE 1485

Query: 679  SALSQLLNE 687
            S    L  E
Sbjct: 1486 SLFYSLCYE 1494

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 124/242 (51%), Gaps = 24/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF    G   C+VG  G GKS +   +L             
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL------------- 667

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   I  V Q P +M+GT++DNI +G  Y  +   +    K C     
Sbjct: 668 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVD 724

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +   P    T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + +
Sbjct: 725 LAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEH 784

Query: 627 TFG--HLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
             G   L+ SK+  + +  ++++ +  ++++ +L  +G +++ G +  + +  +SALS++
Sbjct: 785 VLGPNGLLASKTKVLAT--NKITVLSIADHIALL-ENGEIIQQGSYDDVTSAKSSALSKI 841

Query: 685 LN 686
           ++
Sbjct: 842 IS 843

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 123/485 (25%), Positives = 214/485 (44%), Gaps = 31/485 (6%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK     +V    +CS + Q    
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVKVSFTIIV----ICSSTWQF--- 1072

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L GI T++ +  +G 
Sbjct: 1073 -VFVIIPLGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYQQQGR 1130

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388
             L      + +                     +G +  L       + + Q  L+ G + 
Sbjct: 1131 FLHINQARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTPGMIG 1190

Query: 389  AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTAGHKYKPHRG 444
              + Y      ++  +     E+     +  R+ E  +  P     I      +  P  G
Sbjct: 1191 LSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDWPTHG 1250

Query: 445  VVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTG 503
             ++F++ S  Y  RP + +  +N+N  I P   + IVG +G GKS++ L L R    + G
Sbjct: 1251 AIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAEG 1308

Query: 504  TIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
             I+ID      +  + LR H+ I+ Q+  +  GT+R+NI     Y  T EEI    +   
Sbjct: 1309 RIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEY--TDEEIWHALELAH 1366

Query: 564  CHNFITKF-PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
              + I     +  ++++   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++ 
Sbjct: 1367 LKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVETDQ 1426

Query: 623  AINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALS 682
             I  T     K++  TI++IAHR++TI  S+ ++VL   G + E    + L  N  S   
Sbjct: 1427 VIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRESLFY 1483

Query: 683  QLLNE 687
             L  E
Sbjct: 1484 SLCQE 1488

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 131/256 (51%), Gaps = 29/256 (11%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 616 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGIL------------- 662

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   I  V Q P +M+GT+++NI +G  Y    +   +  + C     
Sbjct: 663 -GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKENILFGHKYDA--DFYDTTLRACALAVD 719

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           ++  P   +T++G +G  LSGGQK RI++ARA+  +    +LD+  +A+D   E    + 
Sbjct: 720 LSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVD---EHVAKHL 776

Query: 628 FGHLMKSK----SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
             H++ S+    S   +   +++S +  ++++ +L  +G +++ G ++++ ++ +SALS+
Sbjct: 777 IEHVLGSQGLLSSKVKVLATNKISVLSIADHISLL-ENGEIIQQGSYEEVTSDKSSALSK 835

Query: 684 LL---NERAAPGPSDQ 696
           ++    ++   G  D+
Sbjct: 836 IIANYGKKQTKGKGDE 851

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 125/493 (25%), Positives = 224/493 (45%), Gaps = 67/493 (13%)

Query: 207  VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 266
            ++ + LH    FFD+  +G +++R   D      S+ Q++   ++++    + V      
Sbjct: 1129 LLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFA---- 1180

Query: 267  SPQLSILLLFFTPPVLFSA--------SVFGKQIRNTSKDLQE----ATGQLTRVAEEQL 314
                ++LL+ +  P  F          S+ G     TS++L+     +   + +   E L
Sbjct: 1181 ----TLLLISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETL 1236

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T+++F  +     + N+++ D  Q                  +  +  L + + G 
Sbjct: 1237 VGVTTIRAF-GDEQRFIKENLSMID--QNSMPFFYLWVVNRWLSFRIDLIGALVIFSSGV 1293

Query: 375  YLVLQ-SQLSIG----DLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT--DR 427
            +++L  + +  G     LT  + +TE    A   L   YSE+     +  R+ E    ++
Sbjct: 1294 FILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQ 1349

Query: 428  KPSISPTAGH----KYKPHRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGP 482
            +P I+  A         P  G VE  ++S  Y P  P V   K++ F I P   V IVG 
Sbjct: 1350 EPLIADPANAVTPPPQWPDSGKVEVNNLSLKYAPHLPYV--IKDVTFTIEPLEKVGIVGR 1407

Query: 483  SGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI 542
            +G GKSTI   L R+    TG+I +D  +I  ++ K LRR I I+ Q+P L +G+IR N+
Sbjct: 1408 TGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNL 1467

Query: 543  TYGLTYTPTKEEIRSVAK-----------------QCFCHNFITKFPNTYDTVIGSRGTL 585
                 Y  + EEI +  K                 Q      + KF N  ++ I   G+ 
Sbjct: 1468 DPYDEY--SDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLNL-ESEIAEGGSN 1524

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
             S GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T     +  + T+++IAHR
Sbjct: 1525 FSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAHR 1582

Query: 646  LSTIRRSENVIVL 658
            L +I   + ++V+
Sbjct: 1583 LRSIVDYDKILVM 1595

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 107/226 (47%), Gaps = 9/226 (3%)

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI 507
           F++V+  + +     + +NL+ +   G    IVG +G GK++I + LL     S G I++
Sbjct: 708 FENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKIIV 767

Query: 508 DD---QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
                +   +     +   I    Q   L++ T+R+NI +   +   + +  +V + C  
Sbjct: 768 PSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEACSL 825

Query: 565 HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
                       T IG +G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I
Sbjct: 826 KRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTALWI 885

Query: 625 --NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
                 G LM+ +  T I + H ++   ++ + +V+  DG V E G
Sbjct: 886 YDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKG 929

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 132/541 (24%), Positives = 233/541 (43%), Gaps = 31/541 (5%)

Query: 167  LYEFLSFFTVALLIGCAAN-FGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            +++F++ + +  L   A N F   I+L   S R    L   + K  +    +FF+   +G
Sbjct: 1001 VWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIG 1060

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R  SD   V  ++    S   ++++  ++ V ++    P   +          +  
Sbjct: 1061 RVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILVSVAMPWFLLFNALIMIIYFYYE 1120

Query: 286  SVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS------FVAEGNELSRYNVAIRD 339
             ++  Q R   +    A   +  +  E L G   + +      F     E  +YN+ +  
Sbjct: 1121 KLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAYNHSKMFKFMNIERVQYNLNVLF 1180

Query: 340  IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGN 399
             F+                S+   +   T L   + L   S +  G +   M Y     +
Sbjct: 1181 TFR-----STNRWLSIRLQSIGAFIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQVTS 1235

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTAGHKYKPHRGVVEFKDVSFSY 455
            A+  +     +I     +  R+ E     P     I      +  P RG +EFK+ + +Y
Sbjct: 1236 ALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEFKNYTTTY 1295

Query: 456  PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKM 515
                S  + KN++  I P   V IVG +G GKST++L L R    + GTI ID  DI+++
Sbjct: 1296 RANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISRI 1354

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT- 574
                LR ++ I+ Q+     GT+R N+     +T    E+ +V +       + +     
Sbjct: 1355 GLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV--ELWNVIELSHLKPHVLRMAEDD 1412

Query: 575  --------YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
                     D  I   G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+A+DVE++  I  
Sbjct: 1413 NLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQE 1472

Query: 627  TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
            T     K +  TI++IAHRL TI  ++ ++VL   G V E    K L ++ ++   QL +
Sbjct: 1473 TIRTQFKDR--TILTIAHRLDTIMDNDKILVLDA-GGVKEFDSPKNLLSDESTLFYQLCD 1529

Query: 687  E 687
            +
Sbjct: 1530 K 1530

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 113/223 (50%), Gaps = 19/223 (8%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDIT-KMNCKSLR 521
            KN++ F  +P S  C++G  G GK+T+   +L      +G+     + I+ K++ +   
Sbjct: 641 LKNIDHFTASPKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG-- 694

Query: 522 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS 581
             I    QE  +M+ TI++NI +G  +  T   +   A +      I   P+   T++G 
Sbjct: 695 ESIAYCPQEAWIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGE 752

Query: 582 RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-----SEGAINYTFGHLMKSKS 636
           +G  LSGGQK R+++ARA+  +  I +LD+  SA+D        E  ++   G L+++K 
Sbjct: 753 KGISLSGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK- 810

Query: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
            T+I   + +S ++ S+ +  L  +G +VE G +  +  +  S
Sbjct: 811 -TVILSTNTVSVLKHSQLIYAL-ENGIIVERGNYNDIIESANS 851

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 130/487 (26%), Positives = 221/487 (45%), Gaps = 35/487 (7%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK        + ++C+ + Q    
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFT----ITVICATTWQF--- 1092

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1093 -IFIIIPLSVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1149

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G +
Sbjct: 1150 RFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMV 1209

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP--TAGH---KYKPH 442
               + Y       +  +     E+     +  R+ E  D K S +P    GH   K  P 
Sbjct: 1210 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLK-SEAPLIVEGHRPPKEWPS 1268

Query: 443  RGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
            +G ++F + S  Y  RP +  + K++N  I P   V IVG +G GKS++ L L R    S
Sbjct: 1269 QGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEAS 1326

Query: 502  TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAK 560
             G I+ID+  I ++    LR  + I+ Q+  +  GT+R+NI     Y  T E I R++  
Sbjct: 1327 EGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--TDEAIWRALEL 1384

Query: 561  QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                 + ++   +  D  +   G  LS GQ+Q + +ARA++    IL+LDEAT+A+DVE+
Sbjct: 1385 SHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVET 1444

Query: 621  EGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSA 680
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L ++  S 
Sbjct: 1445 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPGQLLSDNKSL 1501

Query: 681  LSQLLNE 687
               L  E
Sbjct: 1502 FYSLCME 1508

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 119/242 (49%), Gaps = 24/242 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G+  CIVG  G GK+  ALL          + M+ 
Sbjct: 631 DATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKT--ALL----------SCMLG 678

Query: 509 DQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
           D    K    ++   +  V Q P +M+GT+++NI +G  Y    E      K C     +
Sbjct: 679 DLFRVK-GFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDA--EFYEKTIKACALTIDL 735

Query: 569 TKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
               +   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   E    +  
Sbjct: 736 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVD---EHVARHLI 792

Query: 629 GHLMKSKSM----TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
            H++    +    T +   +++S +  ++++ +L  +G + + G + ++  +  S L +L
Sbjct: 793 EHVLGPNGLLHTKTKVLATNKVSALSIADSIALLD-NGEITQQGTYDEITKDADSPLWKL 851

Query: 685 LN 686
           LN
Sbjct: 852 LN 853

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 144/518 (27%), Positives = 230/518 (44%), Gaps = 88/518 (16%)

Query: 212  LHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLS 271
            LH    FFD   +G +++R   D   V + +T  +   +  LI     + ++  ++P   
Sbjct: 1089 LHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIFLITIITPHFL 1148

Query: 272  I------LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVA 325
            I      +L +F      +AS   K+I + +K        + +   E L G+ T+++F  
Sbjct: 1149 IVAVVVFILYYFVGMWYLTASRELKRIDSITK------SPIFQHFSETLVGVCTIRAFGD 1202

Query: 326  EG----NELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQ-- 379
            E       L + +   R  F +               + +       VLA GS++++   
Sbjct: 1203 EKRFILENLDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFI-------VLASGSFILINIG 1255

Query: 380  ---SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTD---------R 427
               S L+   LT  +L+T+        L   YS       +  RL E +           
Sbjct: 1256 NIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYN 1311

Query: 428  KPSISPTAGHKYKPHRGVVEFKDVSFSYPTR-PSVQIFKNLNFKIAPGSSVCIVGPSGRG 486
            K  I       + P  G +E  ++S  Y +  P V   KN++F I P S V IVG +G G
Sbjct: 1312 KDHIQELQQSSW-PEHGQIEVDNLSLRYASNLPPV--IKNVSFTIEPQSKVGIVGRTGAG 1368

Query: 487  KSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGL 546
            KSTI   L R   P TG I ID  DI++++  +LRR I I+ Q+P+L +GTI+ N+    
Sbjct: 1369 KSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCD 1428

Query: 547  TYTPTKEEIRSVAKQCFCHNFIT-------------------KFPNTYDTVIGSRGTLLS 587
             Y   K  I  V  Q    N I+                   KF N   T I   G  +S
Sbjct: 1429 EYDNKK--IFKVLSQV---NLISTGEMEAAQNMGDDSNTARNKFVNL-QTEITEGGQNIS 1482

Query: 588  GGQKQRIAIARALIKKPTILILDEATSALDVESE----GAINYTFGHLMKSKSMTIISIA 643
             G++Q + IAR+L+++P I++LDEATS++D ES+    G I   F     +KS TI++IA
Sbjct: 1483 QGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEF-----NKS-TILTIA 1536

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
            HRL ++   + V+V+       + G+ K+ Y +P + L
Sbjct: 1537 HRLRSVIDYDRVLVM-------DAGEIKE-YDHPYNLL 1566

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 118/480 (24%), Positives = 206/480 (42%), Gaps = 57/480 (11%)

Query: 223 KVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMM-----CSLSPQLSILLLFF 277
            +G +I+ +  D++ VS  ++      V+A+I  ++ VG++      S    +SI+L+ F
Sbjct: 446 NLGTIINLISIDSFKVSE-ISTYFYMTVQAIIMVLIVVGLLFKFLGISALAGISIILMMF 504

Query: 278 TPPVLFS-ASVFGKQIRNTSKDLQEATGQLT--RVAE--EQLSGIKTVQSFVAEGNELSR 332
             P+ F  A + GK         Q++  Q T  R+A+  E L  I+ V+ F  E N +S+
Sbjct: 505 --PLNFRLAELLGK--------FQKSALQCTDKRIAKLNECLQNIRIVKYFAWENN-ISK 553

Query: 333 YNVAIRD-----IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              +IR      +FQ                +L+  ++F  +  +  +  L + L+   L
Sbjct: 554 DIKSIRQNELRFLFQKALVWALSSFLWFVTPTLVTGVTF-AIYIFVQHQELNAPLAFTTL 612

Query: 388 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYK-----PH 442
           + F L        +  LS   S + Q   +  R+ +  +   +       KY      P 
Sbjct: 613 SLFTLLK----TPLDQLSNMLSFMNQSIVSLDRIVKFINEDDT------EKYNQLTVSPD 662

Query: 443 RGVVEFKDVSFSY-PTRPSVQIFK--NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
              +EFK+ + ++        IFK   LN     G    I+G +G GKS + + LL   +
Sbjct: 663 ENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELH 722

Query: 500 PSTGTIMIDD----QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI 555
             +G+I +       D+   +   L        Q   L++ T+++NI +   Y   +   
Sbjct: 723 LISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR--Y 779

Query: 556 RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSA 615
           + V   C     +   P    T IG +G  LSGGQKQRI++ARA+      ++LD+  SA
Sbjct: 780 KEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSA 839

Query: 616 LDVESEGAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
           +D  +   I  N   G +M+++  T I + H +S   R     V+  +G V   G  K+L
Sbjct: 840 VDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFAVILENGKVKNQGTIKQL 897

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  122 bits (305), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 150/291 (51%), Gaps = 41/291 (14%)

Query: 417 AASRLFELTDRKPS-----ISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKI 471
           +  R+ E TD  PS     ISP A     P  G VE K++S  Y    S +   N++FK+
Sbjct: 3   SVERIKEYTD-IPSESNGYISPPANW---PQTGDVELKNLSLRYSPHSS-KALDNVSFKV 57

Query: 472 APGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEP 531
             G+ V IVG +G GKS+I   + R  +   GTI ID++DI  +  + LR  I  + Q+P
Sbjct: 58  KAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDP 117

Query: 532 VLMSGTIRDNITYGLTYTPTKEEIRSV------AKQC--FCHNFITKFPN---------- 573
            L  GT+R N+     Y+    +I  V       ++C   C  F  + PN          
Sbjct: 118 TLFDGTVRSNLDPFDRYSDV--QIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRF 175

Query: 574 -TYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLM 632
              +TV+ S G+ LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T    M
Sbjct: 176 IDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETM 235

Query: 633 KSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
             K+ TI++IAHRL ++   + ++V+       EMG+ K+ Y +P + +S 
Sbjct: 236 --KNTTILTIAHRLRSVIDYDKILVM-------EMGRVKE-YDHPYTLISD 276

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  129 bits (324), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 132/528 (25%), Positives = 229/528 (43%), Gaps = 44/528 (8%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            TV L + C  +  R+             L   +    L     FF+   +G +++R  +D
Sbjct: 995  TVVLWVFCTIHGSRY-------------LHDAMASSVLRAPMSFFETTPIGRILNRFSND 1041

Query: 235  AY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y    ++ R+ +Q   + VK     VV    +C+ + Q  +++L    P+      + +
Sbjct: 1042 IYKVDELLGRTFSQFFVNVVKVTFTIVV----ICTSTWQFILVVL----PLSVLYIYYQQ 1093

Query: 291  QIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGNELSRYNVA-IRDIFQVG 344
                TS++L+     +TR       +E L G+ T++ +  +    +  N A I +     
Sbjct: 1094 YYLRTSRELRR-LDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAHINQARIDNNMSAF 1151

Query: 345  XXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGL 404
                            LG +  L       + + Q  L+ G +   + Y      ++  +
Sbjct: 1152 YPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSLSYALQITQSLNWI 1211

Query: 405  STFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPT---RPSV 461
                 E+     +  R+ E  + KP  +P      +P +G     D+ F + +   RP +
Sbjct: 1212 VRMTVEVETNIVSVERIKEYAELKPE-APAIIESSRPPKGWPSQGDIRFEHYSTRYRPEL 1270

Query: 462  Q-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSL 520
            Q I +++N  I     V IVG +G GKS++ L L R    + G I ID      +    L
Sbjct: 1271 QLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGLSTDTIGLADL 1330

Query: 521  RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVI 579
            R  + I+ Q+  + +GT+R+N+    T   T EEI    +       +    N    T++
Sbjct: 1331 RHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLKEHVMSMGNDGLQTML 1388

Query: 580  GSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTI 639
               G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T     K++  TI
Sbjct: 1389 TECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIRTAFKNR--TI 1446

Query: 640  ISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
            ++IAHR++TI  S+ +IVL ++G V E    + L   P S    L  E
Sbjct: 1447 LTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLCKE 1493

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 125/241 (51%), Gaps = 20/241 (8%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 623 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVGSGKSALIQSIL------------- 669

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q P +M+GT+++NI +G  Y P+  E     K C  +  
Sbjct: 670 -GDLFRVKGFATIHGSVAYVSQIPWIMNGTVKENILFGHKYDPSFYE--KTVKACALNVD 726

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++  P    T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  ++ 
Sbjct: 727 LSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLVDN 786

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
             G      S T +   ++++ +  ++++ +L  +G +V+ G + ++  +  SALS+L++
Sbjct: 787 VLGVTGLLHSKTKVLATNKITVLSIADSIALL-ENGEIVQQGSYDEVVRDDGSALSKLIH 845

Query: 687 E 687
           E
Sbjct: 846 E 846

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 128/479 (26%), Positives = 217/479 (45%), Gaps = 35/479 (7%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK        + ++C+ + Q    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFT----ITVICATTWQF--- 1093

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1094 -IFIIIPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1150

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G +
Sbjct: 1151 RFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGMV 1210

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISP--TAGH---KYKPH 442
               + Y       +  +     E+     +  R+ E  D K S +P    GH   K  P 
Sbjct: 1211 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLK-SEAPLIIEGHRPPKQWPA 1269

Query: 443  RGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
            +G + F + S  Y  RP +  + K +N  I P   V IVG +G GKS++ L L R    S
Sbjct: 1270 QGDIRFNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEAS 1327

Query: 502  TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAK 560
             G I+ID   I ++    LR  + I+ Q+  +  GT+R+NI     Y  + E I R++  
Sbjct: 1328 EGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--SDEAIWRALEL 1385

Query: 561  QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                 + ++   +  D  +   G+ LS GQ+Q + +ARA++    IL+LDEAT+A+DVE+
Sbjct: 1386 SHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVET 1445

Query: 621  EGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L +N  S
Sbjct: 1446 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DNGKVAEFDTPGQLLSNSKS 1501

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 121/255 (47%), Gaps = 24/255 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN++F+   G+  CIVG  G GK+ +   +L       G +   
Sbjct: 632 DATFLWQRKPEYKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCML-------GDLFRV 684

Query: 509 DQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568
               T   C      I  V Q P +M+GT+++NI +G  Y    E      K C     +
Sbjct: 685 KGFATVHGC------IAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTIDL 736

Query: 569 TKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628
               +   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   E    +  
Sbjct: 737 AILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVD---EHVARHLI 793

Query: 629 GHLMKSKSM----TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
            H++    +    T I   +++S +  ++++ +L  +G +++ G +  +  +  S L +L
Sbjct: 794 EHVLGPNGLLHTKTRILATNKVSALSIADSIALL-DNGEIIQQGAYSDITKDADSPLWKL 852

Query: 685 LNERAAPGPSDQQQQ 699
           LN+      + Q ++
Sbjct: 853 LNDYGKKNNNKQSEE 867

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 146/573 (25%), Positives = 241/573 (42%), Gaps = 94/573 (16%)

Query: 154  DFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLH 213
            D F  + P F + LY F  F +   +       G++ LL  +       L    + K LH
Sbjct: 933  DKFHNRSPSFYMGLYSFFVFGSYIFM------NGQYTLLCYMGVVASKTLNLQALHKILH 986

Query: 214  QDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS-PQLSI 272
                F D + +G +++R   D   +   +T+ +   +   I  ++GVG MC +  P  +I
Sbjct: 987  TPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQ-IANIIGVGAMCIIYLPWFAI 1045

Query: 273  LLLFFTPPVLFSASVFGKQIRNTSKDLQ--EATGQ--LTRVAEEQLSGIKTVQSFVAEGN 328
             +    P +L    +     ++T ++++  EA  +  +     E L+G+ T++++ A+  
Sbjct: 1046 AI----PFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQDR 1101

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVL-------QSQ 381
              ++    I  + +                       FL ++A    L++       Q  
Sbjct: 1102 FATKSEFLIDKMNEAAYISIAVQRWAGI---------FLDLVAVAFALIITLLCVTRQFH 1152

Query: 382  LSIGDLTAFMLY-----------------TEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 424
            +S  D    + Y                 TE   N+   L ++ +++ Q         E 
Sbjct: 1153 ISGADTGVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQ---------EA 1203

Query: 425  TDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPS 483
              RKP  SP       P  G + F++++F+Y  RP + I  KN N  I P   + I G +
Sbjct: 1204 QYRKPECSPPIDW---PQNGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRT 1258

Query: 484  GRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN-- 541
            G GKSTI   L R    +TG I+IDD DI+ +    LR  + I+ Q+PVL  G IR N  
Sbjct: 1259 GAGKSTIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLD 1318

Query: 542  --------------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLS 587
                          +  G   +   E ++S  K     N + KF    +  +   G   S
Sbjct: 1319 PFDEYQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFS 1375

Query: 588  GGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN----YTFGHLMKSKSMTIISIA 643
             G++Q +A+ RAL+++  ILILDEATS++D E++  I       F H       TI+ IA
Sbjct: 1376 LGERQVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAFNHC------TILCIA 1429

Query: 644  HRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676
            HRL TI   + ++VL   G V E      L+ N
Sbjct: 1430 HRLKTILNYDRILVL-EKGEVAEFDTPWNLFNN 1461

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 100/214 (46%), Gaps = 21/214 (9%)

Query: 463 IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRR 522
           +  N+NF I  G  V + GP G GK+++   L       +G          +MN      
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSG----------EMNHSGDLL 673

Query: 523 HIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSR 582
             GI    P + + TIRDNI +G  Y PT    + V   C   + +   P    T +G R
Sbjct: 674 LCGI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGHLMKSKSMTIIS 641
           G  LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y     +  K  T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 642 IAHRLSTIRRSENVIVL--GHDGSVVEMGKFKKL 673
             H+LS + +++ +IVL    D    E+G FK+L
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 128/486 (26%), Positives = 218/486 (44%), Gaps = 33/486 (6%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q   + VK        + ++C  + Q    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFT----ITVICVTTWQF--- 1093

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ TV+ + ++  
Sbjct: 1094 -IFIIVPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY-SQQK 1150

Query: 329  ELSRYN-VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 387
              S  N   I +                    L+G +  L       + + Q  L+ G +
Sbjct: 1151 RFSHINQCRIDNNMSAFYPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMV 1210

Query: 388  TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTA--GH---KYKPH 442
               + Y       +  +     E+     +  R+ E  D K S +P    GH   K  P 
Sbjct: 1211 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIK-SEAPLVIEGHRPPKEWPG 1269

Query: 443  RGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
            +G ++F   S  Y  RP +  + K ++  I P   + IVG +G GKS++ L L R    S
Sbjct: 1270 QGDIKFNQYSTRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEAS 1327

Query: 502  TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
             G I+ID   I ++    LR  + I+ Q+  +  GT+R+NI     YT  +   R++   
Sbjct: 1328 AGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTD-EAMWRALELS 1386

Query: 562  CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                + ++   +  D+ +   G+ LS GQ+Q + +ARA++ +  IL+LDEAT+A+DVE++
Sbjct: 1387 HLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETD 1446

Query: 622  GAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681
              I  T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L  N  S  
Sbjct: 1447 KVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPAQLLTNTKSLF 1503

Query: 682  SQLLNE 687
              L  E
Sbjct: 1504 YSLCAE 1509

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 121/244 (49%), Gaps = 26/244 (10%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G   C+VG  G GK+  ALL     + + G     
Sbjct: 632 DATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKT--ALL-----SSTLG----- 679

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    S+   +  V Q P +M+GT+++NI +G  Y    E      K C     
Sbjct: 680 --DLFRVKGFASVHGSVAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKACALTID 735

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           +    +   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   E    + 
Sbjct: 736 LAILMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVD---EHVARHL 792

Query: 628 FGHLMKSKSM----TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQ 683
             H++ S  +    T +   +++S +  ++++ +L  +G +++ G +  +  +  S L +
Sbjct: 793 VEHVLGSNGLLHTKTKLLATNKVSALSVADSIALLD-NGEIIQQGTYDDITKDADSPLWK 851

Query: 684 LLNE 687
           L+ +
Sbjct: 852 LIKD 855

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 132/540 (24%), Positives = 233/540 (43%), Gaps = 62/540 (11%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            F + LY F  FF         A   +F +L  +       L    +K+ LH    F D  
Sbjct: 927  FYMGLYTFFVFFNYF------ATTSQFSVLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTT 980

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + ++  ++++ V+  +     +VGV +MC +  P  +I +    
Sbjct: 981  PIGRVLNRFTKD----TDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAV---- 1032

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATG-QLTRVAE---EQLSGIKTVQSFVAEGNELSRYN 334
            P +L   +      +++S++++     Q + V     E LSG+ T++++  E   L++ +
Sbjct: 1033 PFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSD 1092

Query: 335  VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYT 394
              I  + + G               ++  ++F  ++   + L +  Q SI   +  +L T
Sbjct: 1093 FLINKMNEAGYVVVAIQRWVSIALDMIA-MAFALII---TLLCVTRQFSISAASVGVLLT 1148

Query: 395  EYTGNAVFGLSTFYSEIMQGAG---AASRL--------FELTDRKPSISPTAGHKYKPHR 443
             Y       L+T    + QG     +A RL         E   R+P  SP       P  
Sbjct: 1149 -YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPPESW---PSE 1204

Query: 444  GVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPST 502
            G ++F  VS +Y  RP +  +  +++  +  G  + I G +G GKSTI   L R      
Sbjct: 1205 GAIDFDHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHD 1262

Query: 503  GTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT--------------YGLTY 548
            G+I ID  DI ++    LR  + I+ Q+PVL  G +R N+                    
Sbjct: 1263 GSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGA 1322

Query: 549  TPTKEEIRSVAKQCFCHNFITKFPNTY-DTVIGSRGTLLSGGQKQRIAIARALIKKPTIL 607
              T++E  + A        +T     + +  +   G+  S G++Q +A+ RAL++   IL
Sbjct: 1323 IATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRIL 1382

Query: 608  ILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ILDEATS++D E++  I             T++ IAHRL+TI   + ++VL   G V E 
Sbjct: 1383 ILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVLDQ-GRVCEF 1439

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 119/277 (42%), Gaps = 52/277 (18%)

Query: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDD 509
           D S S   + + + FKNLN +IA G  V + G  G GKS++   +  +    +G      
Sbjct: 580 DTSSSNEPKVNFKGFKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSG------ 633

Query: 510 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPT--KEEIRSVAKQCFCHNF 567
            DI K     L  +       P + + T++DNI +G  +     KE IR     C     
Sbjct: 634 -DIYKNGSLLLCGY-------PWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQAD 681

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYT 627
           +   P    T IG RG  LSGGQK RI +AR++ KK  I + D+  SA+D          
Sbjct: 682 LDLLPAGDKTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDAR-------V 734

Query: 628 FGHLMKSKSM------TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL-------- 673
             H+M    M      T +   H+LS I R+  VI +  DG+ V+ G   +L        
Sbjct: 735 GKHIMDECMMGALDGKTRVLATHQLSLIARASKVIFIDLDGT-VDSGTLDELKSRHAGFV 793

Query: 674 ----YANPTSALS------QLLNERAAPGPSDQQQQI 700
               Y+N TS         ++ +E   PGP   Q +I
Sbjct: 794 KLMEYSNHTSTDEEEGQDGEVEHEENRPGPHRSQSEI 830

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 135/530 (25%), Positives = 231/530 (43%), Gaps = 44/530 (8%)

Query: 167  LYEFLSFFTVALLIGCAA--NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
            L++F+  + + L I  AA  N    I+L   S R    L   +    L     FF++  +
Sbjct: 1025 LWKFVGIYAL-LGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFESTPI 1083

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +I+R  SD   V R++    +   K ++   V + ++    P      L F   +L  
Sbjct: 1084 GRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMP----WFLVFNAGLLVV 1139

Query: 285  ASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFV-AEGNELSRYNVAIRD 339
               +       S++L+     A   +  +  E L G   + +F  +E      +N   + 
Sbjct: 1140 YVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAFRHSERFHFLNFN---KT 1196

Query: 340  IFQVGXXXXXXXXXXXXXXSLL---GDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396
             FQ+                L    G +  +T L   + +  + Q++ G +   M Y   
Sbjct: 1197 QFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQ 1256

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFE---LTDRKPSISPTAG-HKYKPHRGVVEFKDVS 452
              N++  +    + I     +  R++E   L    P+I  ++   K  P  G + FKD S
Sbjct: 1257 VTNSLMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRPEKSWPSMGEIIFKDYS 1316

Query: 453  FSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQD 511
              Y  RP +  + K +N  I P   + +VG +G GKS+++L L R    + G+I ID  D
Sbjct: 1317 TKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGSIEIDGVD 1374

Query: 512  ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF 571
            I+K+    LR H+ I+ Q+     GT+R N+     Y+   +EI    +       I K 
Sbjct: 1375 ISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSV--QEIWKAVELAHLKPHIIKM 1432

Query: 572  -----PN---------TYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
                 P+           D  I   G  +S GQ+Q + ++RAL+ K  +L+LDEAT+A+D
Sbjct: 1433 MTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAVD 1492

Query: 618  VESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
            +E++  I  T  +  + K  TI++IAHR+ T+  S+ ++VL   G V E 
Sbjct: 1493 METDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVLDK-GEVKEF 1539

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 117/238 (49%), Gaps = 17/238 (7%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIV 527
           +F+   G+  C+VG  G GKST+   +L      +G      ++          R +   
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGP-----KEFISPEILVRARSVAYC 715

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLS 587
            Q P +M+ +I+DNI +G  Y  T   +    K C     +       +T++G +G  LS
Sbjct: 716 PQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISLS 773

Query: 588 GGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGH---LMKSKSMTIISIA 643
           GGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G    L+K K  TII   
Sbjct: 774 GGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTT 831

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKKLYA-NPTSALSQLLNE--RAAPGPSDQQQ 698
           + +S ++ S N+I     G +VE G +++  +    S L +L+ E    A  PSD+++
Sbjct: 832 NAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEFDTFAENPSDKKK 888

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 145/291 (49%), Gaps = 22/291 (7%)

Query: 408  YSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQ-IFKN 466
            YSEI      A  L E  DR+PS  P       P  G ++F+  S  Y  RP +  I K+
Sbjct: 1253 YSEI---PSEAPYLIE--DRRPS--PNW-----PTDGAIQFQHYSTRY--RPGLDLILKD 1298

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGI 526
            +N  I P   + IVG +G GKS++ L L R    + G I+ID   I +M    LR  + I
Sbjct: 1299 INLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSI 1358

Query: 527  VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-YDTVIGSRGTL 585
            + Q+  +  G++R+NI     Y  + EEI  V       N +    N    T +   G  
Sbjct: 1359 IPQDSQVFEGSVRENIDPTEQY--SDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGN 1416

Query: 586  LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  +  T       +  TI++IAHR
Sbjct: 1417 LSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQETIRTAFADR--TILTIAHR 1474

Query: 646  LSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERA-APGPSD 695
            L+TI  S+ ++VL   G V E    + L  NP +    L  +    P PS+
Sbjct: 1475 LNTIMDSDRILVLDA-GRVAEFDTPENLLKNPGTMFYGLCQDAGFVPRPSN 1524

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 122/241 (50%), Gaps = 20/241 (8%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           + +F +  +P  ++  KN+NF+   G   C+VG  G GKS +   LL             
Sbjct: 635 NATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLL------------- 681

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++  +I  V Q   +M+GT++DNI +G  Y P  E      K C     
Sbjct: 682 -GDLFRVKGFATVHGNIAYVSQVAWIMNGTVKDNILFGHKYDP--EFYEKTIKACALTID 738

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +   P+   T++G +G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S   I++
Sbjct: 739 LAILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDH 798

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLN 686
             G     K+ T I   +++S +  +++V +L  +G +++ G F ++     S LS+L+ 
Sbjct: 799 VLGPNGLLKTKTKILATNKISALSIADSVTLL-ENGEIIQQGTFCEITKAADSPLSKLIK 857

Query: 687 E 687
           E
Sbjct: 858 E 858

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 144/588 (24%), Positives = 245/588 (41%), Gaps = 71/588 (12%)

Query: 139  VIGIVLDTLKTSSGSDFF-ELKIPIFSLPLYEFL-SFFTVALLIGCAANFGRFILLRILS 196
            VIG    +L +S    F+ E K P  S   Y  L SFF      G     G++ L+  + 
Sbjct: 895  VIGTTFLSLFSSVWLSFWTEQKFPNRSTSFYMGLYSFFVFG---GYLFMNGQYTLICYMG 951

Query: 197  ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALI-- 254
                  L    +++ LH    + D   +G +++R   D    + S+  ++++ ++  +  
Sbjct: 952  VTASKVLNLKAVERVLHTPMAYMDTTPIGRILNRFTKD----TDSLDNELTESLRLFMTQ 1007

Query: 255  -CGVVGVGMMCSLS-PQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEE 312
               ++GV +MC +  P  +I + F     +  A  +    R   +        +     E
Sbjct: 1008 FANIIGVCVMCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNE 1067

Query: 313  QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAY 372
             L G+ T++++ ++   L + +  I  + + G               ++  ++F  ++  
Sbjct: 1068 VLGGMDTIKAYGSQERFLVKTDFLINKMNEAGYLLVALQRWVAIFLDMIA-VAFALII-- 1124

Query: 373  GSYLVLQSQL-----SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG----AASRL-F 422
             S L +  Q      S+G L  ++L      N +    T     M  A      A+ L  
Sbjct: 1125 -SLLCVTRQFHISPASVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVYCANELPL 1183

Query: 423  ELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVG 481
            E   ++P ++P       P +G + F+DVSF+Y  RP + +  K ++  I     + I G
Sbjct: 1184 EADYKRPELAPPESW---PSKGEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICG 1238

Query: 482  PSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 541
             +G GKSTI   L R    S G I ID  DI ++    LR+ + I+ Q+PVL  GTIR N
Sbjct: 1239 RTGAGKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKN 1298

Query: 542  ----------------ITYGLTYTPTKEEIR-----SVAKQCFCHNFITKFPNTYDTVIG 580
                            ++ G       E ++     S+      H F        D  + 
Sbjct: 1299 LDPFQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKF------HLDQKVE 1352

Query: 581  SRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAIN----YTFGHLMKSKS 636
              G   S G++Q +A+ RAL+++  ILILDEATS++D E++  I       FG       
Sbjct: 1353 EEGANFSLGERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAFG------D 1406

Query: 637  MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
             TI+ IAHRL TI   + ++VL   G + E    + LY        Q+
Sbjct: 1407 CTILCIAHRLKTILTYDRILVL-EQGEIEEFDTPRSLYEKKDGIFRQM 1453

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/218 (35%), Positives = 102/218 (46%), Gaps = 22/218 (10%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC 517
           + S   FKNLN  I  G  V I GP G GKS++   +  +   ++GT+ +D      + C
Sbjct: 590 KKSFHGFKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDGD---LLMC 646

Query: 518 KSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT 577
                        P + + T+RDNI +G  Y   KE    V + C     I   P    T
Sbjct: 647 GY-----------PWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELT 693

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI--NYTFGHLMKSK 635
            IG RG  LSGGQK RI +AR++ K   I + D+  SA+D      I      G L   K
Sbjct: 694 EIGERGITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---K 750

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
             T I   H+LS I ++  VIVLG DGS  E GK + L
Sbjct: 751 GKTRILATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 125/489 (25%), Positives = 214/489 (43%), Gaps = 39/489 (7%)

Query: 218  FFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y V     R+ +Q + + VK +   +V    +C  + Q    
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFTMIV----ICWTTWQF--- 1097

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ T++ +    N
Sbjct: 1098 -IFIIGPLGVLYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGMSTIRGY----N 1151

Query: 329  ELSRYN----VAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSI 384
            +  R++      I +                     +G +  L       Y + Q  L+ 
Sbjct: 1152 QQRRFDHINHCRIDNNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLTA 1211

Query: 385  GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHK----YK 440
            G +   + Y       +  +     E+     +  R+ E ++ K         K    + 
Sbjct: 1212 GMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHW 1271

Query: 441  PHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN 499
            P  G + F   S  Y  RP +  + +++N  I P   + IVG +G GKS++ L L R   
Sbjct: 1272 PDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVE 1329

Query: 500  PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
             S+G I+ID   I ++    LR ++ I+ Q+  +  GTIR+N+    TY  T +EI  V 
Sbjct: 1330 ASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY--TDDEIWRVL 1387

Query: 560  KQCFCHNFITKF-PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
            +    +  +    P      +   G+ LS GQ+Q + +ARAL+    ILILDEAT+A+DV
Sbjct: 1388 ELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVDV 1447

Query: 619  ESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT 678
            E++  I  T     + +  TI++IAHR++TI  S+ ++VL   G V E      L  N  
Sbjct: 1448 ETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVLD-GGRVTEFDTPTNLLRNEG 1504

Query: 679  SALSQLLNE 687
            S    L  E
Sbjct: 1505 SQFHSLCQE 1513

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 98/428 (22%), Positives = 192/428 (44%), Gaps = 38/428 (8%)

Query: 272 ILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN--- 328
           ++LL  TP   F A +  K+++ +    ++   + T V  E L+ IK+++ +  E     
Sbjct: 452 VILLVMTPLNTFLAKI-QKRLQKSQMGFKD---ERTSVISEILNNIKSLKLYAWEEPYKK 507

Query: 329 --ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386
             E  R +  ++++ ++G               L+   +F  V  Y     L   L    
Sbjct: 508 KLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTF-AVFVYTEDRALTVDLVFPA 566

Query: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE-LTDRKPSISPTAGHKYKPHRGV 445
           LT F L +      +F +    +  ++ + + +RLF  LT+ +             + G 
Sbjct: 567 LTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQKDSVQRLPKVTNVGD 622

Query: 446 VEFK---DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
           V  K   D +F +  +P  ++  KN+NF+   G   C+VG  G GKS +   L       
Sbjct: 623 VAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSALIQSL------- 675

Query: 502 TGTIMIDDQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
                    D+ ++    ++   +  V Q   +M+GT+++NI +G  Y P  E      K
Sbjct: 676 -------SGDLFRVKGFATVHGSVAYVSQVAWIMNGTVKENILFGHRYDP--EFYDKTIK 726

Query: 561 QCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE- 619
            C     +    +  +T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   
Sbjct: 727 ACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHV 786

Query: 620 SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
            +  + +  G     ++ T I   +++S +  ++ + +L  +G +VE G + ++ A+  S
Sbjct: 787 GKHLLEHVLGPTGLLRTKTKILATNKISVLSIADRIALL-ENGEIVEQGSYDEVTADGDS 845

Query: 680 ALSQLLNE 687
           ALS+L+ +
Sbjct: 846 ALSKLIRD 853

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 130/245 (53%), Gaps = 11/245 (4%)

Query: 446  VEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
            + F  V   Y P  P V   KN++F + P S V IVG +G GKST+ + L R    + GT
Sbjct: 1238 ISFDHVYVRYAPHLPDV--LKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGT 1295

Query: 505  IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC-- 562
            I I   DI  +N ++LRR + ++ Q+P L SGTI+ NI     Y  + +E+   A++   
Sbjct: 1296 IRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRY--SDQELTHFARRIGL 1353

Query: 563  FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
            F      +  N+  +++   G  +S GQ+Q + +ARAL++K  ILILDEAT+++D E++ 
Sbjct: 1354 FSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHETDA 1413

Query: 623  AINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALS 682
             I         S    +I++AHR+STI   + VIVL  D  +V+      L      A  
Sbjct: 1414 TIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQNGAFH 1469

Query: 683  QLLNE 687
            Q+  E
Sbjct: 1470 QMCKE 1474

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 144/316 (45%), Gaps = 31/316 (9%)

Query: 365 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYT-----GNAVFGLSTFYSEIMQGAGAAS 419
           + +T   +G+ + LQ Q     +T    YT  T      N +  L+T    I+Q   +  
Sbjct: 556 TLVTAATFGASIYLQKQ----KITVASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQ 611

Query: 420 RLFELTDRKPSISPTAGHK-YKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVC 478
           R+ +  +R    S T  H+  K     + F++ S ++    +  + KNL           
Sbjct: 612 RIEKFLNR----SNTKKHEILKDSFTEMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNV 667

Query: 479 IVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTI 538
           I+GPSG GKS++ L LL   +   G+I +    +    C           Q P + + T+
Sbjct: 668 IIGPSGSGKSSVLLALLGELDLIEGSIRVPRGYMHDDRCS-----FAFCSQTPWITNATV 722

Query: 539 RDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIAR 598
           ++NI +   +   + +   V   C     I +     +TV+G +G  LSGGQ+QR+A+AR
Sbjct: 723 KENIVFSSQFNTKRYQ--EVLHACGLEEDILEMQEGDETVVGDKGMTLSGGQRQRLALAR 780

Query: 599 ALIKKPTILILDEATSALDVESEGAINYTF-----GHLMKSKSMTIISIAHRLSTIRRSE 653
           A+      L+LD+  SA+D    G   + F     G LMK K  T I   H ++ +++  
Sbjct: 781 AVYSGAEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMKGK--TCILATHNIALVQKHA 835

Query: 654 NVIVLGHDGSVVEMGK 669
           ++I+L  +G V ++GK
Sbjct: 836 DMIILLDNGRVSKIGK 851

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 135/557 (24%), Positives = 235/557 (42%), Gaps = 80/557 (14%)

Query: 163  FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNH 222
            F + +Y F  F ++  L G      +F LL  +  R    L    + + +H    F ++ 
Sbjct: 839  FYMGMYSFFVFGSIVFLTG------QFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMEST 892

Query: 223  KVGDLISRLGSDAYVVSRSMTQKVSDGVKALI---CGVVGVGMMCSLS-PQLSILLLFFT 278
             +G +++R   D    + S+  ++ D ++ ++   C +VG+ ++C +  P  +I +    
Sbjct: 893  PMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGLG 948

Query: 279  PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE------------ 326
              +  + S +    R   +        +     + L G+ T++++ AE            
Sbjct: 949  LILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLID 1008

Query: 327  -GNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIG 385
              NE S    A++    +               SLL       +    + +VL   L I 
Sbjct: 1009 KTNEASYLYTAVQR--WINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIP 1066

Query: 386  DLT----AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKP 441
            DL       +  TE   N+V  L T+ +E+ Q A     +       PS       K  P
Sbjct: 1067 DLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHGEEV-------PS-------KTWP 1112

Query: 442  HRGVVEFKDVSFSY-PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
              G ++F++V +++    P+V        KIA G  V I G +G GKST+   L R    
Sbjct: 1113 ENGEIKFENVRYTHRDGLPAV--LDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREV 1170

Query: 501  STGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             +G +MIDD D++K+N  +LR  + I+ Q+PVL  G++R N+       P  E    V K
Sbjct: 1171 ESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNL------DPFGEYDDDVLK 1224

Query: 561  QCFCHNFITKFPNT---------------------YDTVIGSRGTLLSGGQKQRIAIARA 599
                   + KF  T                      D  +   G   S G++Q +A+ARA
Sbjct: 1225 NALMRCTVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARA 1284

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLG 659
            LI+  +IL+LDEAT+A+D  ++  +        K +  T++ +AHRL TI   + ++VL 
Sbjct: 1285 LIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVL- 1341

Query: 660  HDGSVVEMGKFKKLYAN 676
             +G ++ +   K L  N
Sbjct: 1342 ENGKIIGLDTPKSLLDN 1358

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 114/216 (52%), Gaps = 28/216 (12%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKST----IALLLLRYYNPSTGTIMIDDQDITKMNCKS 519
           F +LNF+I  G  + IVGP G GK++    I  L+ +Y N   G + +D   ++   C  
Sbjct: 531 FHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGNE--GELEVDGSLVS---CGY 585

Query: 520 LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD-TV 578
                      P + + T+RDNI +G  Y  +K   + V + C     + K  + YD T 
Sbjct: 586 -----------PWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKL-SAYDMTE 631

Query: 579 IGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS-KSM 637
           IG RG  LSGGQK RI +AR+L K+  I + D+  SA+D     +I      LM+  K+ 
Sbjct: 632 IGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKE--CLMEGLKNK 689

Query: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
           T +   H+LS I +++ +IVLG+DG   +MG+++ L
Sbjct: 690 TRVLATHQLSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 132/479 (27%), Positives = 217/479 (45%), Gaps = 59/479 (12%)

Query: 218  FFDNHKVGDLISRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSIL 273
            FF+   +G +++R  +D Y    ++ R+  Q  ++ VK     VV    +C  + Q    
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVV----ICMATWQ---- 1094

Query: 274  LLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQLSGIKTVQSFVAEGN 328
             +F   P+      + +    TS++L+     +TR       +E L G+ T++ + ++ N
Sbjct: 1095 FIFIVLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGLTTIRGY-SQQN 1152

Query: 329  ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDL 387
                 N       +V                L   L F+ +V+   + ++   +L  G L
Sbjct: 1153 RFVHINQT-----RVDNNMSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLGNGTL 1207

Query: 388  TAFMLYTEYTGNAVFGLS-TFYSEIMQGAGAASRL----------FELTDRKPSISPTAG 436
            TA M+          GLS +F  +I Q      R+           E       +   A 
Sbjct: 1208 TAGMI----------GLSLSFALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAP 1257

Query: 437  HKYKPHRGVV------EFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKST 489
            +  K HR         E K V++S   RP ++ I K+++  I P   + IVG +G GKS+
Sbjct: 1258 YIIKDHRPPASWPESGEIKFVNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSS 1317

Query: 490  IALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYT 549
            + L L R    ++G I+ID   I  +    LR  + I+ Q+  +  GT+R+NI     Y 
Sbjct: 1318 LTLALFRIIEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENIDPTNRY- 1376

Query: 550  PTKEEIRSVAKQCFCHNFITKF-PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI 608
             T EEI +        + I     N  +T++   G+ LS GQ+Q + +ARAL+    ILI
Sbjct: 1377 -TDEEIWNALALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILI 1435

Query: 609  LDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
            LDEAT+A+DVE++  I  T  +  K +  TI++IAHR++TI  S+ +IVL   G V E 
Sbjct: 1436 LDEATAAVDVETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVLD-KGRVTEF 1491

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 129/264 (48%), Gaps = 41/264 (15%)

Query: 446 VEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           V+  D +F +  +P  ++  KN+NF    G   CIVG  G GKS +   LL         
Sbjct: 624 VKVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGKVGSGKSALIQSLL--------- 674

Query: 505 IMIDDQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
                 D+ ++    ++   +  V Q P +M+GT++DNI +G  Y P  E  +   K C 
Sbjct: 675 -----GDLIRVKGFATVHGDVANVSQVPWIMNGTVKDNILFGHKYDP--EFYQLTIKACA 727

Query: 564 CHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEG 622
               ++  P+   T++G +G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++ 
Sbjct: 728 LSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKH 787

Query: 623 AINYTFG--HLMKSKS-------MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
            I +  G   L+ SK+       +T++SIA          + I L  +G +++ G + ++
Sbjct: 788 LIEHVLGPHGLLHSKTKVLATNKITVLSIA----------DSITLMENGEIIQQGSYDQV 837

Query: 674 YANPTSALSQLLNE---RAAPGPS 694
             +  S LS+L+ E   +  P PS
Sbjct: 838 NESTNSPLSKLIAEFGKKGKPTPS 861

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 130/559 (23%), Positives = 238/559 (42%), Gaps = 49/559 (8%)

Query: 169  EFLSFFTVALLIGCAA----NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKV 224
            +FL F T+  +IG  +    N    I+L   S R   +L   +    +     FF+   +
Sbjct: 1019 DFLKFVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPI 1078

Query: 225  GDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            G +++R  SD   +   +    S   ++++  VV + ++    P    L         + 
Sbjct: 1079 GRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYY 1138

Query: 285  ASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVG 344
             + +    R   +    +   +  +  E L G   + +F    +  SR+N    +  Q  
Sbjct: 1139 QAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----DHTSRFNFFNFETVQYN 1194

Query: 345  XXXXXXXXXXXXXXSL-LGDLSFLTVLAYG--SYLVL--QSQLSIGDLTAFMLYTEYTGN 399
                          S+ L  +  L +LA G  S+  L  + QLS G +   M Y+    +
Sbjct: 1195 IDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTS 1254

Query: 400  AVFGLSTFYSEIMQGAGAASRLFELTDRKPS----ISPTAGHKYKPHRGVVEFKDVSFSY 455
            ++  +     +I     +  R  E  + KP     I  +   +  P  G +EF + +  Y
Sbjct: 1255 SLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKY 1314

Query: 456  PTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITK 514
              R ++  + K++N  I P   + IVG +G GKST+ L L R    + G+I ID  DI+K
Sbjct: 1315 --RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISK 1372

Query: 515  MNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--- 571
            +  + LR ++ I+ Q+     GTIR N+     +  + EE+    +       I +    
Sbjct: 1373 IGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQH--SDEELWRAVELSHLKQHILRMNEE 1430

Query: 572  ---------------PNTYD------TVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
                           P++++      T I   G+ +S GQ+Q + ++RAL+    +LILD
Sbjct: 1431 ANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILD 1490

Query: 611  EATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
            EAT+A+D+E++  +  T  +  K +  TI++IAHR+ T+   + ++VL   G V E    
Sbjct: 1491 EATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVLDK-GEVAEFDTV 1547

Query: 671  KKLYANPTSALSQLLNERA 689
              L ++  +   +L  + A
Sbjct: 1548 SNLLSDKNTMFYKLCEQGA 1566

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 119/233 (51%), Gaps = 21/233 (9%)

Query: 464 FKNL-NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI-MIDDQDITKMNCKSLR 521
            KN+ NF +  GS  CIVG  G GKSTI   +L       G +  I   D T+    ++R
Sbjct: 645 LKNIDNFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIR 697

Query: 522 -RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
              I    QE  +M+ ++++NI +G  +      +  V + C   + ++  P+  +T++G
Sbjct: 698 ATSIAYCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVG 755

Query: 581 SRGTLLSGG-QKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGH---LMKSK 635
            +G  L GG QK RI++ARA+  +  + +LD+  SA+D   S+  I Y       L+++K
Sbjct: 756 EKGISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK 815

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKK-LYANPTSALSQLLNE 687
             TII   + ++ ++ S+ +  +   G +VE   ++  + ++  S + +L+ E
Sbjct: 816 --TIILSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEE 865

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  123 bits (309), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 147/532 (27%), Positives = 234/532 (43%), Gaps = 94/532 (17%)

Query: 206  HVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCS 265
            +++   LH +  FFD   VG +++R   D             +GV   +   + V + C 
Sbjct: 1078 NMLDLVLHANIRFFDVTPVGRIMNRFAKDI------------EGVDQELIPYLEVTIFC- 1124

Query: 266  LSPQLSILLLF--FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAE-----------E 312
            L   LSI+ L    TP  L  A V         K    A  +L R+             E
Sbjct: 1125 LIQCLSIIFLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSE 1184

Query: 313  QLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDL-SFLTVLA 371
             L+G+ T+++F   G+E  R+ +   D                   +   D+     VL 
Sbjct: 1185 TLAGVCTIRAF---GDE-KRFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFIVLG 1240

Query: 372  YGSYLVLQ-----SQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELT- 425
             GS+++L      S L+   LT  +L+T+        L   YS       +  RL E + 
Sbjct: 1241 SGSFILLNIGDIDSSLAGISLTYSILFTD----GALWLVRLYSTFEMNMNSVERLKEYSG 1296

Query: 426  ----DRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTR-PSVQIFKNLNFKIAPGSSVCIV 480
                +   +      +   P  G +E  ++S  Y +  P V   KN++F + P + + IV
Sbjct: 1297 IEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYASNLPPV--IKNVSFTVDPQTKIGIV 1354

Query: 481  GPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRD 540
            G +G GKSTI   L R   P TG I ID  DI+K++  +LRR I I+ Q+P+L +GTI+ 
Sbjct: 1355 GRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKS 1414

Query: 541  NITYGLTYTPTKE-EIRSVAKQCFCHNFIT------------KFPNTYDTVIGSR----- 582
            N+       P  E + R + K     N I+             F   ++  +  R     
Sbjct: 1415 NL------DPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVE 1468

Query: 583  -GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE----GAINYTFGHLMKSKSM 637
             G  LS G+KQ + IAR+L+++P I++LDEATS++D +S+    G I   F     S+S 
Sbjct: 1469 GGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEF-----SRS- 1522

Query: 638  TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERA 689
            TI++IAHRL ++   + V+V+       + G+ K+ Y +P   L    NER+
Sbjct: 1523 TILTIAHRLRSVIDYDKVLVM-------DAGEVKE-YDHPYELLK---NERS 1563

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 84/327 (25%), Positives = 145/327 (44%), Gaps = 32/327 (9%)

Query: 365 SFLTVLAYGSYLVLQSQ-----LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAAS 419
           + +T + +  Y+ +Q Q     L+   L+ F L        +  LS   S + Q   +  
Sbjct: 581 TLVTSVTFAVYIFVQQQELNAPLAFTTLSLFTLLK----TPLDQLSNMLSFMNQSKVSLE 636

Query: 420 RLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPS-VQIFK----NLNFKIAPG 474
           R+ E  + + + +        P +  ++FK  +  +    + +  F+    N+NF+I  G
Sbjct: 637 RIVEFLNEEDT-AKYNQLTVSPDKNKIKFKKATLVWNENDNDINKFRLCDLNINFRI--G 693

Query: 475 SSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQD-----ITKMNCKSLRRHIGIVQQ 529
               I+G +G GKS + + LL      +G+I++   +     I  +N   L        Q
Sbjct: 694 KLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIPDLN--GLTNSFAYCSQ 751

Query: 530 EPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGG 589
              L++GT+R+NI +   Y   +   ++V   C     +   P    T IG +G  LSGG
Sbjct: 752 SAWLLNGTVRNNIIFNGVYDENR--YKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGG 809

Query: 590 QKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF---GHLMKSKSMTIISIAHRL 646
           QKQRI++ARA+      ++LD+  SA+D  +   I Y     G LMK++  T I + H +
Sbjct: 810 QKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNI 866

Query: 647 STIRRSENVIVLGHDGSVVEMGKFKKL 673
           S   R     V+  +G V   G   +L
Sbjct: 867 SLAIRKAYFAVILENGKVKSQGTITEL 893

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 138/268 (51%), Gaps = 23/268 (8%)

Query: 425  TDRKPSISPTAG-----HKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCI 479
            ++R P   P AG     H Y  +R     +D+ +         + K++N +I P   + I
Sbjct: 1281 SNRPPKEWPVAGEIKFEHYYTRYR-----EDLDY---------VLKDINLEIKPREKIGI 1326

Query: 480  VGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIR 539
            VG +G GKS++ L L R    ++G I+ID   I ++    LR H+ I+ Q+  +  GTIR
Sbjct: 1327 VGRTGAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIR 1386

Query: 540  DNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARA 599
            +NI     +T   +  R++       + +    +   T++   G+ LS GQ+Q + +ARA
Sbjct: 1387 ENIDPTNQFTDA-DIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARA 1445

Query: 600  LIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLG 659
            L+    +L+LDEAT+A+DVE++  I  T     K +  TI++IAHR++TI  ++ +IVL 
Sbjct: 1446 LLVPSKVLVLDEATAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVLD 1503

Query: 660  HDGSVVEMGKFKKLYANPTSALSQLLNE 687
              G VVE    + L  N  S    L  E
Sbjct: 1504 -KGKVVEFDTPEALLKNTNSIFYSLSKE 1530

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 116/507 (22%), Positives = 222/507 (43%), Gaps = 47/507 (9%)

Query: 199 VVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKV----SDGVKALI 254
           V + L + + +K L    E  +    GD+++ +  D   + + +TQ +    S  ++ ++
Sbjct: 396 VKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIHLIWSGPLQIVL 454

Query: 255 CGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
           C ++ +  +   S  + +L+L    PV    S   K  +N  K   +   + TRV  E L
Sbjct: 455 C-LISLYKLLGHSMWVGVLILTIMIPV---NSFLMKIQKNLQKSQMKFKDERTRVISEIL 510

Query: 315 SGIKTVQSFVAEGN-----ELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTV 369
           + +K+++ +  E       E  R    ++++ ++G               L+   +F  V
Sbjct: 511 NNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTF-AV 569

Query: 370 LAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFE-LTD-- 426
             Y     L + L    LT F L +      +  +    + I++ + + SRLF  LT+  
Sbjct: 570 FVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEE 625

Query: 427 -RKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSG 484
            +K ++      K      V    + +F +  +P  ++  KN+N++   G   CIVG  G
Sbjct: 626 LQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVGKVG 685

Query: 485 RGKSTIALLLLRYYNPSTGTIMIDDQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNIT 543
            GKS     LL               D+ ++    ++   +  V Q   +M+GT+RDN+ 
Sbjct: 686 SGKSAFLQSLL--------------GDLFRVKGFATIHGSVAYVSQVAWIMNGTVRDNVL 731

Query: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKK 603
           +G  Y P  E      K C     +    +   T++G +G  LSGGQK R+++ARA+  +
Sbjct: 732 FGHKYDP--EFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYAR 789

Query: 604 PTILILDEATSALDVE-SEGAINYTFG--HLMKSKSMTIISIAHRLSTIRRSENVIVLGH 660
               +LD+  +A+D   S   + +  G   L+ SK  T I   +++S +  ++++ +L  
Sbjct: 790 ADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSK--TRILATNKISVLSAADSITLL-E 846

Query: 661 DGSVVEMGKFKKLYANPTSALSQLLNE 687
           +G + + G +     +  SAL +LL E
Sbjct: 847 NGEITQQGTYADCRKDEESALGKLLKE 873

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 130/528 (24%), Positives = 230/528 (43%), Gaps = 63/528 (11%)

Query: 173  FFTVALLIGCAANFGRFILLRIL----SERVVARLRAHVIKKTLHQDAEFFDNHKVGDLI 228
            +  V  + G  A+    I   IL    S      L   ++   L     FF+   +G ++
Sbjct: 969  YLGVYFMFGLGASLSTLIQSAILWIYCSIHASVYLHESMLAAVLRAPMSFFETTPIGRIL 1028

Query: 229  SRLGSDAY----VVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFS 284
            +R  +D Y    +++R+ +Q  ++  +     +V    +C  + Q +    FF  P+   
Sbjct: 1029 NRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV----ICVTTWQFT----FFVIPLAML 1080

Query: 285  ASVFGKQIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI 340
               + +    TS++L+         +    +E L+G+ +++ +     +L R+ + I   
Sbjct: 1081 YIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVSSIRGY----GQLDRF-IHINQA 1135

Query: 341  FQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNA 400
             ++                L   L F+     GS ++  +      L+ F L +    + 
Sbjct: 1136 -RINNNTSAYYPSMNVNRWLAYRLEFI-----GSCIIFFA----ATLSVFRLASGSLTSG 1185

Query: 401  VFGLSTFYS---------------EIMQGAGAASRLFELTDRKPS----ISPTAGHKYKP 441
            + GLS  Y+               E+     +  R+ E  + +P     I+ +      P
Sbjct: 1186 MVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQFIANSVPSGDWP 1245

Query: 442  HRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
              G ++F++ S  Y  RP +  I + +N  I P   V IVG +G GKS++AL L R    
Sbjct: 1246 KDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGKSSLALSLFRIIEA 1303

Query: 501  STGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
            + G I ID   I  +    LR+ + I+ Q+  +  GT+RDNI     Y  T E+I    +
Sbjct: 1304 AEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNIDPTKQY--TDEQIWKALE 1361

Query: 561  QCFCHNFITKF-PNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                 + +     +  DT +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE
Sbjct: 1362 LSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDEATAAIDVE 1421

Query: 620  SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEM 667
            ++  I  T       +  TI++IAHR++TI  S+ ++VL   G+V E 
Sbjct: 1422 TDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVAEF 1466

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 115/525 (21%), Positives = 222/525 (42%), Gaps = 102/525 (19%)

Query: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQK---VSDGVKALICGVVGVGMM 263
           + KK LH   E       GD+++ +  DA  + R +TQ    +  G   L   +  +  +
Sbjct: 366 IYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLCLYSLHRL 424

Query: 264 CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ-- 321
                 + ++LL FT P+    S   + ++   K+  +   + TR+  E L+ IK+++  
Sbjct: 425 LGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSLKLY 481

Query: 322 ----------SFVAEGNELS--------------RYNVAIRDIFQVGXXXXXXXXXXXXX 357
                      +V    EL               +YN+     F V              
Sbjct: 482 AWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIP---FLVSCSTFAVFVLTQKG 538

Query: 358 XSLLGDLSF------------LTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLS 405
             L  DL F            L VL       +++ ++IG LT F+   E   +A+    
Sbjct: 539 RPLTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVAIGRLTNFLTAEELQRDAI---- 594

Query: 406 TFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQI-F 464
                                R+P++    G        V    + +F +  +P  ++  
Sbjct: 595 --------------------TREPAVKAPGG------VAVALADNATFLWQRKPEYKVAL 628

Query: 465 KNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSL-RRH 523
           KN+NF+       CI+G  G GKS +   +L               D+ ++N  ++ R +
Sbjct: 629 KNINFRAKKSELTCIIGKVGSGKSALIQAML--------------GDLFRVNGSAVVRGN 674

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
           +  V Q   +M+GT+RDNI +G  Y    +  +   K C     ++  P+  +T +G +G
Sbjct: 675 VAYVSQVAWIMNGTVRDNILFGHKYDA--KFYQQTIKACALTVDLSILPDGDNTFVGEKG 732

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFG--HLMKSKSMTII 640
             LSGGQK R+++ARA+  +    +LD+  +A+D   ++  +   FG   L+KSK+  + 
Sbjct: 733 ISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLT 792

Query: 641 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLL 685
           +  ++++ +  ++++++L  +G +V+ G F ++ ++  SA+S+L+
Sbjct: 793 T--NKITALEIADHIVLL-ENGEIVQQGTFSEVISDEDSAISKLV 834

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/259 (31%), Positives = 142/259 (54%), Gaps = 31/259 (11%)

Query: 441  PHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500
            P  G +EFK++S  Y    S +   N++FK+  G+ V IVG +G GKS+I   + R  + 
Sbjct: 1301 PQTGEIEFKNLSLRYSPHSS-KALDNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDW 1359

Query: 501  STGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560
             +GTI+ID++DI  ++ + LR  I  + Q P L  GTIR N+     Y+  K+   ++AK
Sbjct: 1360 ESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSD-KQVFDALAK 1418

Query: 561  -------QCFCHNFITK-------FPNTY---DTVIGSRGTLLSGGQKQRIAIARALIKK 603
                   +  C   +T         PN +   ++V+ S G+ LS GQ+Q + +AR+++  
Sbjct: 1419 VGLIERNEVLC--LVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGS 1476

Query: 604  PTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGS 663
              I+++DEAT+++D  S+  I  T    M++   TI++IAHRL ++     ++V+     
Sbjct: 1477 RKIMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM----- 1529

Query: 664  VVEMGKFKKLYANPTSALS 682
              +MG+ K+ Y +P + +S
Sbjct: 1530 --DMGRVKE-YDHPYNLIS 1545

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/258 (30%), Positives = 122/258 (47%), Gaps = 10/258 (3%)

Query: 446 VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI 505
           V FKD +  +    +    KN++ +    S   I+GP+G GKS++ L LL   N  +G I
Sbjct: 664 VGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQI 723

Query: 506 MI---DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 562
            +   D +D  ++    +   +    Q P L+SGTI DNI +G    P +    +V K C
Sbjct: 724 YVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKAC 781

Query: 563 FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +        T +G  G  LSGGQ+QR+A+ARA+      L+LD+  SA+D E+  
Sbjct: 782 CLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPETAL 841

Query: 623 AI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSA 680
            I      G +MK ++  I S  H +S I +    +V+  +G V   GK   L A   + 
Sbjct: 842 NIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGKPSDL-AESNNF 898

Query: 681 LSQLLNERAAPGPSDQQQ 698
           L + +N   A    +Q +
Sbjct: 899 LKESMNNGLADESGNQAK 916

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 127/504 (25%), Positives = 228/504 (45%), Gaps = 53/504 (10%)

Query: 175  TVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSD 234
            T+ L + C     R+ L  I++  V   LRA ++         FF+   +G +++R  +D
Sbjct: 1012 TIILWVFCTIRGSRY-LHSIMAASV---LRAPMV---------FFETTPIGRILNRFSND 1058

Query: 235  AYVVS----RSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGK 290
             Y V     R+  Q   +  K     +V    +C  + Q   L+L    P++     + +
Sbjct: 1059 IYKVDELLGRTFAQFFVNVTKVSFTIIV----ICVTTWQFIFLIL----PMIVLYVYYQQ 1110

Query: 291  QIRNTSKDLQE----ATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXX 346
                TS++L+         +    +E L G+ T++ +  + +  +  N +     ++   
Sbjct: 1111 YYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGY-DQQDRFTHINQS-----RIDNN 1164

Query: 347  XXXXXXXXXXXXSLLGDLSFL-TVLAYGSYLVLQSQLSIGDLTAFML-----YTEYTGNA 400
                         L   L F+ T++ +G+  +   +L  G LT  M+     Y      +
Sbjct: 1165 MSAFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSLSYALQITQS 1224

Query: 401  VFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKP-----HRGVVEFKDVSFSY 455
            +  +     E+     +  R+ E ++ K S +P     ++P      +G ++F+  S  Y
Sbjct: 1225 LNWIVRMTVEVETNIVSVERIKEYSEIK-SEAPLVIEDHRPPADWPSKGDIKFEHYSTRY 1283

Query: 456  PTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKM 515
                ++ + K++N  + P   + IVG +G GKS++ L L R    + G I+ID   I ++
Sbjct: 1284 RENMNL-VLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVIDGVPINEI 1342

Query: 516  NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF-PNT 574
                LR  + I+ Q+  +  GT+R+NI     Y  + EEI  V +     N +     + 
Sbjct: 1343 GLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQY--SDEEIWRVLELSHLKNHVLSMSKDG 1400

Query: 575  YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS 634
              T +   G  LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T     K 
Sbjct: 1401 LMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQETIRTAFKD 1460

Query: 635  KSMTIISIAHRLSTIRRSENVIVL 658
            +  TI++IAHRL+TI  S+ ++VL
Sbjct: 1461 R--TILTIAHRLNTIMDSDRILVL 1482

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 120/250 (48%), Gaps = 38/250 (15%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  Q+  KN+N ++  G   C+VG  G GKS +   LL             
Sbjct: 636 DANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLL------------- 682

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++      V Q P +M+GT++DNI +G  Y P   ++    K C     
Sbjct: 683 -GDLYRVKGYAAVHGSTAYVSQVPWIMNGTVKDNILFGHKYDPVFYDL--TIKACALTID 739

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           +   P+   T++G +G  LSGGQK R+++ARA   +    +LD+  +A+D   ++  I +
Sbjct: 740 LGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEHVAQHLIEH 799

Query: 627 TFG--HLMKSKS-------MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANP 677
             G   L+KSK+       +T++SIA  +S +            G +++ G ++ +  + 
Sbjct: 800 VLGPRGLLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQHGSYEDISKDL 849

Query: 678 TSALSQLLNE 687
            S LS L+ E
Sbjct: 850 DSPLSNLVKE 859

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 140/289 (48%), Gaps = 26/289 (8%)

Query: 417  AASRLFELTDRKPS----ISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKI 471
            +  R+ E  +  P     I  +   K  P RG + F++ S  Y  R ++  + K++  +I
Sbjct: 1264 SVERILEYCNLPPEADAIIEESRPPKEWPSRGAITFQNYSTKY--RENLDPVLKDITVEI 1321

Query: 472  APGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEP 531
             P   + IVG +G GKST++L L R   PS G+I+ID  DI K+    LR ++ I+ Q+ 
Sbjct: 1322 KPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDA 1381

Query: 532  VLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNT-----Y 575
                GTI+ N           I   L  +  K  I  +A +    N  T    T      
Sbjct: 1382 QAFEGTIKSNLDPFGQYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELL 1441

Query: 576  DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
               I   G  LS GQ+Q + ++RAL+    IL+LDEAT+A+D+E++  I  T     K +
Sbjct: 1442 SARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR 1501

Query: 636  SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
              TI++IAHR+ T+  S+ ++VL   G V E      L A+ ++    L
Sbjct: 1502 --TILTIAHRIDTVMDSDKIMVLDK-GEVKEFDTPTNLLADKSTIFYNL 1547

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 150/319 (47%), Gaps = 35/319 (10%)

Query: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSIS-PTA 435
           ++++ +SI  L  F+L  E        L  F+ E +            T   P+I    A
Sbjct: 573 IIETGVSIKRLKDFLLAEE--------LDDFFIERLDANA--------TSNSPAIEIYNA 616

Query: 436 GHKYKPHRGVVEFKDVSFSYPTRPSVQIFKNL-NFKIAPGSSVCIVGPSGRGKSTIALLL 494
              +K  +G+ E ++         +    KN+ +F+   G   CIVG  G GKST    +
Sbjct: 617 TFLWKSTKGLKEDENYDEEAAVASTKVALKNIRHFEARKGDLTCIVGRVGSGKSTFLQAI 676

Query: 495 LRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEE 554
           L      +G   +D+    K+  ++  + I    Q+P +M+ +++DN+ +G  +   ++ 
Sbjct: 677 LGQLPCISG---LDEHVPPKLIIRA--KSIAYCPQQPWIMNASLKDNVIFG--HRLNEDY 729

Query: 555 IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
            ++  ++C     +   P+   T++G +G  LSGGQK R+++ARA+  +  + +LD+  S
Sbjct: 730 YKATIRKCQLLPDLDILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDILS 789

Query: 615 ALDVE-----SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
           A+D E      E  +N   G L   K+ T+I   + +S ++ S+N+  L  DG +VE   
Sbjct: 790 AVDAEVSKNIVEQVLNRGTGIL---KNKTVILTTNAVSVLKHSQNIYAL-LDGEIVENKS 845

Query: 670 F-KKLYANPTSALSQLLNE 687
           +   +  + +S L  L+ E
Sbjct: 846 YADAMSCDDSSILKTLIQE 864

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 135/555 (24%), Positives = 220/555 (39%), Gaps = 85/555 (15%)

Query: 203  LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVS----RSMTQKVSDGVKALICGVV 258
            L + ++   L     FF+   +G +++R  +D Y V     R+ +Q  S+ VK     VV
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVV 1068

Query: 259  GVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVA-----EEQ 313
                +C  + Q     +FF  P+ F    + +    TS++L+     +TR       +E 
Sbjct: 1069 ----ICVSTWQF----IFFIVPMSFLYIYYQQYYMRTSRELRRLDS-VTRSPTISHFQET 1119

Query: 314  LSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYG 373
            L GI T++ +  E   +      + +                     LG +  L     G
Sbjct: 1120 LGGISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLG 1179

Query: 374  SYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRL---FELTDRKPS 430
             Y + Q  ++ G +   + Y      ++  +     E+     +  R+    EL    PS
Sbjct: 1180 IYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPS 1239

Query: 431  I----SPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQ---IFKNLNFKIAPGSSVCIVGPS 483
            I     P       P  G V+F      Y TR       + K++   I P   + IVG +
Sbjct: 1240 IVEDKRPDVNW---PQDGAVKFN----HYYTRYRADLDYVLKDITLDIKPREKIGIVGRT 1292

Query: 484  GRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNIT 543
            G GKS++ L L R    S G I +D  +  ++    LR  + I+ Q+  +  GT+RDNI 
Sbjct: 1293 GAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNID 1352

Query: 544  YGLTYTPTKEEIRSVAKQCFCHNFITKFP------------------------------- 572
                Y  T EEI    +     + I                                   
Sbjct: 1353 PTGQY--TDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSS 1410

Query: 573  -------------NTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619
                         N  +T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE
Sbjct: 1411 DGLTSSGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVE 1470

Query: 620  SEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
            ++  I  T     K++  TI++IAHRL+TI  S+ ++VL   G + E    + L  +  S
Sbjct: 1471 TDQLIQETIRSAFKNR--TILTIAHRLNTIMDSDRILVLD-KGEIKEFDSPQTLLGDKDS 1527

Query: 680  ALSQLLNERAAPGPS 694
                L  E+A   P+
Sbjct: 1528 LFYSLC-EQAGLTPA 1541

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 122/243 (50%), Gaps = 24/243 (9%)

Query: 450 DVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMID 508
           D +F +  +P  ++  KN+NF+   G   CIVG  G GKS +   +L             
Sbjct: 615 DATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSGKSALIQSIL------------- 661

Query: 509 DQDITKMN-CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 567
             D+ ++    ++   +  V Q P +M+GT+++NI +G  +   K+      K C     
Sbjct: 662 -GDLFRVKGFATVHGDVAYVSQVPWIMNGTVKENILFGHKFD--KKFYEKTIKACALTID 718

Query: 568 ITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINY 626
           ++  P+   T++G +G  LSGGQK R+++ARA+  +    + D+  +A+D    +  I +
Sbjct: 719 LSILPDGDSTLVGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEH 778

Query: 627 TFG--HLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQL 684
             G   L+ SK+     +A    T+    + I L  +G +++ GK++++ ++P S L +L
Sbjct: 779 VLGPNGLLHSKTKV---LATNKITVLNIADYITLLDNGEIIQRGKYEEVTSDPGSPLCKL 835

Query: 685 LNE 687
           +NE
Sbjct: 836 INE 838

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 120/544 (22%), Positives = 240/544 (44%), Gaps = 63/544 (11%)

Query: 170  FLSFFTVALLIGCAANFG----RFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            F+S F  A  +  A  FG    + I  ++LS   +A+LR H             D   VG
Sbjct: 1050 FISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFH-------------DITPVG 1096

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +++R   D  ++ + +         +++  +  + ++  ++P+     L F  P+    
Sbjct: 1097 RIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRF----LLFAIPLCALY 1152

Query: 286  SVFGKQIRNTSKDLQEA----TGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRD-- 339
             + G      S++L+         + ++  E + G+ T+++   E   +++  VAI    
Sbjct: 1153 YIVGSLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDKSN 1212

Query: 340  --IFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGSYL-VLQSQLSIGDLTAFMLYTEY 396
               F +               +L+   S L ++    YL    + + + +  +F    ++
Sbjct: 1213 APFFYLNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTETAQW 1272

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYP 456
                  G+    S + +         E ++     +P A     P  G +EF++++  Y 
Sbjct: 1273 IIKVFSGVELLMSSVERIKEYVDVPLESSESNNYATPLANW---PQTGDIEFENLTLRYS 1329

Query: 457  TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
               S +    ++FK+  G+ V IVG +G GKS+I   + R  +   GTI+ID++DI  + 
Sbjct: 1330 PHSS-KALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVP 1388

Query: 517  CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSVA----KQCFC------ 564
             + LR  I  + Q P L  GTIR N+     Y+  +  E +  V      +  C      
Sbjct: 1389 LECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQK 1448

Query: 565  ------HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                  H    +F +  +TV+ S G+ +S GQ+Q + +AR+++    I+++DEAT+++D 
Sbjct: 1449 LSYPSNHKLRNRFIDL-NTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDY 1507

Query: 619  ESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPT 678
             S+  I  T    M++   T+++IAHRL ++   + ++V+       +MG+ ++ Y +P 
Sbjct: 1508 VSDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM-------DMGRVEE-YDHPY 1557

Query: 679  SALS 682
            + +S
Sbjct: 1558 NLIS 1561

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 73/254 (28%), Positives = 118/254 (46%), Gaps = 14/254 (5%)

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI-- 505
           F++ +  +    +    KN++      +   I+GP+G GKS++ L LL   N  +G I  
Sbjct: 667 FENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGKINV 726

Query: 506 -MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
             +  +D  ++    +   +    Q P L+SGTI+DNI +G  +   +++   V K C  
Sbjct: 727 PTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEFFN--QQKFDDVIKCCCL 784

Query: 565 HNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624
              I        T +G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+D E+   I
Sbjct: 785 EKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHI 844

Query: 625 --NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALS 682
                 G +MK +  T I  +H +S I +    +V+  +G V   GK   L  +     S
Sbjct: 845 YEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVILDNGEVKAQGKPSDLIES-----S 897

Query: 683 QLLNERAAPGPSDQ 696
           + L E     P D+
Sbjct: 898 KFLKESINNDPGDK 911

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 134/550 (24%), Positives = 230/550 (41%), Gaps = 45/550 (8%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRIL-SERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            L+ F+  + +  +I  A N  R I++ I  S R   +L  ++    ++    FF+   +G
Sbjct: 1041 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1100

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R   D   V   +    S   ++L+  +V V ++    P   +  +F      +  
Sbjct: 1101 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1160

Query: 286  SVFGKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            + +      TS++L+  T      +  +  E L+G   + ++    N   R++    +  
Sbjct: 1161 AYYIV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESV 1212

Query: 342  QVGXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEY 396
            Q                S+ L  +  L VLA G    S +    QL+ G +   M Y+  
Sbjct: 1213 QFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQ 1272

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFEL----TDRKPSISPTAGHKYKPHRGVVEFKDVS 452
              N++  +     +I     +  R+ E      +    I  T   K  P  G ++F D S
Sbjct: 1273 VTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYS 1332

Query: 453  FSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQD 511
              Y  R ++  +   +N +I P   + IVG +G GKST+ L L R    + G I+ID  D
Sbjct: 1333 TKY--RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVD 1390

Query: 512  ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI--------------TYGLTYTPTKEEI-- 555
            I+ +    LR ++ I+ Q+     GTIR N+                     P  E I  
Sbjct: 1391 ISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIIS 1450

Query: 556  -RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             R    +    N   K  N  +  I   G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1451 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1510

Query: 615  ALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
            ++D+E++  I  T  +    +  TI++IAHR+ T+   + ++VL   G V E      L 
Sbjct: 1511 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLL 1567

Query: 675  ANPTSALSQL 684
             N  S    L
Sbjct: 1568 ENKNSIFYNL 1577

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 123/244 (50%), Gaps = 18/244 (7%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI-MIDDQDITKMNCKSLR 521
           FKN+N F++  GS  CIVG  G GK+T+   +L      +G    I  + I + N     
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS---- 727

Query: 522 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS 581
             I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G 
Sbjct: 728 --IAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGE 783

Query: 582 RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGH---LMKSKSM 637
           +G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I         L+KSK  
Sbjct: 784 KGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK-- 841

Query: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKK-LYANPTSALSQLLNERAAPGPSDQ 696
           TII   + +S ++ S+ +  L  +  ++E G +   + ++  S L  L+NE      ++ 
Sbjct: 842 TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNS 900

Query: 697 QQQI 700
           ++++
Sbjct: 901 KEEV 904

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 134/550 (24%), Positives = 230/550 (41%), Gaps = 45/550 (8%)

Query: 167  LYEFLSFFTVALLIGCAANFGRFILLRIL-SERVVARLRAHVIKKTLHQDAEFFDNHKVG 225
            L+ F+  + +  +I  A N  R I++ I  S R   +L  ++    ++    FF+   +G
Sbjct: 1013 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1072

Query: 226  DLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSA 285
             +I+R   D   V   +    S   ++L+  +V V ++    P   +  +F      +  
Sbjct: 1073 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1132

Query: 286  SVFGKQIRNTSKDLQEATG----QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIF 341
            + +      TS++L+  T      +  +  E L+G   + ++    N   R++    +  
Sbjct: 1133 AYYIV----TSRELKRLTSITYSPIMSLISETLAGYLVINAY----NHAKRFSYFNFESV 1184

Query: 342  QVGXXXXXXXXXXXXXXSL-LGDLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEY 396
            Q                S+ L  +  L VLA G    S +    QL+ G +   M Y+  
Sbjct: 1185 QFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQ 1244

Query: 397  TGNAVFGLSTFYSEIMQGAGAASRLFEL----TDRKPSISPTAGHKYKPHRGVVEFKDVS 452
              N++  +     +I     +  R+ E      +    I  T   K  P  G ++F D S
Sbjct: 1245 VTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYS 1304

Query: 453  FSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQD 511
              Y  R ++  +   +N +I P   + IVG +G GKST+ L L R    + G I+ID  D
Sbjct: 1305 TKY--RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVD 1362

Query: 512  ITKMNCKSLRRHIGIVQQEPVLMSGTIRDNI--------------TYGLTYTPTKEEI-- 555
            I+ +    LR ++ I+ Q+     GTIR N+                     P  E I  
Sbjct: 1363 ISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIIS 1422

Query: 556  -RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATS 614
             R    +    N   K  N  +  I   G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1423 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1482

Query: 615  ALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLY 674
            ++D+E++  I  T  +    +  TI++IAHR+ T+   + ++VL   G V E      L 
Sbjct: 1483 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLL 1539

Query: 675  ANPTSALSQL 684
             N  S    L
Sbjct: 1540 ENKNSIFYNL 1549

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 123/244 (50%), Gaps = 18/244 (7%)

Query: 464 FKNLN-FKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI-MIDDQDITKMNCKSLR 521
           FKN+N F++  GS  CIVG  G GK+T+   +L      +G    I  + I + N     
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS---- 699

Query: 522 RHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS 581
             I    Q+  +M+ ++++NI +G  Y      +    + C     +   P+  +T++G 
Sbjct: 700 --IAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGE 755

Query: 582 RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGH---LMKSKSM 637
           +G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I         L+KSK  
Sbjct: 756 KGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK-- 813

Query: 638 TIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKK-LYANPTSALSQLLNERAAPGPSDQ 696
           TII   + +S ++ S+ +  L  +  ++E G +   + ++  S L  L+NE      ++ 
Sbjct: 814 TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNNS 872

Query: 697 QQQI 700
           ++++
Sbjct: 873 KEEV 876

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 132/279 (47%), Gaps = 23/279 (8%)

Query: 417  AASRLFELTDRKPS----ISPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKI 471
            +  R+ E  D KP     I  +   K  P RG + F+  +  Y  R ++  + K+++ +I
Sbjct: 1282 SVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHYTTKY--RENLDPVLKDIDLRI 1339

Query: 472  APGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEP 531
                 + +VG +G GKST+ L L R   P  G I ID  DI+ +    LRR + I+ Q+ 
Sbjct: 1340 KHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQDA 1399

Query: 532  VLMSGTIRDN-----------ITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIG 580
                GT+R N           I   L  +  K  I  +  +        K  +  DT I 
Sbjct: 1400 QAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSELPDDE--NKPTDLLDTQIS 1457

Query: 581  SRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTII 640
              G  LS GQ+Q + ++RAL+    ILILDEAT+A+D E++  I  T     K +  TI+
Sbjct: 1458 DNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR--TIL 1515

Query: 641  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTS 679
            +IAHR+ T+  S+ ++VL   G V E      L  N  S
Sbjct: 1516 TIAHRIDTVLDSDKIMVLDK-GEVKEFDTPDNLLKNKES 1553

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 114/243 (46%), Gaps = 18/243 (7%)

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
           + P V +    NF        CIVG  G GKST    +L    P   +   D     K  
Sbjct: 636 SSPGVALKSIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQL-PCVSS---DSASGVKPK 691

Query: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576
                 ++    Q+P +M+ +++DNI +G  Y   +   +   K C     +   P+   
Sbjct: 692 VVIRADNLAYCPQQPWIMNASLKDNILFGYKYD--EAMYKKTIKACQLLPDLEILPDGDQ 749

Query: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE-SEGAINYTFGH---LM 632
           T++G +G  LSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+        L+
Sbjct: 750 TLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLL 809

Query: 633 KSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN-----PTSALSQLLNE 687
           K+K  T+I   + ++ +  S+ +I L  +G +VE   ++++ +        S+L +++ E
Sbjct: 810 KNK--TVILTTNAVNVLVHSD-MIYLLKNGKIVESNSYEEVMSKDRNNGEKSSLREIIEE 866

Query: 688 RAA 690
            A+
Sbjct: 867 FAS 869

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 117/505 (23%), Positives = 213/505 (42%), Gaps = 54/505 (10%)

Query: 202  RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261
            RL     K+ L+    F D   +G +++R   D  V+   +T      V  +   VVGV 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDSTRMFVFQM-ANVVGVF 956

Query: 262  MM-------CSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQL 314
            ++        +++  +S+LLL F      SA    K++    +        +     E L
Sbjct: 957  ILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSF------VYNNLGEVL 1010

Query: 315  SGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXXXXXXSLLGDLSFLTVLAYGS 374
             G+ T++++ A+   L + +  +    + G              +L  DL  + +    +
Sbjct: 1011 DGLDTIRAYNAQSRFLRKSDYFLNRTNEAGYLVIGARCWV----ALTTDLVAIAIALIVT 1066

Query: 375  YLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDR---KPSI 431
             L +   + I   +A +L T      V  +  +++ +++G          T R     + 
Sbjct: 1067 LLCVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATA 1121

Query: 432  SPTAGHKY---------KPHRGVVEFKDVSFSYPTRPSVQI-FKNLNFKIAPGSSVCIVG 481
             P    +Y          P  G + F++VSF+Y  RP + +    ++F +  G  + I G
Sbjct: 1122 LPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICG 1179

Query: 482  PSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDN 541
             +G GK+++   L R     +G+I ID  DI  +    LR  + I+ Q+P+L  GT+R N
Sbjct: 1180 RTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKN 1239

Query: 542  ITYGLTYTPTKEEIRSVAKQCFCHNFITK---FPNTY----DTVIGSRGTLLSGGQKQRI 594
            +       P  E            + +      P ++    D  +   G   S G++Q +
Sbjct: 1240 L------DPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLL 1293

Query: 595  AIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSEN 654
            A+ARAL++   ILILDEATS++D  ++  +        + +  T++ +AHRL TI   + 
Sbjct: 1294 ALARALVRSTRILILDEATSSVDYATDARVQARIA--AEFRQATVLCVAHRLRTIISYDR 1351

Query: 655  VIVLGHDGSVVEMGKFKKLYANPTS 679
            ++VL   G V E     +L+A   S
Sbjct: 1352 ILVLDQ-GRVAEFDTPYRLFARKDS 1375

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 106/215 (49%), Gaps = 19/215 (8%)

Query: 464 FKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
             +L F I  G  + ++G  G GK+++   +  Y   +TG++ ++    + + C      
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---SLLFC------ 601

Query: 524 IGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRG 583
            G+    P + + TIRDNI +G ++  T+ +   V   C        FP    T +G RG
Sbjct: 602 -GV----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVGERG 654

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIA 643
             LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + ++ T I   
Sbjct: 655 ITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILAT 713

Query: 644 HRLSTIRRSENVIVLGHDGSVVEMGKFKKLYA-NP 677
           H+L+ ++ +  VI LG DGS  +MG   +L+  NP
Sbjct: 714 HQLALVQEASRVIFLGQDGS-FDMGTPAELHEKNP 747

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 99/208 (47%), Gaps = 19/208 (9%)

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516
           ++ S   F +L+F++  G  + I G  G GK+++   L  + + + G I  + +    + 
Sbjct: 583 SKTSFSGFSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR---MLF 639

Query: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEI-RSVAKQCFCHNFITKFPNTY 575
           C +           P + + TIRDNIT+G   +P  E + R V + C     ++  P   
Sbjct: 640 CGA-----------PWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGD 685

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
            T +G RG  LSGGQK RI +AR + K   I + D+  SA+D    GA       L K  
Sbjct: 686 KTEVGERGITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARV-GASIMNDCLLGKLG 744

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGS 663
             T I   H++S   ++  VI LG DGS
Sbjct: 745 DKTRILATHQISLTEQASRVIYLGTDGS 772

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 157/376 (41%), Gaps = 40/376 (10%)

Query: 188  RFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ--K 245
            +F L+  L  R    +    + + LH    F D   +G +++R   D  ++   +T+  +
Sbjct: 939  QFSLVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLR 998

Query: 246  VSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQ 305
            +      +I GV+             I+ + + P    +  +        S   Q +  +
Sbjct: 999  MFSYQFTVIWGVI-------------IMSIIYLPWFAVAVPLLVVVFILVSDHYQCSARE 1045

Query: 306  LTRVA-----------EEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGXXXXXXXXXX 354
            + R+             E +SG+ T++++ AE   L + ++ I  + ++           
Sbjct: 1046 IKRLEAVQRSFVLNNFNEVISGVDTIKAYHAEARFLKKSDILIDRMNEMTFPLYASQRWV 1105

Query: 355  XXXXSLLGDLSFL--TVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIM 412
                 ++  L  L  ++L    +  + S  S G L  ++L      N +    T   ++ 
Sbjct: 1106 SILIGMIAVLFALIISILCVTGWFNI-SPASTGVLLTYVLQLPNLFNTLLRAMT---QLE 1161

Query: 413  QGAGAASRLFELTDRKPSISP-----TAGHKYKPHRGVVEFKDVSFSYPTRPSVQ-IFKN 466
                +A R+    +  P  +P      A  K  P RG + F +V+ +Y  RP +  + ++
Sbjct: 1162 NDMNSAERVLSYANSLPKEAPYRIPEMAPPKAWPERGAITFDNVALAY--RPGLPLVLQD 1219

Query: 467  LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGI 526
            ++F I+ G  + I G +G GKSTI   L R    S G++ ID  DI  +   +LR  + I
Sbjct: 1220 VSFHISSGEKIGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSI 1279

Query: 527  VQQEPVLMSGTIRDNI 542
            + Q+P+L  GTIR N+
Sbjct: 1280 IPQDPLLFRGTIRKNL 1295

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 576  DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
            D  +   G+  S G++Q +A+ARAL+++  ILILDEATS++D E++  I      + + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARI--VQEFQ 1475

Query: 636  SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
              TI+ +AHRL TI   + ++V+   G V E     +LY    S    + ++
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGSIFRSMCDQ 1526

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 111/230 (48%), Gaps = 15/230 (6%)

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI 507
           F+D S  +    +    KN++      S   I+GP+G GKS++ L LL   N  +G I +
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 508 ------DDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561
                 DD +I K     +   +    Q P L+SGTI+DN+ +G  +   K++   V K 
Sbjct: 713 PTVESRDDLEIGK---DGMTNSMAYCSQTPWLISGTIKDNVVFGEIFN--KQKFDDVMKS 767

Query: 562 CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
           C     I        T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA+D E+ 
Sbjct: 768 CCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETA 827

Query: 622 GAI--NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
             I      G +MK ++  I S  H +S + +  + +V+   G V   GK
Sbjct: 828 LYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGK 875

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 111/232 (47%), Gaps = 31/232 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPSTGTIMIDDQDITKMNCKSLRRH 523
           L F    GSS+ I+GP+G GKS+I  ++      YN + G + I  ++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTY 738

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
              I     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F +L+K  
Sbjct: 739 LDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
               ISI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 19/187 (10%)

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQE 530
           + PGSS+ I+GP+  GKS+I  +L   +     T ++     + + C        I Q+ 
Sbjct: 595 LGPGSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAESDLMC--------IAQRP 646

Query: 531 PVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPN-TYDTVIGSRG 583
             +  GT RD I Y ++     E      E+  + K+      + +    +Y   +    
Sbjct: 647 YFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWK 706

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIA 643
            +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +    ISI+
Sbjct: 707 DILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISIS 762

Query: 644 HRLSTIR 650
            R S I+
Sbjct: 763 QRPSLIK 769

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 103/205 (50%), Gaps = 12/205 (5%)

Query: 463 IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMI---DDQDITKMNCKS 519
           I +NLN K        + GP+G GKS + + LL   +   G I +     +    ++   
Sbjct: 708 ILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHELMIHGDG 767

Query: 520 LRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVI 579
           L   I    Q P +++ +I++NI +G  +   +     V + C   N +    +  ++++
Sbjct: 768 LTNSISYCSQIPWIINDSIKNNILFGSEFNLKRYN--DVIRACCLTNDLRLLQDGDNSIV 825

Query: 580 GSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF---GHLMKSKS 636
           G RG  LSGGQ+QR+++ARA+  K   +ILD+  SA+D +    I Y     G LMK + 
Sbjct: 826 GDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGR- 883

Query: 637 MTIISIAHRLS-TIRRSENVIVLGH 660
            T I ++H +   I+++  +++L +
Sbjct: 884 -TCILVSHNVELVIKKAAYLLILDN 907

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 111/232 (47%), Gaps = 31/232 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPSTGTIMIDDQDITKMNCKSLRRH 523
           L F    GSS+ I+GP+G GKS+I  ++      YN + G + I  ++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPPEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTY 738

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F +L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
               ISI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 102/206 (49%), Gaps = 27/206 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPSTGTIMIDDQDITKMNCKSLRRH 523
           L F    GSS+ I+GP+G GKS+I  ++      YN + G + I  ++           +
Sbjct: 631 LPFLQGSGSSLLILGPNGCGKSSIQRIIADVWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ +A+    +        TY
Sbjct: 679 IFCIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTY 738

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F +L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHD 661
               ISI+ R + I+  E ++ +G +
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGEN 820

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 123/253 (48%), Gaps = 35/253 (13%)

Query: 442 HRGVVEFKDVSFSYPT----RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL-- 495
           H   + F+++S++ P+         I KN++  + PG  + I+G SG GK+T+  +L   
Sbjct: 429 HVAALSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFK 488

Query: 496 RYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITY 544
           R     +G I I+ +++++   + + + IG V Q           E VL S  +R  +  
Sbjct: 489 RKSGHVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPN 543

Query: 545 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARALI 601
            +T+   ++ +  V ++        +  N  D +IG    RG  +SGG+K+R++IA  L+
Sbjct: 544 SMTFYQKQQRVFQVLEE-------LRIYNIKDRLIGDDFERG--ISGGEKRRVSIACELV 594

Query: 602 KKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR-LSTIRRSENVIVLGH 660
             P IL LDE TS LD  +   +      L K+ + T++   H+  S I    + +VL  
Sbjct: 595 TSPLILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLS 654

Query: 661 DGSVVEMGKFKKL 673
            G +V  G+ +++
Sbjct: 655 SGEMVYSGEIRRV 667

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 103/237 (43%), Gaps = 48/237 (20%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y       + K++N  +   S + +VG +G GK+T+  +++    P+ G 
Sbjct: 531 IIQLQDVSFGYEENSP--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGY 588

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGSRG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G+ G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVE 666
            LD     A+     N+T G LM S  +++I   H  S I  SE+  V   DG++ +
Sbjct: 680 HLDTAGLDALIDALKNFTGGVLMVSHDISVID--HVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 110/232 (47%), Gaps = 31/232 (13%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLR---YYNPSTGTIMIDDQDITKMNCKSLRRH 523
           L F    GSS+ I+GP+  GKS+I  ++      YN + G + I  ++           +
Sbjct: 631 LPFLQGSGSSLLILGPNSCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------N 678

Query: 524 IGIVQQEPVL-MSGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTY 575
           I  + Q+P     GT+RD I Y ++           KE ++ + +    +        TY
Sbjct: 679 IFCIPQKPYFSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTY 738

Query: 576 DTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
              +     LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F +L+K  
Sbjct: 739 LDAVADWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLF-NLLKRY 794

Query: 636 SMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNE 687
               ISI+ R + I+  E ++ +G +      GK++        A++ + NE
Sbjct: 795 RFNFISISQRPTLIKYHEMLLEIGENRD----GKWQLQAVGTDEAITSIDNE 842

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 91/191 (47%), Gaps = 21/191 (10%)

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIV 527
           N  + PGSS+ I+GP+  GKS+I  ++   +     T ++     + M C        I 
Sbjct: 592 NVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLLSIPSESDMMC--------IA 643

Query: 528 QQEPVLMSGTIRDNITYGLTYTPTKE------EIRSVAKQCFCHNFITKFPN--TYDTVI 579
           Q+   +  GT RD I Y +      E      E+  V K+    +++ K  +   Y   +
Sbjct: 644 QRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRADALNYLDHV 702

Query: 580 GSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTI 639
                +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  L K +    
Sbjct: 703 ADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR-FNF 758

Query: 640 ISIAHRLSTIR 650
           ISI+ R S I+
Sbjct: 759 ISISQRPSLIK 769

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 100/209 (47%), Gaps = 24/209 (11%)

Query: 466 NLNFKIA---PGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRR 522
           N+N K+A   PGSS+ I+GP+G GK++I  ++   +       ++     + + C     
Sbjct: 589 NINKKLAFQGPGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC----- 643

Query: 523 HIGIVQQEPVLMSG-TIRDNITYGLTYTPT------KEEIRSVAKQCFCHNFITKFPNT- 574
               V Q+P  + G T R+ I Y ++           +E+  +  +      + +     
Sbjct: 644 ----VPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGWR 699

Query: 575 YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS 634
           Y   +     +LSGG++QRI  AR +  KP  ++LDEAT+A+  + E   +Y FG L+K 
Sbjct: 700 YLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKR 755

Query: 635 KSMTIISIAHRLSTIRRSENVIVLGHDGS 663
                I+I+ R S I+  +  + +  DG+
Sbjct: 756 YRFNFITISQRPSLIKYHDLALDISTDGT 784

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 109/223 (48%), Gaps = 21/223 (9%)

Query: 455 YPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI---------ALLLLRYYNPSTGTI 505
           +  + + QI +++N    PG    I+GPSG GKS++         + LL++++  STG+I
Sbjct: 679 WLQKKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFH--STGSI 736

Query: 506 MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLT---YTPTKEEIRSVAKQC 562
           +++   I+K   KS+  ++     + +L S T+R+   +      +  T ++ RS   + 
Sbjct: 737 LLNTNSISKEMFKSVCSYVS-QDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEI 795

Query: 563 FCHNFITKFPNTYDTVIGSRGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                +T   NT   VIG+     +SGG+K+R+ I   L+    IL+LDE TS LD  + 
Sbjct: 796 LLALGLTHCENT---VIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTSGLDSFTS 852

Query: 622 GAINYTFGHLMKSKSMTIISIAH--RLSTIRRSENVIVLGHDG 662
            AI     +L      T+I   H  R    ++  +V++L   G
Sbjct: 853 AAILEILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSG 895

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 4/97 (4%)

Query: 576 DTVIG-SRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKS 634
           +T++G +R   LSGG+K+R+++A  L+  P+ + LDE T+ LD  S   +  +   L + 
Sbjct: 153 NTLVGDARNRGLSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKLARD 212

Query: 635 KSMTIISIAH--RLSTIRRSENVIVLGHDGSVVEMGK 669
              + I   H  R   +   ++V +L   G+VV  GK
Sbjct: 213 GQKSFIMSVHQPRSDIMFLLDSVCILSK-GNVVYCGK 248

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 101/210 (48%), Gaps = 20/210 (9%)

Query: 461 VQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSL 520
           + + + L FK  PGSS+ I+GP+G GK++I  ++   +       +        ++  + 
Sbjct: 589 INLSQKLMFK-GPGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGL--------LSVPAE 639

Query: 521 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPT------KEEIRSVAKQCFCHNFITKFPNT 574
           R  I I Q+   +  GT R+ I Y ++           +E+  V K+      + +    
Sbjct: 640 RELICIPQKPYFIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGW 699

Query: 575 -YDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMK 633
            Y   +     +LSGG++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F +++K
Sbjct: 700 RYLDAVAEWKDVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLF-NMLK 755

Query: 634 SKSMTIISIAHRLSTIRRSENVIVLGHDGS 663
                 I+I+ R S I+  +  + +G D S
Sbjct: 756 RYRFNFITISQRPSLIKYHDLALEIGADES 785

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 120/239 (50%), Gaps = 21/239 (8%)

Query: 443  RGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYN-- 499
            +GV  +KDV +  P + S + +   ++  + PG +  ++G SG GK+T+  +L +  +  
Sbjct: 799  KGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLT-ALMGASGAGKTTLLNVLAQRMDFG 857

Query: 500  -PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTK 552
              S+G I++D + + +      +R +G VQQ+ +     T+R+++ +          P  
Sbjct: 858  IVSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDA 913

Query: 553  EEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-LDE 611
            E++  V K       +    +  D V+G  G  L+  Q+++++I   L+ KPT+L+ LDE
Sbjct: 914  EKMEYVEKIIV----VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDE 969

Query: 612  ATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRS-ENVIVLGHDGSVVEMGK 669
             TS LD +S  AI      L ++    + +I    +T+  S + +++L   GSVV  G 
Sbjct: 970  PTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGN 1028

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 92/208 (44%), Gaps = 38/208 (18%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y   P   + K++N  +   S + +VG +G GK+T+  +++    P+ G 
Sbjct: 534 IIQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGF 591

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTK--EEIRSVAKQC 562
           +            ++ R  IG   Q  V      +  + +  T  P K  EE R      
Sbjct: 592 V-----------SRNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYR------ 634

Query: 563 FCHNFITKFPNTYDTVIGSRG----TLLSGGQKQRIAIARALIKKPTILILDE-----AT 613
                +  F      + GS G     LLSGGQK R+A A   +  P IL+LDE      T
Sbjct: 635 ---RHLGSFG-----ITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDT 686

Query: 614 SALDVESEGAINYTFGHLMKSKSMTIIS 641
           S LD   +   N++ G LM S  ++II 
Sbjct: 687 SGLDALEDSLKNFSGGVLMVSHDISIID 714

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T+++++H 
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSHD 426

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 427 RAFLNEVATDIIYQHN 442

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 117/245 (47%), Gaps = 32/245 (13%)

Query: 442 HRGVVEFKDVSFSYPT-RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYY 498
           +   + F++++++  + +    I K ++  I PG  + ++G SG GK+T+   L + R  
Sbjct: 373 NAAALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKT 432

Query: 499 NPSTGTIMIDDQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLT 547
              TG+I ++  DI +   K   + IG V Q           E VL S  +R  +    +
Sbjct: 433 GQVTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLR--LPRSFS 487

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKP 604
           +   +  +  V ++        +  +  D VIG+   RG  +SGG+K+R++IA  L+  P
Sbjct: 488 FAAKQTRVYQVLEE-------LRILDIKDRVIGNDFERG--ISGGEKRRVSIACELVTSP 538

Query: 605 TILILDEATSALDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVLGHDGS 663
            IL LDE TS LD  +   +      L K+ + T ++SI    S I +  + +VL  +G 
Sbjct: 539 LILFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGE 598

Query: 664 VVEMG 668
           +V  G
Sbjct: 599 MVYSG 603

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 93/212 (43%), Gaps = 46/212 (21%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y   P   + K++N  I   S + +VG +G GK+T+  ++L    P +G 
Sbjct: 531 IIQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGY 588

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGSRG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +GS G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGHLMKSKSMTIIS 641
            LD     A+     N+T G LM S  +++I+
Sbjct: 680 HLDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +KS   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR011C (ADP1) and
           YOL075C
          Length = 1011

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 129/268 (48%), Gaps = 43/268 (16%)

Query: 448 FKDVSFS-YPTRPS-VQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS---T 502
           F+++ +  +P+R S V+I  +++  ++PG  + ++G SG GK T  L +L   N +   +
Sbjct: 366 FENLCYKVFPSRSSPVRILNSISGYVSPGEILAVMGGSGAGK-TCLLDILGMKNKAGEVS 424

Query: 503 GTIMIDDQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTYTPT 551
           GT+ I+   ITK    ++ + +G V Q           E VL S  +R  +   +++   
Sbjct: 425 GTVKINGVPITK---HTVSKVVGFVDQDNHLLPTLTVYETVLNSALLR--LPRSMSFAAK 479

Query: 552 KEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKPTILI 608
           ++ +  V ++        +  +  D +IG+   RG  +SGG+K+R++IA  L+  P IL 
Sbjct: 480 QKRVYQVLEE-------LRIFDIRDRLIGNDFERG--ISGGEKRRVSIACELVTSPLILF 530

Query: 609 LDEATSALDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVLGHDGSVVEM 667
           LDE TS LD  +   +      L      T ++SI    S I R  + +VL ++G +V  
Sbjct: 531 LDEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLLNEGEMV-- 588

Query: 668 GKFKKLYANPTSALSQLLNERAAPGPSD 695
                 Y+ P + ++  L       PSD
Sbjct: 589 ------YSGPITRVNDFLRNTGFNCPSD 610

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 103/242 (42%), Gaps = 54/242 (22%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           V+ F ++SF+Y   P   +++NLNF +   S + +VGP+G GKST+  ++     P  G 
Sbjct: 392 VLAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGR 451

Query: 505 I--------------MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
            K ++                           GT LS GQ+ R+  A   ++ P IL+LD
Sbjct: 509 QKAQM---------------------------GT-LSEGQRSRVVFALLALQAPNILLLD 540

Query: 611 EATSALDVES----EGAIN-YTFGHLMKSKSMTIIS-IAHRLSTIRRSENVIVLGHDGSV 664
           E T+ LD+ +      AIN +  G ++ S    ++  IA  +  +   EN      DGS+
Sbjct: 541 EPTNGLDIPTIDSLAEAINTFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTAYRWDGSI 597

Query: 665 VE 666
           +E
Sbjct: 598 LE 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 114/244 (46%), Gaps = 35/244 (14%)

Query: 446 VEFKDVSFSYP----TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 499
           + F+++S+  P    ++   ++  ++   + PG  + I+G SG GK+T+   L + R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 500 PSTGTIMIDDQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTY 548
              GTI ++   I     K   + IG V Q           E VL S  +R  +   + +
Sbjct: 456 RVQGTIAVNGHSILN---KLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 549 TPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKPT 605
           T  ++ +  V ++        +  +  D +IG+   RG  +SGG+K+R++IA  L+  P 
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERG--ISGGEKRRVSIACELVTSPA 561

Query: 606 ILILDEATSALDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVLGHDGSV 664
           IL LDE TS LD  +   +      L K+ + T ++SI    S I    + +VL  DG +
Sbjct: 562 ILFLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEM 621

Query: 665 VEMG 668
           +  G
Sbjct: 622 IYSG 625

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 81/188 (43%), Gaps = 45/188 (23%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           V+ F D+SF Y + PS  +++NLNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +                D  D+TK   + +R     V Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQYWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 32/44 (72%)

Query: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           T I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 104/241 (43%), Gaps = 48/241 (19%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y    S  + K++N  +   S + +VG +G GK+T+  +++    P TG 
Sbjct: 532 IIQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGH 589

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R  IG   Q  +       D++           ++ + A     
Sbjct: 590 V-----------SRNPRLRIGYFTQHHI-------DSM-----------DLNASAVDWMS 620

Query: 565 HNFITKFPNTYDTVIGSRG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G+ G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 621 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSN 680

Query: 615 ALDVESEGAI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            LD     A+     N++ G LM S  +++I        I  SE+  V   DG++ +  K
Sbjct: 681 HLDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKK 738

Query: 670 F 670
           +
Sbjct: 739 Y 739

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 646 LSTIRRSENVIVLGHD 661
            S +      I+  H+
Sbjct: 425 RSFLNEVATDIIYQHN 440

>SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa]
           {ON} highly similar to gnl|GLV|KLLA0D04554g
           Kluyveromyces lactis KLLA0D04554g and similar to YCR011C
           uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1027

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 130/277 (46%), Gaps = 44/277 (15%)

Query: 440 KPH-RGVVEFKDVSFSYPTR--PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496
           KP  +  + F+++++   +    S Q+  +++  + PG  + I+G SG GK+T+ L +L 
Sbjct: 363 KPDVKATLTFENINYQVRSSKGSSTQVLNSISGSVKPGEILAIMGGSGAGKTTL-LDILA 421

Query: 497 YYNPS---TGTIMIDDQDITKMNCKSLRRHIGIVQQEP-----------VLMSGTIRDNI 542
             N +   TG+I ++  ++TK N     + +G V QE            VL S  +R  +
Sbjct: 422 MKNKTGKVTGSIRLNGTEVTKQN---YSKIVGFVDQEDFLLPTLTVYETVLNSALLR--L 476

Query: 543 TYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARA 599
              +++   ++ +  V ++        +     + VIG+   RG  +SGG+K+R++IA  
Sbjct: 477 PRSMSFAAKQKRVYQVLEE-------LRIFEIRNRVIGNDLERG--ISGGEKRRVSIACE 527

Query: 600 LIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVL 658
           L+  P IL LDE TS LD  +   +      L    + T I+SI    S I +  + +VL
Sbjct: 528 LVTSPLILFLDEPTSGLDSNNANNVIECLVRLANHYNRTLILSIHQPRSNIFKLFDKLVL 587

Query: 659 GHDGSVVEMGKFKKLYANPTSALSQLLNERAAPGPSD 695
             +G +V        Y+     +S+ L  +    PSD
Sbjct: 588 LSEGELV--------YSGEAVRVSEFLRNQGFTCPSD 616

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 112/237 (47%), Gaps = 21/237 (8%)

Query: 445  VVEFKDVSFSYP-TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS-- 501
            VV ++D+ +     R S +I  N++  + PG+   ++G SG GK+T+   L         
Sbjct: 852  VVHWRDLCYEVRIKRESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVI 911

Query: 502  TGTIMIDDQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEI 555
            TG I +D     K+  +S  R IG  QQ+ + L + T+R+++ +          P  E+ 
Sbjct: 912  TGGIFVDG----KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKR 967

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
            + V +     N +   P   D ++G  G  L+  Q++R+ I   L+ KP +LI LDE TS
Sbjct: 968  KYVEEVI---NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTS 1023

Query: 615  ALDVESEGAINYTFGHLMKSKSMTIISIAHRLST--IRRSENVIVLGHDGSVVEMGK 669
             LD ++  +I      L  ++   I+   H+ S   I+  + ++ L   G  V  G+
Sbjct: 1024 GLDSQTAWSICQLIRKL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/285 (22%), Positives = 116/285 (40%), Gaps = 60/285 (21%)

Query: 363 DLSFLTVLAYG----SYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAG 416
           D+    + AYG    SY+  +S+L    +  +    E   +       +  Y+ +++ A 
Sbjct: 294 DMRLQKLTAYGGNYDSYVKTRSELETNQMKQYHKQQEEIAHIKKFIASAGTYANLVKQAK 353

Query: 417 AASRLFELTDRKPSISPTAGHKYKPHR---------GVVEFKDVSFSYPTRPSVQIFKNL 467
           +  ++ +  +    + P    +    R          V+ F ++SFSY  +P   +++NL
Sbjct: 354 SRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPPVLAFDEISFSYDEKPENNLYENL 413

Query: 468 NFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTI--------------MIDDQDIT 513
           NF +   S V +VGP+G GKST+  ++     P  G +                D  D+T
Sbjct: 414 NFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQHSQDQLDLT 473

Query: 514 KMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPN 573
           K   + +R   G + ++     G +     YGLT      E ++V               
Sbjct: 474 KSALEFVRDKYGHISEDFQYWRGQLG---RYGLT-----GEGQTV--------------- 510

Query: 574 TYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                    GT LS GQ+ R+  A   + +P +L+LDE T+ LD+
Sbjct: 511 -------QMGT-LSEGQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 31/42 (73%)

Query: 579 IGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 219 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 260

>KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1020

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 121/264 (45%), Gaps = 26/264 (9%)

Query: 443 RGVVEFKDVSFSYPT-RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 499
           R  + F+D+S+S  + +  + +   ++  + PG  + ++G SG GK+T+   L +     
Sbjct: 364 RSTLTFEDISYSITSNKKEINLLNGISGSVRPGEIMALMGGSGAGKTTLLDILAMKEKAG 423

Query: 500 PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLM-SGTIRDNI-TYGLTYTPTKEEIRS 557
             +G I ++ + +TK N   L   IG V QE  L+ + T+ + +    L   P K  +  
Sbjct: 424 KVSGLIKVNGKGVTKQN---LAEIIGFVDQEDFLLPTLTVYETVLNSALLRLPRK--MSF 478

Query: 558 VAKQCFCHNFITKFPNTYDTVIG-----SRGTLLSGGQKQRIAIARALIKKPTILILDEA 612
            AKQ   +  + +                RG  +SGG+K+R++IA  L+  P+IL LDE 
Sbjct: 479 TAKQKRVYQVLEELRIIDIKDRIIGDDFDRG--ISGGEKRRVSIACELVTSPSILFLDEP 536

Query: 613 TSALDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
           TS LD  +   +      L    + T ++SI    S I +S + +VL   G +V      
Sbjct: 537 TSGLDSNNANNVIECLVRLALHYNRTLVLSIHQPRSNIFKSFDKLVLLSQGEMV------ 590

Query: 672 KLYANPTSALSQLLNERAAPGPSD 695
             ++   + +S+ L       PSD
Sbjct: 591 --FSGAATDVSEFLRNNNYNCPSD 612

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 98/208 (47%), Gaps = 33/208 (15%)

Query: 460 SVQIFKNLN------FKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPSTGTIMIDDQ 510
           S Q FK +N      F    GSS+ I+GP+  GK++I  ++      YN + G + +  Q
Sbjct: 645 STQDFKQINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIWPIYNKN-GLLSVPSQ 703

Query: 511 DITKMNCKSLRRHIGIVQQEPVLMS-GTIRDNITYGLTYTPTKEE------IRSVAKQCF 563
           +           +I  + Q P   S GT+RD I Y ++     +       +  + K+  
Sbjct: 704 E-----------NIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVN 752

Query: 564 CHNFITKFPN-TYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
               + +    TY   +     LLSGG+KQRI  AR L  KP  ++LDEAT+A+  + E 
Sbjct: 753 LKYLMKRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME- 811

Query: 623 AINYTFGHLMKSKSMTIISIAHRLSTIR 650
             +Y F +++K      I+I+ R S I+
Sbjct: 812 --DYLF-NILKKYRFNFITISQRPSLIK 836

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 114/246 (46%), Gaps = 33/246 (13%)

Query: 443 RGVVEFKDVSFSYPTR--PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYY 498
             V+ FKD+ +  P     S  +   ++  + PG  + ++G SG GK+T+   L + +  
Sbjct: 393 EAVLTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKA 452

Query: 499 NPSTGTIMIDDQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLT 547
              +G I ++ + I+K   K   + IG V Q           E VL S  +R  +   L 
Sbjct: 453 GKVSGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALP 507

Query: 548 YTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKP 604
           +   +  +  V ++        +  +  D +IG+   RG  +SGG+K+R++IA  L+  P
Sbjct: 508 FEAKRSRVYKVLEE-------LRILDIKDKIIGNEFERG--ISGGEKRRVSIACELVTSP 558

Query: 605 TILILDEATSALDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVLGHDGS 663
            IL LDE TS LD  +   +      L ++   T ++SI    S I +  + +VL  +G 
Sbjct: 559 LILFLDEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGE 618

Query: 664 VVEMGK 669
           +V  G+
Sbjct: 619 MVYSGE 624

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 113/239 (47%), Gaps = 18/239 (7%)

Query: 444  GVVEFKDVSFSYPTRPSV-QIFKNLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPS 501
            GV  +K+V+F+ P + S  ++  N++   APGS   ++G SG GK+T +  L  R     
Sbjct: 843  GVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGII 902

Query: 502  TGTIMIDDQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKEEI 555
            TG ++++ + I      S  R  G VQQ+ V +   T+R++  +          P  E++
Sbjct: 903  TGDMLVNGKPID----ASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKL 958

Query: 556  RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-LDEATS 614
              V K       I    +  + +IG  G  L+  Q+++++I   L  KP +L+ LDE TS
Sbjct: 959  AYVEKII----EILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTS 1014

Query: 615  ALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKK 672
             LD +S  AI      L ++    + +I    +T+    + +++L   G  V  G   K
Sbjct: 1015 GLDSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFGPIGK 1073

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 103/248 (41%), Gaps = 32/248 (12%)

Query: 443 RGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL---RYYN 499
           RGV E K+       R +  I +N +    PG  V ++G  G G S+    +    R + 
Sbjct: 153 RGVREVKN-------RGNRDIVRNASLLARPGDMVLVLGRPGAGCSSFLKTIAGETRNFE 205

Query: 500 PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
              G+I  D     +M  K     I   + +      T++  + + L+ T  +  +   +
Sbjct: 206 EVRGSISYDGIPQEEMMKKYKTDVIYNGEMDVHFPHLTVQQTLDFALSCTTPRVRLDGAS 265

Query: 560 KQCFCHNFITKFPNTYDTVIGSRGTL-----------LSGGQKQRIAIARALIKKPTILI 608
           +      +IT     Y T+ G R T            +SGG+++R++IA AL  + +I  
Sbjct: 266 RS----EYITAMRELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYC 321

Query: 609 LDEATSALD----VESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSV 664
            D AT  LD    +E   AI  T  +L   KS+ +++I      I    + + + +DG  
Sbjct: 322 WDNATRGLDASTALEFAQAIR-TMTNL--QKSIALVTIYQASENIYECFDKVTVLYDGRQ 378

Query: 665 VEMGKFKK 672
           +  G  ++
Sbjct: 379 IFFGAIEQ 386

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 98/209 (46%), Gaps = 33/209 (15%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLRY---YNPSTGTIMIDDQDITKMNCKSLRRH 523
           L F   PGSS+ I+GP+  GKS+I  ++      YN + G + I  +D  ++ C      
Sbjct: 676 LPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED--ELMC------ 726

Query: 524 IGIVQQEPVL-MSGTIRDNITY----------GLTYTPTKEEIRSVAKQCFCHNFITKFP 572
              + Q P     GT RD I Y          GL      + +  V  +        K  
Sbjct: 727 ---IPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKR--DKGW 781

Query: 573 NTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLM 632
           + +D V   +  +LSGG+KQR+  AR L  KP  +ILDEAT+A+ V+ E   +Y F  ++
Sbjct: 782 SYFDAVFDWKD-VLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KML 836

Query: 633 KSKSMTIISIAHRLSTIRRSENVIVLGHD 661
           K      ISI+ R S ++  + ++ +  D
Sbjct: 837 KKYRFNFISISQRPSLVKYHDLLLEISED 865

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 104/242 (42%), Gaps = 54/242 (22%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           V+ F D+SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDVES----EGAIN-YTFGHLMKSKSMTIIS-IAHRLSTIRRSENVIVLGHDGSV 664
           E T+ LD+ +      AIN +  G ++ S    ++  IA  +  +   EN      DGS+
Sbjct: 541 EPTNGLDIPTIDSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTATRWDGSI 597

Query: 665 VE 666
           ++
Sbjct: 598 LQ 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 111/236 (47%), Gaps = 36/236 (15%)

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS------ 501
           +K+ +F + T+   +I +++N    PG    I+GPSG GKS++  L+      S      
Sbjct: 697 WKEGNFHHETK---EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFD 753

Query: 502 -TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYG-------LTYTPTKE 553
            +G+IM +D  ++++  K++  ++     + +L + T+++ + Y        LT     E
Sbjct: 754 TSGSIMFNDIQVSELMFKNVCSYVS-QDDDHLLAALTVKETLKYAAALRLHHLTEAERME 812

Query: 554 E----IRSVAKQCFCHNFITKFPNTYDTVIGSRGTL-LSGGQKQRIAIARALIKKPTILI 608
                IRS+  +  C N           +IG+     +SGG+K+R+ +   L+  P IL+
Sbjct: 813 RTDNLIRSLGLK-HCEN----------NIIGNEFVKGISGGEKRRVTMGVQLLNDPPILL 861

Query: 609 LDEATSALDVESEGAINYTFGHLMKSKSMTIISIAH--RLSTIRRSENVIVLGHDG 662
           LDE TS LD  +   I      L + +  TII   H  R    +R  NV++L   G
Sbjct: 862 LDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSG 917

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 92/219 (42%), Gaps = 41/219 (18%)

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL-------------LRYYNPSTG 503
           ++ +  +    +  +  GS + ++G SG GK+T+  +L             +RY    TG
Sbjct: 38  SKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTG 97

Query: 504 T---------IMIDDQDITKMNCKSLRRHIGIV---QQEPVLMSGTIRDNITYGLTYTPT 551
           +           +D QD        +++H+ +    QQ+ +    T R+ + +       
Sbjct: 98  SEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLN 151

Query: 552 KEEIRSVAKQCFCHNFITKF--PNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKPTI 606
             E     K+      I +    +  DT++G    RG  LSGG+K+R++I   +I  P+I
Sbjct: 152 SSE---RTKKLMVEQLIEELGLKDCADTLVGDNSHRG--LSGGEKRRLSIGTQMISNPSI 206

Query: 607 LILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
           + LDE T+ LD  S   +  T   L K    T I   H+
Sbjct: 207 MFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 245

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 94/208 (45%), Gaps = 29/208 (13%)

Query: 474 GSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVL 533
           GSS+ I+GP+  GKS+I  +L   +       ++       + C         V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPIYNKNGLLSTPPSHDLFC---------VPQRPYF 665

Query: 534 MSG-TIRDNITYGLTYTPTKEE----------IRSVAKQCFCHNFITKFPNTYDTVIGSR 582
           + G T RD I Y +TY    E           +R V           +  N +D  I   
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRLDYLLKR--DRGLNYFDA-IADW 722

Query: 583 GTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISI 642
             +LSGG+KQR+   R +  +P  ++LDEAT+A+ V+ E  + +T   ++K      ISI
Sbjct: 723 KDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT---MLKRYRFNFISI 778

Query: 643 AHRLSTIRRSENVIVL--GHDGSVVEMG 668
           + R S I+  + ++ L  G D S+  +G
Sbjct: 779 SQRPSLIKYHDYLLELTNGTDWSLQALG 806

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 127/264 (48%), Gaps = 26/264 (9%)

Query: 443 RGVVEFKDVSFSYPTRPSVQIFKN-LNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYN 499
           +  + F+++ ++  +    ++  N ++  + PG  + ++G SG GK+T+   L +     
Sbjct: 363 KSTLTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAG 422

Query: 500 PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLM-SGTIRDNI-TYGLTYTPTKEEIRS 557
            ++G+I I+  +ITK N   L +  G V QE  L+ + T+ + +    L   P K  +  
Sbjct: 423 KASGSIKINGSEITKQN---LSKIAGFVDQENFLLPTLTVYETVLNSALLRLPRK--LSF 477

Query: 558 VAKQCFCHNFITKFP--NTYDTVIG---SRGTLLSGGQKQRIAIARALIKKPTILILDEA 612
           V KQ   +  + +    +  D +IG    RG  +SGG+K+R++IA  L+  P++L LDE 
Sbjct: 478 VQKQKRVYQVLEELRILDIKDRIIGDDLERG--ISGGEKRRVSIACELVTSPSVLFLDEP 535

Query: 613 TSALDVESEGAINYTFGHLMKSKSMT-IISIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
           TS LD  +   +      L    + T I+SI    S I +S + +VL   G +V      
Sbjct: 536 TSGLDSNNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMV------ 589

Query: 672 KLYANPTSALSQLLNERAAPGPSD 695
             ++   + +S+ L       PSD
Sbjct: 590 --FSGVATDVSEFLRNNGYNCPSD 611

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/272 (22%), Positives = 109/272 (40%), Gaps = 56/272 (20%)

Query: 372 YGSYLVLQSQLSIGDLTAFMLYTEYTGN--AVFGLSTFYSEIMQGAGAASRLFELTDRKP 429
           Y SY   +S+L    +  +    E   +       +  Y+ +++ A +  ++ +  +   
Sbjct: 308 YDSYHKTRSELETNQMKQYSKQQEEIQHIKKFIASAGTYANLVKQAKSRQKILDKMEADG 367

Query: 430 SISPTAGHKYKPHR---------GVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480
            I P A  K    R          V+ F D+SF Y + PS  ++++LNF +   S + +V
Sbjct: 368 LIQPVAPDKIFSFRFPQVERLPPPVLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALV 427

Query: 481 GPSGRGKSTIALLLLRYYNPSTGTI--------------MIDDQDITKMNCKSLRRHIGI 526
           GP+G GKST+  ++     P +G +                D  D+TK   + +R     
Sbjct: 428 GPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSN 487

Query: 527 VQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLL 586
           + Q+     G +     YGLT      ++ +                            L
Sbjct: 488 ISQDFQFWRGQLG---RYGLTGEGQTVQMAT----------------------------L 516

Query: 587 SGGQKQRIAIARALIKKPTILILDEATSALDV 618
           S GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 517 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 45/188 (23%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           V+ F D+SF Y + PS  ++++LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 392 VLAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGR 451

Query: 505 I--------------MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLG---RYGLTGEG 508

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
              ++ +                            LS GQ+ R+  A   +++P +L+LD
Sbjct: 509 QTVQMAT----------------------------LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDV 618
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 29/35 (82%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 107/236 (45%), Gaps = 33/236 (13%)

Query: 448 FKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL-------LRYYNP 500
           FK+   S     + +I +++N    PG    I+GPSG GKS++  L+       L     
Sbjct: 702 FKNWKESKLHHETKEILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKFD 761

Query: 501 STGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTY-----------T 549
           ++GTIM +D  ++++  K++  ++     + +L + T+++ + Y                
Sbjct: 762 TSGTIMFNDIQVSELMFKNVCSYVS-QDDDHLLATLTVKETLKYAAALRLHHLNEAERTE 820

Query: 550 PTKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTL-LSGGQKQRIAIARALIKKPTILI 608
            T   IRS+  +  C N           +IG+     +SGG+K+R+ +   L+  P IL+
Sbjct: 821 RTDNLIRSLGLK-HCEN----------NIIGNEFVKGISGGEKRRVTMGVQLLSDPPILL 869

Query: 609 LDEATSALDVESEGAINYTFGHLMKSKSMTIISIAH--RLSTIRRSENVIVLGHDG 662
           LDE TS LD  +   I     +L K    T+I   H  R    +R  NV++L   G
Sbjct: 870 LDEPTSGLDSFTSATILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSG 925

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 94/220 (42%), Gaps = 36/220 (16%)

Query: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL-------------LRYY----N 499
           ++ +  +  + +  +  GS + ++G SG GK+T+  +L             +RY      
Sbjct: 38  SKTNTTLVNSFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLRHEGSIRYVLEDSE 97

Query: 500 PSTGTIMIDDQDITKMNCK------SLRRHIGIV---QQEPVLMSGTIRDNITYGLTYTP 550
           P +G    +  D+   N +        ++H+ +    QQ+ +    T R+ + +      
Sbjct: 98  PGSGYGSEESVDVKAKNSRLDGEDHHTQKHVIMAYLPQQDVLSPRLTCRETLNFA---AD 154

Query: 551 TKEEIRSVAKQCFCHNFITKFP--NTYDTVIGS---RGTLLSGGQKQRIAIARALIKKPT 605
            K    S  K+      I +    +  DT++G    RG  LSGG+K+R++I   +I  P+
Sbjct: 155 LKLNSSSRTKKLMVEQLIEELGLRDCADTLVGDNSHRG--LSGGEKRRLSIGTQMISNPS 212

Query: 606 ILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
           I+ LDE T+ LD  S   +  T   L K    T I   H+
Sbjct: 213 IMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 252

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 102/239 (42%), Gaps = 55/239 (23%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y  +    + K++N  +   S + +VG +G GK+T+  +++    P++G 
Sbjct: 531 IIQLQDVSFGYEEQSL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGY 588

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNGRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGSRG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             +  K    Y   +G+ G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 KTYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LD     A+      +T G LM         ++H +S I    N I +  DG+V + G
Sbjct: 680 HLDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 113/240 (47%), Gaps = 18/240 (7%)

Query: 443  RGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 500
            +GV  +KDV F+ P   S + +  N++    PG+   ++G SG GK+T +  L  R    
Sbjct: 850  KGVFIWKDVCFTIPYEGSTRMLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGI 909

Query: 501  STGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSG-TIRDNITYGLTY-----TPTKEE 554
             TG ++++ + I      S  R  G VQQ+ + ++  T+R+++ +          P  E+
Sbjct: 910  ITGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQRLPDSEK 965

Query: 555  IRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-LDEAT 613
            +  V K       +       + ++G  G  L+  Q+++++I   L+ KP +L+ LDE T
Sbjct: 966  MEYVEKII----RVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPT 1021

Query: 614  SALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKK 672
            S LD +S  AI      L K+    + +I    +T+    + +++L   G  V  G   K
Sbjct: 1022 SGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFGDIGK 1081

>TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1011

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 123/275 (44%), Gaps = 47/275 (17%)

Query: 458 RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLL---RYYNPSTGTIMIDDQDITK 514
           + +V+I +N++    PG  + I+G SG GK+T+  +L    +     +G I I+ + + K
Sbjct: 409 KSNVKILQNVSGVAKPGEIMAIMGGSGAGKTTLLDILAMKDKTDGDVSGAIKINGKQLEK 468

Query: 515 MNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCF 563
                 R+ IG V Q           E VL S  +R  +   +++   +  +  V  +  
Sbjct: 469 ---SYFRKLIGFVDQYDYLFPTLSVYETVLNSALLR--LPSSMSFAAKQLRVLQVLDE-- 521

Query: 564 CHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                 +     D +IG+   RG  +SGG+K+R++IA  L+  P+ILILDE TS LD  +
Sbjct: 522 -----LRILEIKDRLIGNDYQRG--ISGGEKRRVSIACELVTSPSILILDEPTSGLDSNN 574

Query: 621 EGAINYTFGHLMKSKSMTII-SIAHRLSTIRRSENVIVL---------GHDGSVVEMGKF 670
              +      L ++ + TII SI    S I  S N ++L         G   +V +  + 
Sbjct: 575 ANNVINCLVRLAQNHNRTIIVSIHQPRSNIFYSFNKLILLSNSRLIYSGEASNVTKFLEA 634

Query: 671 KKLYANPTSALSQLL------NERAAPGPSDQQQQ 699
            KLY  P   ++  L      NER      ++  +
Sbjct: 635 NKLYCPPGYNVADYLIDITVTNERVDADSVNKNNE 669

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 86/178 (48%), Gaps = 25/178 (14%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           V+ F D+SFSY   P   +++ LNF +   S + +VGP+G GKST+  ++     P +G 
Sbjct: 390 VLAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGR 449

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP---TKEEIRSVAKQ 561
           +            +     +G+  Q         +D +   LT +P    +++  ++++ 
Sbjct: 450 V-----------SRHTHVKLGVYSQHS-------QDQLD--LTKSPLEFVRDKYPNISQD 489

Query: 562 C-FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
             +    + ++  T +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 490 FQYWRGQLGRYGLTGEAQTSQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 24/174 (13%)

Query: 463 IFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLLLRYYNPSTGTIMIDDQDITKMNCKSL 520
           + ++ N ++  G    ++G +G GKST   A+    Y  P    + + D+        +L
Sbjct: 94  LIQDSNLELNYGRHYGLLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSAL 153

Query: 521 RRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDT--- 577
              +   Q E   +   +   I   L   P  E +  + ++    +     PNT+++   
Sbjct: 154 DYVVTEAQNELKRLEDLVEKII---LEDGPESELLEPLYEKMDSMD-----PNTFESRAA 205

Query: 578 -----------VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
                       I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 206 VILIGLGFNSKTITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 259

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 101/239 (42%), Gaps = 55/239 (23%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y  +    + K++N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYDEKNL--LLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGY 588

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R  IG   Q  V       D++           ++ + A     
Sbjct: 589 V-----------SRNGRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGSRG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  K    Y   +G+ G           LLSGGQK R+A A   +  P ILILDE ++
Sbjct: 620 KTFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
            LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 680 HLDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 102/241 (42%), Gaps = 48/241 (19%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF +   PS  + K++N  +   S + IVG +G GK+T+  +L+         
Sbjct: 531 IIQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILM--------- 579

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
                        + LR   G V + P L        + Y   +     ++ + A     
Sbjct: 580 -------------EQLRPLQGYVSRNPRL-------RVAYFTQHHVDSMDLNASAVDWMS 619

Query: 565 HNFITKFPNTYDTVIGSRG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
           + F  +    Y   +G+ G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 NTFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGK 669
            LD     A+      +T G LM S  +++I      + I  SEN  V   +G++ +   
Sbjct: 680 HLDTAGLDALMDALKKFTGGVLMVSHDISVIDGV--CNEIWVSENGTVRRFEGTIFDYKN 737

Query: 670 F 670
           +
Sbjct: 738 Y 738

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1499

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 111/236 (47%), Gaps = 12/236 (5%)

Query: 444  GVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNPS 501
            G+  +++V ++ P R S + +  N++   APG+   ++G SG GK+T +  L  R     
Sbjct: 851  GIFIWRNVCYTIPYRGSTRRLLDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGII 910

Query: 502  TGTIMIDDQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAK 560
            TG ++++   I      S  R  G VQQ+ V +   T+R+++ +        + +    K
Sbjct: 911  TGDMLVNGNHID----ASFERRTGYVQQQDVHVKEMTVRESLQFAAR-MRRPQSVPEAEK 965

Query: 561  QCFCHNFIT--KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALD 617
              +  + I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS LD
Sbjct: 966  MAYVEDIIEILDMEEYADALVGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLD 1025

Query: 618  VESEGAINYTFGHLMKSKSMTIISIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKK 672
             +S  AI      L ++    + +I    +T+  + + +++L   G  V  G   K
Sbjct: 1026 SQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGK 1081

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 101/257 (39%), Gaps = 41/257 (15%)

Query: 443 RGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYN 499
           RG+ E K+       R +  I +N N    PG  + ++G  G G S+    +   +  + 
Sbjct: 160 RGIREAKN-------RKTRDIVRNANILARPGEMILVLGRPGAGCSSFLKTVSGEVDNFE 212

Query: 500 PSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVA 559
              G I  D     +M  K     I   + +      T++  + + L+ T  ++ + + +
Sbjct: 213 EVRGEISYDGISQKEMMAKFKTDVIYNGETDVHFPHLTVQQTLDFALSCTTPQKRLDNAS 272

Query: 560 KQCFCHNFITKFPNTYDTVIGSRGTL-----------LSGGQKQRIAIARALIKKPTILI 608
           +      +IT     Y T+ G R T            +SGG+++R++IA AL  + +I  
Sbjct: 273 RS----EYITAMRELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALASRGSIYC 328

Query: 609 LDEATSALDVESEGAINYTFGHLMK-----SKSMTIISIAHRLSTIRRSENVIVLGHDGS 663
            D AT  LD  +       F   ++      KS+  ++I      I    + + +  DG 
Sbjct: 329 WDNATRGLDASTA----LEFAQAIRIMTNLQKSVAFVTIYQASENIYECFDKVTVLFDGR 384

Query: 664 VVEMGK-------FKKL 673
            +  G        FKKL
Sbjct: 385 QIYYGHVEDAKAYFKKL 401

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 110/247 (44%), Gaps = 64/247 (25%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           V+ F D+SFSY  +P   ++++LNF +   S + +VGP+G GKST+  ++       +G 
Sbjct: 392 VLAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGR 451

Query: 505 I--------------MIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP 550
           +                D  D+TK   + +R     + Q+     G +     YGLT   
Sbjct: 452 VSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLG---RYGLT--- 505

Query: 551 TKEEIRSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILD 610
              E ++V                   ++G+    LS GQ+ R+  A   +++P +L+LD
Sbjct: 506 --GEAQTV-------------------LMGT----LSEGQRSRVVFALLALEQPNVLLLD 540

Query: 611 EATSALDVES----EGAINYTFGHLMKSKSMTIISIAHRLSTIRR-SENVIVLGH----- 660
           E T+ LD+ +      AIN   G         ++ ++H    + + ++++ V+ H     
Sbjct: 541 EPTNGLDIPTIDSLADAINEFNG--------GVVVVSHDFRLLDKIAKDIFVVEHKTATR 592

Query: 661 -DGSVVE 666
            DGS++E
Sbjct: 593 WDGSILE 599

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 32/44 (72%)

Query: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620
           T I  +   +SGG K R+A+A+AL  KPT+L+LD+ T+ LD+E+
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 120/255 (47%), Gaps = 40/255 (15%)

Query: 446 VEFKDVSFSYPT---------RPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTI--ALLL 494
           + F+++++  P+           +V++ K+++  + PG    I+G SG GK+T+   L +
Sbjct: 390 LSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAM 449

Query: 495 LRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRDNIT 543
            R      G I ++   +++   KS  + IG V Q           E VL S  +R  + 
Sbjct: 450 KRKTGQVGGEIKVNGNIMSR---KSYSKLIGFVDQNDYLHPTLTVYETVLNSALLR--LP 504

Query: 544 YGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARAL 600
             +++   +  +  + ++        +  +  D +IG+   RG  +SGG+K+R++IA  L
Sbjct: 505 RTMSFESKQSRVFQILEE-------LRIFDIKDRIIGNDFERG--ISGGEKRRVSIACEL 555

Query: 601 IKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR-LSTIRRSENVIVLG 659
           +  P IL LDE TS LD  +   +  +   L K+ + T+I   H+  S I    N +VL 
Sbjct: 556 VTSPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVLL 615

Query: 660 HDGSVVEMGKFKKLY 674
             G +V  G   K++
Sbjct: 616 SQGEMVFSGDSIKIH 630

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 103/233 (44%), Gaps = 32/233 (13%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y  +    +  ++N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVSFGYNEKN--LLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGY 588

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 562
           +            ++ R  IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 V-----------SQNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKTDEEYR------ 631

Query: 563 FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +  F  T    +  +  LLSGGQK R+A A   +  P ILILDE ++ LD     
Sbjct: 632 ---RHLGAFGITGSLSL-QKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGID 687

Query: 623 AI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKF 670
           A+      +T G LM S  +++IS  +  + I  SEN  V   DG++ +   +
Sbjct: 688 ALVDAMKKFTGGILMVSHDISVIS--NVCNEIWVSENGTVKRFDGTIYDYRDY 738

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y     +K+   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 100/217 (46%), Gaps = 26/217 (11%)

Query: 460 SVQIFK-----NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITK 514
           S+Q FK     N+    + G+S+ I+GP+  GKS+I  ++   +       ++     + 
Sbjct: 612 SIQDFKKNFDPNVPLIDSTGASLLILGPNSCGKSSIQRIITEVWPVYNKNGLLSIPAPSN 671

Query: 515 MNCKSLRRHIGIVQQEPVLM-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNF 567
           + C         V Q P     GT RD I Y ++           + +  + K+      
Sbjct: 672 LFC---------VPQRPYFTRGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYL 722

Query: 568 ITK-FPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
           + +    +Y   +     +LSGG+KQR+  AR L  +P  ++LDEAT+A+ V+ E   +Y
Sbjct: 723 LDREIGCSYMDAVADWKDVLSGGEKQRMNFARILFHRPRFVVLDEATNAISVDME---DY 779

Query: 627 TFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGS 663
            F +L+K      I+I+ R S I+  + ++ +   GS
Sbjct: 780 LF-NLLKRYRFNFITISQRPSLIKYHDMLLEVDSSGS 815

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 108/233 (46%), Gaps = 12/233 (5%)

Query: 443  RGVVEFKDVSFSYPTRPSV-QIFKNLNFKIAPGSSVCIVGPSGRGKST-IALLLLRYYNP 500
             GV  +KDV ++ P +    Q+  N++   APG+   ++G SG GK+T +  L  R    
Sbjct: 834  EGVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGI 893

Query: 501  STGTIMIDDQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVA 559
             TG ++++   I      S  R  G VQQ+ + +   T+R+++ +        E I    
Sbjct: 894  ITGDMLVNGSPID----ASFERRTGYVQQQDIHIKEMTVRESLQFS-ARMRRPESIPDSE 948

Query: 560  KQCFCHNFIT--KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-LDEATSAL 616
            K  +    I         D ++G  G  L+  Q+++++I   L  KP +L+ LDE TS L
Sbjct: 949  KMSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLDEPTSGL 1008

Query: 617  DVESEGAINYTFGHLMKSKSMTIISIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
            D ++  AI      L ++    + +I    +T+  + + +++L   G  V  G
Sbjct: 1009 DSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1061

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 100/225 (44%), Gaps = 25/225 (11%)

Query: 462 QIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL---LRYYNPSTGTIMID---DQDITKM 515
           +I + +N    PG  + ++G  G G S+    +   +  +   TG I  D    +D+ K 
Sbjct: 159 KIIQGVNLLALPGEMILVLGRPGAGCSSFLKTISGEVDQFPEVTGDISYDGIPQKDMMKK 218

Query: 516 NCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF------IT 569
               +  +  +    P L   T++  + + L        + + +++ +  +       I 
Sbjct: 219 YKPDVIYNGEMDVHFPHL---TVKQTLDFALACKVPSVRVNNASRKQYIASMRELYATIF 275

Query: 570 KFPNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626
              +TY+T +G+   RG  +SGG+++R++IA AL  + +I   D AT  LD  +  A+ Y
Sbjct: 276 GLRHTYNTKVGNDFVRG--VSGGERKRVSIAEALAARGSIYCWDNATRGLDAST--ALEY 331

Query: 627 TFG-HLMKS--KSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMG 668
                +M +  KS  +++I      I  + + + + +DG  +  G
Sbjct: 332 AQAIRIMTNLLKSTALVTIYQASENIYETFDKVTVLYDGRQIYFG 376

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 95/205 (46%), Gaps = 22/205 (10%)

Query: 467 LNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGI 526
           L F     SS+ I+GP+G GKS+I  ++   +       ++   D + + C         
Sbjct: 633 LPFLSGQASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSLLC--------- 683

Query: 527 VQQEPVLM-SGTIRDNITYGLTYTP------TKEEIRSVAKQCFCHNFITKFPN-TYDTV 578
           + Q+P     GT RD I Y ++           + +  +  +      + + P  +Y   
Sbjct: 684 IPQKPYFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDE 743

Query: 579 IGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMT 638
           +     +LSGG+KQR+  AR L  KP  ++LDEAT+A+  + E   +Y F  L K +  +
Sbjct: 744 VTEWKDVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FS 799

Query: 639 IISIAHRLSTIRRSENVI-VLGHDG 662
            I+I+ R S I+  + ++ +   DG
Sbjct: 800 FITISQRPSLIKYHDMLLEIADRDG 824

>KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1022

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 107/219 (48%), Gaps = 29/219 (13%)

Query: 471 IAPGSSVCIVGPSGRGKSTIALLLLRYYNPS---TGTIMIDDQDITKMNCKSLRRHIGIV 527
           + PG  + I+G SG GK+T+ L +L   N +   TG+I ++  DI K       + IG V
Sbjct: 397 VKPGEMLAIMGGSGAGKTTL-LDILAMKNKTGKVTGSIKVNGVDIDK---DKYSKIIGFV 452

Query: 528 QQEPVLM-SGTIRDNITYG--------LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578
            QE  L+ + T+ + +           L+++  +  +  V ++        +  +  D V
Sbjct: 453 DQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVLEE-------LRIFDIRDRV 505

Query: 579 IGS---RGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSK 635
           IGS   RG  +SGG+K+R++IA  L+  P +L LDE TS LD  +   +      L    
Sbjct: 506 IGSEYERG--ISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIECLVRLANHY 563

Query: 636 SMT-IISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
           + T ++SI    S+I +  + +VL  +G +V  G   K+
Sbjct: 564 NKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSGDAHKV 602

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 114/240 (47%), Gaps = 25/240 (10%)

Query: 443  RGVVEFKDVSFSYPTRPSVQIF-KNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501
            +GV  ++DV +  P + + +I   N+   +APG+   ++G SG GK+T+   L +  N  
Sbjct: 866  KGVFIWQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVG 925

Query: 502  --TGTIMIDDQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTY-----TPTKE 553
              TG + I+ + +      S  R  G VQQ+ + +   T+R+++ +          P  E
Sbjct: 926  IVTGDMSINGKPVD----SSFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAE 981

Query: 554  EI---RSVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-L 609
            ++    +V K       +       D ++G  G  L+  Q+++++I   L+ KP +L+ L
Sbjct: 982  KVADAETVMK-------LLDMEEYGDALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFL 1034

Query: 610  DEATSALDVESEGAINYTFGHLMKSKSMTIISIAHRLSTI-RRSENVIVLGHDGSVVEMG 668
            DE TS LD +S  AI      + K+    + +I    +T+  + + +++L   G  V  G
Sbjct: 1035 DEPTSGLDSQSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1094

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 103/238 (43%), Gaps = 44/238 (18%)

Query: 462 QIFKNLNFKIAPGSSVCIVGPSGRGKS----TIALLLLRYYNPSTGTIMIDD--QDITKM 515
           +I +N+N    PG  + ++G  G G S    T A +  ++     G I+ D   Q++   
Sbjct: 178 KILQNINVLAKPGEMILVLGRPGSGCSSFLKTAAGVTDQFAGGVDGEILYDGIPQNVMMK 237

Query: 516 NCKS-------LRRHIGIVQQEPVLMSGTIRDNITYGLT-YTPT--------KEEIRSVA 559
           N KS       L  H       P L   T++  + + +   TP         KE IR+  
Sbjct: 238 NYKSDVIYNPELDVHF------PFL---TVKQTLDFAIACKTPAVRVNNVSRKEHIRATR 288

Query: 560 KQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616
                +  I    +TYDT +G+   RG  +SGG+++R++IA AL  + T+   D AT  L
Sbjct: 289 D---LYATIFGLTHTYDTKVGNDFVRG--VSGGERKRVSIAEALAARGTVYSWDNATRGL 343

Query: 617 DVESEGAINYTFG-HLMKS--KSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 671
           D  +  A+ Y     +M +  +S   ++I      I  + + + + H G  +  G  K
Sbjct: 344 DAST--ALEYAQAIRIMTNLLRSTAFVTIYQASENIYETFDKVTVLHSGRQIYYGSTK 399

>KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 100/226 (44%), Gaps = 37/226 (16%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSFSY  + S  +  ++N  +   S + +VG +G GK+T+  +++    P+ G 
Sbjct: 531 IIQLQDVSFSY--KESDPLLTDVNLDVQMDSRISLVGANGCGKTTLLKVMMEQLRPTKGF 588

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 562
           +            ++ R  IG   Q  V      +  + +  T  P  T EE R      
Sbjct: 589 V-----------SRNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRR----- 632

Query: 563 FCHNFITKFPNTYDTVIGSRG----TLLSGGQKQRIAIARALIKKPTILILDEATSALDV 618
                +  F      + GS G     LLSGGQK R+A A   +  P IL+LDE ++ LD 
Sbjct: 633 ----HLGAF-----GISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDT 683

Query: 619 ESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSV 664
               A+       +KS +  ++ ++H +S I    N I +   G V
Sbjct: 684 AGLDAL----VDALKSFNGGVLMVSHDISVINSVCNEIWVSEGGKV 725

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 96/235 (40%), Gaps = 55/235 (23%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DV+F Y    +  + K++N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 531 IIQLQDVTFGY--NENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGY 588

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564
           +            ++ R  +G   Q  V                     ++ + A +   
Sbjct: 589 V-----------SRNPRLRLGYFAQHHV------------------DAMDLNASAVEWMS 619

Query: 565 HNFITKFPNTYDTVIGSRG----------TLLSGGQKQRIAIARALIKKPTILILDEATS 614
             F  +    Y   +GS G           LLSGGQK R+A A   +  P +LILDE ++
Sbjct: 620 KTFPGRSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSN 679

Query: 615 ALDVESEGAI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSV 664
            LD     A+     N+T G LM         ++H +S I    N I +  DGS 
Sbjct: 680 HLDTSGIDALVDALKNFTGGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +KS   TI+ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSHD 423

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON}
           Anc_1.427
          Length = 1097

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 114/257 (44%), Gaps = 45/257 (17%)

Query: 448 FKDVSFSYPTRPSV--------------QIFKNLNFKIAPGSSVCIVGPSGRGKSTI--A 491
           F+++S+  P  P                 I  N++  + PG    I+G SG GK+T+   
Sbjct: 409 FENISYRVPQLPGDHGNNNSNNDNDDGKSILNNISGIVKPGQIFAIMGGSGAGKTTLLDI 468

Query: 492 LLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQ-----------EPVLMSGTIRD 540
           L + R     TGTI ++ Q I++   K   +  G V Q           E VL S  +R 
Sbjct: 469 LAMKRKTGIVTGTIKVNGQTISR---KDYSKLTGFVDQNDYLHPMLTVYETVLNSALLR- 524

Query: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RGTLLSGGQKQRIAIA 597
            +   +++   +  +  V ++        +  +  D +IGS   RG  +SGG+K+R++IA
Sbjct: 525 -LPRSMSFEAKESRVYQVLEE-------LRIFDIKDRIIGSDFERG--ISGGEKRRVSIA 574

Query: 598 RALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR-LSTIRRSENVI 656
             L+  P IL LDE TS LD  +   +  +   L +  + T++   H+  S I    + +
Sbjct: 575 CELVTSPLILFLDEPTSGLDANNASNVINSLVRLSQHYNRTLVLTIHQPRSNIFYQFDKL 634

Query: 657 VLGHDGSVVEMGKFKKL 673
           VL  +  +V  G   K+
Sbjct: 635 VLLSNSEMVYSGDVSKV 651

>TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa]
           {ON} Anc_8.661 YPL147W
          Length = 872

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 89/193 (46%), Gaps = 21/193 (10%)

Query: 466 NLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCKSLRRHIG 525
           +L F   PG+S+ I+GP+  GKS+I  ++   +       ++       + C        
Sbjct: 632 SLPFFEGPGASLLILGPNSCGKSSIQRIIAEIWPVYNKNGLLSIPSEGNLFC-------- 683

Query: 526 IVQQEPVLM-SGTIRDNITYGLTYTP-------TKEEIRSVAKQCFCHNFITKFPNTYDT 577
            V Q+P     GT+RD I Y ++           K  ++ + +    +    K   TY  
Sbjct: 684 -VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGFKDKHLVQILGEVRLEYLLKRKKGWTYLD 742

Query: 578 VIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSM 637
            +     +LSGG+KQR+  AR +  KP  ++LDE T+A+  + E   +Y F +L+K    
Sbjct: 743 AVADWKDVLSGGEKQRMNFARIMFHKPRFVVLDEGTNAISADME---DYLF-NLLKRYRF 798

Query: 638 TIISIAHRLSTIR 650
             ISI+ R S I+
Sbjct: 799 NFISISQRPSLIK 811

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 99/227 (43%), Gaps = 32/227 (14%)

Query: 445 VVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGT 504
           +++ +DVSF Y  +    + K++N  +   S + +VG +G GK+T+  +++    P  G 
Sbjct: 530 IIQLQDVSFGYDEKN--LLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGY 587

Query: 505 IMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTP--TKEEIRSVAKQC 562
           +             + R  IG   Q  V      +  + +     P  T EE R      
Sbjct: 588 V-----------SSNGRLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYR------ 630

Query: 563 FCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEG 622
                +  F  T  T+   +  LLSGGQK R+A A   +  P IL+LDE ++ LD     
Sbjct: 631 ---RHLGSFGIT-GTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLD 686

Query: 623 AI-----NYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSV 664
           A+     N++ G LM S  +++I        I  SEN  V   DG++
Sbjct: 687 ALVESLKNFSGGVLMVSHDISVIDSV--CKEIWVSENGTVRRFDGTI 731

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMTIISIAHR 645
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y     +K+   T++ ++H 
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSHD 422

Query: 646 LSTIRRSENVIVLGHD 661
            + +      I+  H+
Sbjct: 423 RAFLNEVATDIIYQHN 438

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 98/213 (46%), Gaps = 21/213 (9%)

Query: 450  DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS--TGTIMI 507
            DV     TR   +I  N++  + PG+   ++G SG GK+T+   L         TG + I
Sbjct: 901  DVQIKTETR---RILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFI 957

Query: 508  DDQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566
            D     K   +S  R IG  QQ+ + L + T+R+++ +   Y     E+    K  +  +
Sbjct: 958  DG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVED 1012

Query: 567  FIT--KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILI-LDEATSALDVESEGA 623
             I   +     D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  A
Sbjct: 1013 IIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWA 1072

Query: 624  INYTFGHLMK---SKSMTIISIAHRLSTIRRSE 653
            I      LM+   ++   I+   H+ S I   E
Sbjct: 1073 I----CQLMRKLCNQGQAILCTIHQPSAILMQE 1101

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 112/250 (44%), Gaps = 21/250 (8%)

Query: 432  SPTAGHKYKPHRGVVEFKDVSFSYPTRPSVQ-IFKNLNFKIAPGSSVCIVGPSGRGKSTI 490
            S T G +    + V  ++++ +  P +   + +  N++  + PG+   ++G SG GK+T+
Sbjct: 837  SSTNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

Query: 491  ALLLLRYYNPS--TGTIMIDDQDITKMNCKSLRRHIGIVQQEPV-LMSGTIRDNITYGLT 547
               L         TG +++D     +   +S  R IG  QQ+ + L + T+R+++ +   
Sbjct: 897  LDCLAERVTMGVITGDVLVDG----RPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-A 951

Query: 548  YTPTKEEIRSVAKQCFCHNFIT--KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPT 605
            Y     E+    K  +    I   +     D V+G  G  L+  Q++R+ I   L  KP 
Sbjct: 952  YLRQPAEVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPK 1011

Query: 606  ILI-LDEATSALDVESEGAINYTFGHLMK---SKSMTIISIAHRLSTIRRSE--NVIVLG 659
            +L+ LDE TS LD ++  +I      LM+   S    I+   H+ S I   E   ++ L 
Sbjct: 1012 LLVFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQ 1067

Query: 660  HDGSVVEMGK 669
              G     G+
Sbjct: 1068 DGGQTTYFGE 1077

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 76/176 (43%), Gaps = 25/176 (14%)

Query: 460 SVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNC-- 517
           S QI K +   + PG  + ++G  G G +T    LL+  + +T    +D   +   N   
Sbjct: 157 SFQILKPMEGYLDPGELLVVLGRPGSGCTT----LLKTISSNTHGFRVDKDSVISYNGLT 212

Query: 518 -KSLRRH-----IGIVQQEPVLMSGTIRDNI-TYGLTYTPTKEEIRSVAKQCFCHNFITK 570
            + +R+H     +   + +  L   T+ + + T     TPT   I+ V +  +  +    
Sbjct: 213 PREMRKHFRGEVVYNAESDVHLPHLTVFETLYTVARLKTPTN-RIKGVDRDTYARHITDV 271

Query: 571 FPNTY------DTVIGS---RGTLLSGGQKQRIAIARALIKKPTILILDEATSALD 617
              TY      +T +G+   RG  +SGG+++R++IA   I        D AT  LD
Sbjct: 272 AIATYGLSHTKNTKVGNALVRG--VSGGERKRVSIAEVSICGSKFQCWDNATRGLD 325

>TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {ON}
           Anc_3.133 YOL075C
          Length = 1312

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 106/234 (45%), Gaps = 35/234 (14%)

Query: 462 QIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPST-------GTIMIDDQDITK 514
           +I  ++N    PG    I+GPSG GKS++  L+      S        G+I ++D +I++
Sbjct: 727 EILNSINATFKPGMINAIMGPSGSGKSSLLNLISAKQKSSMFATFSKEGSIALNDNEISE 786

Query: 515 MNCKSLRRHIGIVQQEPVLMSG-TIRDNITYG----LTYTPTKEE-------IRSVAKQC 562
              KSL  ++   Q +  L+S  T+R++  +     L Y  + E        IR++    
Sbjct: 787 EMFKSLCAYVS--QDDDHLLSKLTVRESFKFAADLRLHYMCSDERDEKIDTLIRALG--- 841

Query: 563 FCHNFITKFPNTYDTVIGSRGTL-LSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621
                     N  +T+IG      +SGG+K+R+++   L+K P IL+LDE TS LD  + 
Sbjct: 842 --------LTNCQNTIIGDEFVKGISGGEKRRVSMGIQLLKDPPILLLDEPTSGLDSFTS 893

Query: 622 GAINYTFGHLMKSKSMTIISIAH--RLSTIRRSENVIVLGHDGSVVEMGKFKKL 673
             +      L      T+I   H  R    ++  NV++L   G     G  K++
Sbjct: 894 LTVLEILEQLSADFGKTVIITIHQPRAELFKKFGNVLLLAKSGRTAFNGSPKEM 947

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 103/242 (42%), Gaps = 40/242 (16%)

Query: 438 KYKPHRGV-VEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLL-- 494
           K+KP   V +  +D++ +  ++    + ++ +  +  GS + ++G SG GK+T+  +L  
Sbjct: 20  KFKPTNKVSLHVRDLTIT-ASKSKKTLIRDFSIDLPSGSVMAVIGGSGSGKTTLLNVLAS 78

Query: 495 -----LRYY----------------NPSTGTIMIDD----QDITKMNCKSLRRHIGIVQQ 529
                L Y                 NP     +  D       ++ +  S    +  + Q
Sbjct: 79  KISGGLSYTGDISYIADNNSSTTSSNPYEKVSVTSDTFSLSSTSQESIASSHASMAYLPQ 138

Query: 530 EPVLMSG-TIRDNITYG--LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGS---RG 583
           + VL    T R+ + Y   L    +KEE   +  +     +     +  DT++G    RG
Sbjct: 139 QDVLAPKLTCRETLMYSAELKLQQSKEENAKLVDELI---YELGLIDCADTLVGDSSHRG 195

Query: 584 TLLSGGQKQRIAIARALIKKPTILILDEA