Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.56.8ON51551526640.0
Smik_6.4806.8ON51651624300.0
YPL272C6.8ON51751723850.0
Suva_16.336.8ON51851823040.0
NDAI0G00860singletonON52353012591e-169
KNAG0E027706.8ON50851912561e-169
TDEL0G046306.8ON50352012331e-165
CAGL0A01089g6.8ON53553812011e-160
Kpol_1045.796.8ON50852411531e-153
KAFR0B065106.8ON50852411101e-147
SAKL0E00792g6.8ON51152110761e-141
TPHA0J002606.8ON51552410531e-138
TPHA0M001806.8ON50351610441e-137
TBLA0A072206.8ON5095338481e-107
NCAS0D021806.8ON5155378471e-107
KLTH0C11572g6.8ON5185257195e-88
Kwal_56.223416.8ON5195306463e-77
Ecym_30116.8ON5095236367e-76
ACR018C6.8ON4784586138e-73
Kpol_1032.1singletonON2462443275e-34
Kpol_191.16.8ON1391451082e-05
KLTH0C02178g5.119ON4641421091e-04
CAGL0K00737g5.119ON457133900.019
Kwal_27.98985.119ON460118880.034
NDAI0D023605.119ON470304840.12
TPHA0H009605.119ON47673722.9
TBLA0A039608.326ON85072723.6
ZYRO0F01540g5.119ON47090696.8
KAFR0B057708.331ON256059698.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.5
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...  1030   0.0  
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   940   0.0  
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   923   0.0  
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   892   0.0  
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              489   e-169
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   488   e-169
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   479   e-165
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   467   e-160
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   448   e-153
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   432   e-147
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   419   e-141
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   410   e-138
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   406   e-137
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   331   e-107
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      330   e-107
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   281   5e-88
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   253   3e-77
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   249   7e-76
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   240   8e-73
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   130   5e-34
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    46   2e-05
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    47   1e-04
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    39   0.019
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    39   0.034
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    37   0.12 
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    32   2.9  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    32   3.6  
ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {...    31   6.8  
KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON} Anc_...    31   8.3  

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score = 1030 bits (2664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/515 (97%), Positives = 503/515 (97%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60

Query: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW
Sbjct: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF
Sbjct: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWEKNGFND 420
           LSLIDDELSADEFLANR            LMEYQFNKVTKHVSDFIMAKLKSWEKNGFND
Sbjct: 361 LSLIDDELSADEFLANRNDKEDDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKNGFND 420

Query: 421 DDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPTLMS 480
           DDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPTLMS
Sbjct: 421 DDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPTLMS 480

Query: 481 LSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           LSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 LSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/516 (88%), Positives = 480/516 (93%), Gaps = 1/516 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKS  + NDADW+SDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLP IA TLKRLIKSQPALFAT+NEEWEFEPL+QLKTSDIVNVIEFET+KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRF+PGSN+PLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LNNIS   H +DR+LFDI++V+IS+LNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF
Sbjct: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTS+    S TQLKKYNDILNAHSSLCGTTVFGIV+NQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDF+G IVFSIPIDLRK+L LGESLGLFFKELRI CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360

Query: 361 LSLIDDELSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWEKNGFND 420
           LSLIDDELS +EFLAN             LMEYQFN VTKHVS FIMAKLKSWEKNGFND
Sbjct: 361 LSLIDDELSVNEFLANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLKSWEKNGFND 420

Query: 421 DDIRRMKYDNDD-CHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPTLM 479
           DDIRRMKYDNDD  HIQNSKTKL+QINDVSDISLSMNND+K+FKI+SSGFTSSINRPTL+
Sbjct: 421 DDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFTSSINRPTLL 480

Query: 480 SLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           SLSYTYC+EMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 SLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/517 (88%), Positives = 480/517 (92%), Gaps = 2/517 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKK+LTQSLNDQRNGTIFSSTYSKS +R NDADW+SDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLP IA TLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LN IS   HS+DR+LFD++D+N+S L FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI+
Sbjct: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240

Query: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTSL  S S TQLKKYNDILNAH+SLCGTTVFGIVNNQRFNYLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDF+G IVF+IPI+LR +L LG SLGLFFKELR+ECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECP 360

Query: 361 LSLIDDELSADEFLANR-XXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWEKNGFN 419
           LSLIDDELSA+EFL N              LMEYQFNKVTKHVS FIMAKL+SWEKNGFN
Sbjct: 361 LSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRSWEKNGFN 420

Query: 420 DDDIRRMKYDN-DDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPTL 478
           DDDIRRMKYDN DD HIQNS+TKLIQINDVSDISLSMN D+K+FKI+S+GFTSSINRPTL
Sbjct: 421 DDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPTL 480

Query: 479 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 MSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/518 (85%), Positives = 475/518 (91%), Gaps = 3/518 (0%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60
           MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKS ++  DADW+SDEVTLGTNSSKDDS
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDS 60

Query: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RLTLP IA TLK+LIKSQPALFATVNE+WE+ PLKQLKTSDIVNVIEFET KDKEVNCHW
Sbjct: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE LLVFHGHDVLFDIFSAANFHKLFLKE
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 181 LNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           LN+I+  + SDDRVLFDI+DVN + L+FPKSIYDSAKL LPAMTPQI HKQTQSFFKSIF
Sbjct: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240

Query: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300
           YNTLKRPFGYLTNQTS      T+QLK+YNDILN +SSLCGTTVFGIVNNQRF+YLKSIV
Sbjct: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360
           NQEHICLRSFICGIAMICLKPLVKDF+G IVFSIPIDLRK+L+LGESLGLFFKELRIECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360

Query: 361 LSLIDDELSADEFLA--NRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWEKNGF 418
           LSLIDDELS +EFL   N             LMEYQFNKVTKHVS++IM KLKSWE+NGF
Sbjct: 361 LSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSWERNGF 420

Query: 419 NDDDIRRMKYDN-DDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPT 477
           NDDDIRRMKYDN DD H+QNSKTKLIQINDVSDISLSM+ND+K+FKI+SSGFT+SINRPT
Sbjct: 421 NDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPT 480

Query: 478 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           LMSLSYTYCE+MGLNICIHYPDSYNLESFVECFESFIE
Sbjct: 481 LMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  489 bits (1259), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 251/530 (47%), Positives = 358/530 (67%), Gaps = 26/530 (4%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62
           + R LSSFEKK+L+Q+L+ +RNG  +++ Y       +D+  +     L T     D RL
Sbjct: 2   SIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATK----DIRL 57

Query: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
            +  +   L+RLIK    L++T+NE +EF+ L ++K  D+++VI F+T KD+++NCH G 
Sbjct: 58  NIGIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGA 117

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FNK +F    NKPLW LY+IDE +++FHG D+LFDIFSAANFHKLF  ELN
Sbjct: 118 PP-YLLRHIFNKEKF--ELNKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELN 174

Query: 183 NISLE---AHSDDRVLFDISDVNISNLNF-------PKSIYDSAKLHLPAMTPQIFHKQT 232
           +  L    + S+ + L  +  +N+S+ NF       P+SI+D+ KLHLPAMTP +F+ QT
Sbjct: 175 DYFLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQT 234

Query: 233 QSFFKSIFYNTLKRPFGYLTNQTSLGPSTSTTQLKKYN-----DILNAHSSLCGTTVFGI 287
           +SFFK+I+ NT+K+P        S   +  T+QLK+Y      D+L   SSLCGTTVFG 
Sbjct: 235 KSFFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGT 294

Query: 288 VNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGES 347
           V+  R+NYLK ++ Q+ ICLRSFICGI MICLKP +K+++G I+FSIPI+LR  +D  ++
Sbjct: 295 VSPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKN 354

Query: 348 LGLFFKELRIECPLSLIDDE-LSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFI 406
            GLF+K+++I+CPLSLIDD     + +  +             L+EYQF +VT+ + + I
Sbjct: 355 FGLFYKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQVTEFIENVI 414

Query: 407 MAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMN-NDEKAFKII 465
           + +LK WEK  FNDDDI+RMK+D+D+   QNS  K+IQIND ++I L  N N+ KAF + 
Sbjct: 415 LERLKIWEKFNFNDDDIKRMKFDHDEVLGQNS--KIIQINDTTEIMLGENDNNNKAFTLT 472

Query: 466 SSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           +  FT +++    MS+S+  CEE GLN+CIHYPD Y++E+FVECF++FIE
Sbjct: 473 NPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  488 bits (1256), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 254/519 (48%), Positives = 347/519 (66%), Gaps = 18/519 (3%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDS 60
           M++ R LSSFEKKLL QS++  +NGT F + YS          W+ +E TL T     DS
Sbjct: 1   MSSVRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFK-----EGWSDEEATLLT---VKDS 52

Query: 61  RLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120
           RL L  +   L+ LIK    LF T+NE++EFE LK++KTSD+++ I+F++ KD+++NC  
Sbjct: 53  RLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQL 112

Query: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180
           G PP YLLRH FN  RFVPGS KPLW LY++D++L  FHG D LFD+FS ANFH+L LKE
Sbjct: 113 GAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKE 171

Query: 181 LNNISLEAHSDDRV--LFDISDVNISNL-NFPKSIYDSAKLHLPAMTPQIFHKQTQSFFK 237
           +N +S       ++  +F     ++S +   PKSIYD+ KL++P + P +F+ QTQSFFK
Sbjct: 172 VNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFK 231

Query: 238 SIFYNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLK 297
           SI+ NT+K+P  +LTN      S ++    KYNDIL+ +S LCG TVFG V+N+RF YL 
Sbjct: 232 SIYVNTVKKPIEFLTNTDVSFLSLNSNM--KYNDILDINSKLCGNTVFGCVSNERFKYLN 289

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRI 357
           +I+NQE +CL+SFI GIAM+CLKP+VK+ +G + FSIP+DLR  +D     GL++K++R+
Sbjct: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349

Query: 358 ECPLSLIDDELSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWEKNG 417
           ECPLSLIDD+ S D     +            LMEYQF  +T  V + +  +L  + K G
Sbjct: 350 ECPLSLIDDDKSKD---CMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSKTG 406

Query: 418 FNDDDIRRMKYDNDDCHIQNSKTK-LIQINDVSDISLSMNNDEKAFKIISSGFTSSINRP 476
           FNDDDIRRMK+D+ +    +S     IQI D S I+++   +  +F I +   T S+N  
Sbjct: 407 FNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTKSLNSE 466

Query: 477 TLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
            LMSLSYTYCEE GLNICIHYP++Y +ESFVECF+SF+E
Sbjct: 467 ELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  479 bits (1233), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 249/520 (47%), Positives = 340/520 (65%), Gaps = 27/520 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62
           +FR L  FEKK+L+QSL   RNG +F + YS +P      +W SD+ TL T     DSRL
Sbjct: 2   SFRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPE-----EW-SDDATLLTYK---DSRL 52

Query: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
            L  ++ TL ++I     LF T+NE+ EF P+K++K  +++N + F + KD+ VNC +G 
Sbjct: 53  NLSLLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGA 112

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH FN+T F PGS   LW +YV+DE L+VFHGHDVLFDIFSAANFHK+FL+ LN
Sbjct: 113 PP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLN 171

Query: 183 NISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242
           +IS ++ S    +F +    +    FPKSIYD+AKL LPA    +F+ QTQSFFKS+++N
Sbjct: 172 SIS-KSGSKLSTIFKLEKAVLPP--FPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFN 228

Query: 243 TLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIVNQ 302
            +K+P  Y+ +     P        +Y DIL   ++LCGTT+FG +  +R   L  I  Q
Sbjct: 229 AVKKPLDYINSNP---PQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQ 285

Query: 303 EHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECPLS 362
           ++ICL+SF+CGI M+CLKP+VK++TG+I F +P+DLR +L+     G+F+K++R+ECPLS
Sbjct: 286 QNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLS 345

Query: 363 LIDDELSADEFLANRXXXXXXXX------XXXXLMEYQFNKVTKHVSDFIMAKLKSWEKN 416
           LIDD+      + N                   L+EYQF +VT HV   +  ++K+WEK 
Sbjct: 346 LIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKF 405

Query: 417 GFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNND-EKAFKIISSGFTSSINR 475
           GFNDDDI+RMK+ +DD     + TKLIQINDVSDI +  + D    F +     T S+  
Sbjct: 406 GFNDDDIKRMKFGSDDTA---TNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKP 462

Query: 476 PTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
             LMSLSYT+ E+ GL+ICIHYPD YN+ESFVECF+SFIE
Sbjct: 463 GQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIE 501

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  467 bits (1201), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 245/538 (45%), Positives = 347/538 (64%), Gaps = 34/538 (6%)

Query: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDAD-WNSDEVTLGT------NSSK 57
           R LSS+E+KLL++ L + +NGT+F ++Y    +   D   W+ D  TL        ++ K
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 58  DDSRLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVN 117
               LTLP +   LK LI+  P ++ TVN+  EF PLK+++T D+++V+ F+  KD++VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 118 CHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLF 177
           CH G PPPYL+RH      F PGSNKPLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 178 LKELNNISLEAHSDDR---VLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQS 234
           LKEL  +     S ++    LF +     +N + PKSIYD+ KLHLPA  P++ + QTQS
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 235 FFKSIFYNTLKRPFGYLTNQTSLGP-------------STSTTQLK----KYNDILNAHS 277
           FFKSIF N +K+P  ++    +                S    QLK    +Y +IL + +
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSAT 302

Query: 278 SLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPID 337
           S CG T+FG V+N+RFNYL S+V  E ICLRSFI  I M+CLKP+VK F G ++FS+P++
Sbjct: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362

Query: 338 LRKNLDLGESLGLFFKELRIECPLSLIDDELSADEFLANRXXXXXXXXXXXXLMEYQFNK 397
           LR +++     GL +K++R+ECPLS+IDD+  +   L               L+E QF +
Sbjct: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGL-----NESDPEYNEKLLEIQFQQ 417

Query: 398 VTKHVSDFIMAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNN 457
           +  +V++ I  ++ +W+K G+ND+D++RMK+   D       T+LI+INDVS++S   +N
Sbjct: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFA-PNTRLIKINDVSEVSFD-DN 475

Query: 458 DEKAFKIISSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           D +   I S GFT+S+++ TLMSLSYT+CEE GLNICIHYPD YN+E+FV+CFESF+E
Sbjct: 476 DIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  448 bits (1153), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 239/524 (45%), Positives = 344/524 (65%), Gaps = 30/524 (5%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKD-- 58
           MT+FR L ++EKKL+ Q+L  Q NG IFS+ Y       N  D  +D+ TL TNS     
Sbjct: 1   MTSFRQLGTYEKKLVGQALAGQSNGIIFSAKYI-----SNAQDGLTDDATLLTNSEPLLL 55

Query: 59  DSRLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNC 118
           DSRL        L++++   P L  TVNE+ EFE +K++KTSDI+  ++F+++KD+ VNC
Sbjct: 56  DSRL-----VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNC 110

Query: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFL 178
           H G PP YLLRH FN+ +F PGS KPLW L VID++L++FHG DVLFDIF+AANFHKLFL
Sbjct: 111 HLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFL 169

Query: 179 KELNNISLEAHSDDRVLF--DISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236
           + LN++  E  +D   ++  D +  N S ++FP++IY++ KL +P  T  + + QTQSFF
Sbjct: 170 ETLNSMDDEHITDLEYIYRYDATKSNRS-ISFPRTIYENPKLRIPGKTIDLVNLQTQSFF 228

Query: 237 KSIFYNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYL 296
           KS + N +K+P   +T  +         ++    D +N  S+LCGTTVFG +   RF YL
Sbjct: 229 KSFYVNAIKKPLDIITFNSEPMKYIKPNEI----DFMNEASALCGTTVFGHITTDRFEYL 284

Query: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELR 356
            SI   E++C+RSFICGIA++CLK ++KDFTG+I FSIP++LR++++     GLF+K + 
Sbjct: 285 NSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTIL 344

Query: 357 IECPLSLIDDELSADEFL------ANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKL 410
           +ECPLSLIDD++  +  +      +N              +EYQF +++  VS  +  ++
Sbjct: 345 VECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERM 404

Query: 411 KSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFT 470
           ++W +NGFNDDDI++MK+ +DD   + S TK+IQINDVS+  ++ +   K   I    FT
Sbjct: 405 RAWRRNGFNDDDIKKMKFTSDD---KASNTKIIQINDVSEFKINSSKSSKV-SIKELNFT 460

Query: 471 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFI 514
            SI+    MSLSYTYC+E G NICIHYPD+Y++E FVE F+SF+
Sbjct: 461 HSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  432 bits (1110), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 225/524 (42%), Positives = 333/524 (63%), Gaps = 28/524 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62
           T R LSS+E+K+L +++  +RNG IF+++YS S       +W  D   L    +  DSR 
Sbjct: 2   TLRTLSSYERKILDETIRRERNGVIFTASYSASS-----EEWGDDTTLL----TLKDSRP 52

Query: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
           T+  +   ++RLI     LF T+NE +EFE LK +K  DI+N++EF++ KD+++NCH G 
Sbjct: 53  TIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGC 112

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+  RFVPGS KPLW+L++IDE+L++FHG D+LFDIFSAANFHKL LKE N
Sbjct: 113 PP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETN 171

Query: 183 NISLEA--HSDDRVLFDISDV--NISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238
            ++ E    S+  ++F + +    I+NL   KSIYD+ ++HLPA +P +F+ QTQSFFKS
Sbjct: 172 IVANEPLDSSESDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKS 231

Query: 239 IFYNTLKRPFGYLTNQTSLGPSTS------TTQLKKYNDILNAHSSLCGTTVFGIVNNQR 292
           +F++T+K+P  YL         TS       T ++KY DI + +++L  TTVFG +  QR
Sbjct: 232 VFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQR 291

Query: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGE-SLGLF 351
           + YL S++  + IC +SF+ GI M+CLKP +++F G++ FSI I+LR  L       GLF
Sbjct: 292 YEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLF 351

Query: 352 FKELRIECPLSLIDDELSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLK 411
           +K++ I+ PLSLIDD  +A      R            ++E+QF +VT  V D I  ++ 
Sbjct: 352 YKDVLIDVPLSLIDD--NAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRIS 409

Query: 412 SWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTS 471
            +   GFNDDDIR+MKY           TK+I++ D S++SL     +  + + ++ FT 
Sbjct: 410 KFSTMGFNDDDIRQMKYGK-----PAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTK 464

Query: 472 SINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           S+ +    S+SYT C+  GLN+C+ +PD  ++E+FVECF+SFIE
Sbjct: 465 SLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  419 bits (1076), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 219/521 (42%), Positives = 326/521 (62%), Gaps = 28/521 (5%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62
           +FR LSS EKKL +Q+LN++RNG +F++ YS   ++  +  W SD  TL T     D RL
Sbjct: 6   SFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDK--EETW-SDNATLLT---VKDQRL 59

Query: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
           +   ++  LK++I +   L+ T+N+  EF+P+K +   D+V  +EF++ KD+ VNCH GV
Sbjct: 60  SNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGV 119

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K +F    +KPLW + ++DE +++FHGHDVLFDIF+AANFHKLF + LN
Sbjct: 120 PP-YLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALN 178

Query: 183 NISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYN 242
            +  +  + + +  + S  +     FPKSIY++ KL LPA+   +F  QTQSFFKS++  
Sbjct: 179 QLPKDGPTLECLFKNDSKASF----FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234

Query: 243 TLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIVNQ 302
           T+K+P  ++    + G     +    Y DIL   ++LCGTTVFG ++ +R   LK I+ Q
Sbjct: 235 TIKKPLDFINTNPNSGLKYYQSC---YTDILLGANNLCGTTVFGNISAERVCALKKIMKQ 291

Query: 303 EHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECPLS 362
           E+ICL SF+C IA++CLKPLV +F  ++ FSIP+DLR  +      GL +K + +ECPL+
Sbjct: 292 ENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLT 351

Query: 363 LIDDEL--------SADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWE 414
           LIDD++          D  + N             L+EYQF +   HV + +  + ++WE
Sbjct: 352 LIDDKVFQGLNVYNGYD--IRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWE 409

Query: 415 KNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSIN 474
           ++GFNDDDI+RMK+   +   Q    ++I++N+V++    + +D   F I    FT S N
Sbjct: 410 RSGFNDDDIKRMKFGKTE---QGKSKRIIEVNNVTEFQFHV-DDNATFNIKDVCFTKSQN 465

Query: 475 RPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
             T MSLS  + E  GLN+CIHYPD YN++ FVECF+SF+E
Sbjct: 466 LETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  410 bits (1053), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 219/524 (41%), Positives = 329/524 (62%), Gaps = 27/524 (5%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLT 63
           FRPL+S+E+ +L +S  +Q NGTIFS+ Y+   +   ++  N D  TL T + +++    
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYT---DMQTNSTINDDAATLLTQNEENN---M 56

Query: 64  LPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123
                  L  +I   P L+ T+N + EFEP+ ++KT D+++ I+F + KD+ VNC  G P
Sbjct: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNN 183
           P YLLRH FNK +FVPGS KPLW LY++D+++++FHG DVLFDI+SAA+FH+ F   L  
Sbjct: 117 P-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG 175

Query: 184 ISLEAHSDDRVLFDISDVNISNLN--FPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241
            +  +      +F +SD++ S L   FPKSIYDS  L LPA T  +   QT+ F KS+  
Sbjct: 176 ATPTSEKL-TTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVS 234

Query: 242 NTLKRPFGYLT-NQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIV 300
            T+ +P   +  N   +   T++  +    DIL   SSLCGTTVFG ++N+RF+YL+SI 
Sbjct: 235 KTIVKPLNIIMFNDEPMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIA 290

Query: 301 NQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECP 360
            +E++C +S +CGI M+CLKPL+KDF+  I FSI ++LR +++     GLF+K +RIE P
Sbjct: 291 EEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVP 350

Query: 361 LSLIDDEL-----SADEFLA-NRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWE 414
           LS IDD +     S + + A N             L+ YQFN++   +S  +  ++++W 
Sbjct: 351 LSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRMRAWR 410

Query: 415 KNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDIS---LSMNNDEKAFKIISSGFTS 471
           +NGFNDDDI+ MK+ + D   +N+  K+IQIND+SD+S   ++ N +  +  +    FT 
Sbjct: 411 RNGFNDDDIKMMKFGSKD---KNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLSFTH 467

Query: 472 SINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           S+     MSLSYT+C+  G NICIH+P+ Y+LE FVE F++FI+
Sbjct: 468 SLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  406 bits (1044), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 219/516 (42%), Positives = 322/516 (62%), Gaps = 20/516 (3%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLT 63
           FR L  +EKK+L Q++  +RNG +FSS  + +      AD   D  TL T  S ++  L 
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFAD---DNATLYTGRSVNEVSLK 59

Query: 64  LPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123
              + A L+ +I +   L+ T+N+   F P+ Q++T+D++  I ++  KDK +       
Sbjct: 60  -SVLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL--MKDQI 116

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNN 183
              LLRH FNK  F P + KPLW   + +++ ++FHGHDVLFDIFS ANF K  LKE+N+
Sbjct: 117 SDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMND 176

Query: 184 I--SLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241
           +  S +     + LF   D   S  N+P+SIY++ KLHLPA+T  + + QTQSFFK+I+ 
Sbjct: 177 VLNSNQKLKTVKTLFKF-DAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQ 235

Query: 242 NTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSIVN 301
           NTLK+P   +T+  S   +  +    +  DIL+  +SLCG TV G ++ +R+ +LK +V 
Sbjct: 236 NTLKKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVE 295

Query: 302 QEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECPL 361
           QE+I LRSFI  I M+CLKP+VK+F G+I+FSIP++LR  +      GLF+K +++ECPL
Sbjct: 296 QENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPL 355

Query: 362 SLIDDELSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKSWEKNGFNDD 421
            LI+DE    ++  N             L+E QF ++++HVSD I  ++K+WEK GFNDD
Sbjct: 356 ELINDE----KYYTN--PEVLHSMQNNSLLEIQFERISRHVSDVISQRMKAWEKFGFNDD 409

Query: 422 DIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNND--EKAFKIISSGFTSSINRPTLM 479
           DI+RMK+ ND+   +     +IQINDV++IS    ND    +F + +  FT S++    M
Sbjct: 410 DIKRMKFSNDE---KTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCNEFM 466

Query: 480 SLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           SL Y++  + GLNICIHYPD YN+E+FVECF+SFIE
Sbjct: 467 SLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  331 bits (848), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/533 (37%), Positives = 308/533 (57%), Gaps = 55/533 (10%)

Query: 3   TFRPLSSFEKKLLTQSLNDQ-RNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSR 61
             RPLSS EK+ L  SL  + R+G++ S  +       N  D + D   L    S  D  
Sbjct: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWV-----SNSLDISDDATLL----SSKDKP 61

Query: 62  LTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWG 121
           LT+  ++  LK LI +   +F T+N+  EF+ L ++ TSD+++ I FE  KD+ VNCH G
Sbjct: 62  LTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSG 121

Query: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKEL 181
            PP YL+ + F+   F P S KPLW L++++ +L+VF+G D LFDIF+ ANF KL  + +
Sbjct: 122 APP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEII 180

Query: 182 NNISLEAHS-DDRVLFDISDV-NISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI 239
           N++  E     D ++F + ++ NIS +NFPKSIYD+  LHLPA  P++F+ QTQSFFKSI
Sbjct: 181 NSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSI 240

Query: 240 FYNTLKRPFGYL--TNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLK 297
           + NT K+ F YL  T QT +  + +    K YN+IL+ +S +    V G V+ +R+  L 
Sbjct: 241 YLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLL 300

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLR--KNL------------- 342
            +++ E I L+SF C I ++CLK ++  F G+I+F IP +LR  +NL             
Sbjct: 301 KLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPE 360

Query: 343 DLGESLGLFFKELRIECPLSLIDDELSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHV 402
           D    LG+ +K++ +E PL LI+   + D                  ++E QF  V  ++
Sbjct: 361 DSANELGIIYKDIYVEVPLKLIEKIGNED------------------VVEEQFKIVCNYI 402

Query: 403 SDFIMAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAF 462
           ++ I  ++K+WEKNGFNDDDI+RMK+  +          +I++ND++ + LS + D   F
Sbjct: 403 NESIQKRIKAWEKNGFNDDDIKRMKFGYEQV------GNIIEVNDLTSLDLSCSKDS-LF 455

Query: 463 KIISSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
            I     T ++ +  ++SLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 456 HIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/537 (37%), Positives = 304/537 (56%), Gaps = 52/537 (9%)

Query: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLTL 64
           R LS +E KLL Q+L  +RNG  F++ Y +     N  D +       T  S  D RLTL
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGR-----NYDDSSLSSSDESTLVSLKDRRLTL 58

Query: 65  PSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPP 124
             I   L+ LI     L+  ++E+  +  + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117

Query: 125 PYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNN- 183
           PYLLRH FNK+ F  G  KPLW LY+IDE  ++FHG D+LFD FSAA FHK FL E+N+ 
Sbjct: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177

Query: 184 ----ISLEAHSDDRVLFDISD----VNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSF 235
               +S +       LF +S     + I +   P+SIYD        +T  +F+ QT+SF
Sbjct: 178 MSSIVSSKQKKPLDYLFQLSSSADLIKIYD-EIPRSIYDYDSSPFAPLTAVMFNDQTKSF 236

Query: 236 FKSIFYNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNA-----------HSSLCGTTV 284
           FKS++ N +K+P  ++TN +S        Q+K Y  I  A           H SLCG T+
Sbjct: 237 FKSLYLNAVKKPIEFITNTSS--------QVKTYQQIKEAETEGYLNPMGIHRSLCGNTI 288

Query: 285 FGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDL 344
           FG +++ RFN L     +E I L+S ICG+ M+ LKP + DF+  +VFSI ++LR ++  
Sbjct: 289 FGTISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSK 348

Query: 345 GESLGLFFKELRIECPLSLIDDELSADEFLANR---XXXXXXXXXXXXLMEYQFNKVTKH 401
            ++ GL+++++ IECPLSLIDD   A +F   R               + E QF  VT +
Sbjct: 349 SKTFGLYYRDIIIECPLSLIDDR--AIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTY 406

Query: 402 VSDFIMAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMN---ND 458
           + + +  K+  W+     D+DI+ MK  +    +  SK ++IQIND+++I ++ N   ND
Sbjct: 407 IQNVMNEKIGYWK----TDNDIKMMKMMD---DMHQSKDEIIQINDLTEIDINENLSQND 459

Query: 459 EKAFKIISSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
               K  SS   +S+++  + S+SYT+CE  GL I IH P   ++ESFVE F++F++
Sbjct: 460 PYCVK--SSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  281 bits (719), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 176/525 (33%), Positives = 280/525 (53%), Gaps = 28/525 (5%)

Query: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKS-PNRGNDADWNSDEVTLGTNSSKDD 59
           +  +R L+  EK +L ++    +NG +FS+TY K+ PN+    D + +E    T  S  +
Sbjct: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNK----DLSDNE----TLRSDMN 56

Query: 60  SRLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCH 119
            RL+   I   L ++IK    L   V+   EFEP+ ++   D+V  IEF+   D++VNC+
Sbjct: 57  QRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCY 116

Query: 120 WGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLK 179
            GVPP YLLRH F+K  F  G  +PLW L+VID  ++VFHGHDVLFD F+AANFHKLFL+
Sbjct: 117 NGVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQ 175

Query: 180 ELNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI 239
            LN++S E+ +  R +F    +  +    P++++   +    +     F+ Q+Q+  +S+
Sbjct: 176 ALNSLS-ESCTSPRPVFKGGKILPT---LPRALFQKQEPQAASSITDAFYSQSQAILRSL 231

Query: 240 FYNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSI 299
           +   +K+P  ++    S     ST Q     + LN  + LCGT VFG ++  RF  LK I
Sbjct: 232 YNLAIKKPLRFI---ESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGI 288

Query: 300 VNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIEC 359
           +N   I +++FI    + CL+P++      I FS+PI+LR  +     LG++ + + IEC
Sbjct: 289 LNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIEC 348

Query: 360 PLSLI--DDELSADEFLANRXXXXXXXXXXXXLM-------EYQFNKVTKHVSDFIMAKL 410
           PL     +   SA  +++N                      E  F +   HVS+ +   L
Sbjct: 349 PLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKAL 408

Query: 411 KSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFT 470
           +  E   F D D+ +M+ +    +   S +K+I+IND+S+I LS N +   + +     T
Sbjct: 409 QDLETGKFKDMDMMKMEQEA-KFYAAASGSKIIEINDLSEIDLS-NVNPSQYVVEDICAT 466

Query: 471 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
            S    T MS+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  253 bits (646), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 164/530 (30%), Positives = 277/530 (52%), Gaps = 41/530 (7%)

Query: 3   TFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRL 62
            +R L++ EK ++ ++    +NG +FSSTY + P+       N D  +   +  K    L
Sbjct: 7   VYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPD-------NVDNTSPSVSCMKMGKGL 59

Query: 63  TLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGV 122
               +   L ++IK    L +++N+  +FE +  +   D+V  IEF+ + D++V+C+ GV
Sbjct: 60  PDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGV 119

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
           PP YLLRH F+K  F  G  KPLW ++VID++++VFHGHDVLFD F+AA FHKLFL+ LN
Sbjct: 120 PP-YLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALN 178

Query: 183 NI-SLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFY 241
           +  +++    D +     D+    +   +S+     + L +         +Q+  K+++ 
Sbjct: 179 SFRNVKGQKSDLIFKTREDL----IPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYS 234

Query: 242 NTLKRPFGYLTN---QTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKS 298
             +K+P  ++ +   + S  P+++   L  Y         LCGT VFG VN +R   L++
Sbjct: 235 LAIKKPLRFIESGRLEHSGIPASNPYDLASY------AGDLCGTVVFGNVNPERVRGLRA 288

Query: 299 IVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIE 358
           ++N+  I  RSFI  + M CL P+++     I+FS+PI+LR+++     LG+F   +  E
Sbjct: 289 LMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFE 348

Query: 359 CPLSLIDDELSA--------DEFL-ANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAK 409
           CPL LI  ++           EFL  +               +  F ++  HV+  +   
Sbjct: 349 CPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELA 408

Query: 410 LKSWEKNGFNDDDI----RRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKII 465
               EK+  + +D+    R  +Y        +S++K+++IND+ ++ LS     + +KI 
Sbjct: 409 AMRLEKSHSSGEDLIKAEREARY-----FAASSRSKIVEINDLLEVDLSSKIHSR-YKIG 462

Query: 466 SSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
               TSS    T MS+SY   E  GLN+ IHY + +N+E FVE FE F++
Sbjct: 463 DVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  249 bits (636), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 161/523 (30%), Positives = 279/523 (53%), Gaps = 33/523 (6%)

Query: 2   TTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSR 61
           ++ R LSS EK    +    +RNG +F+  YS   N+     W SD++TL   S+  DSR
Sbjct: 6   SSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSS--NKCESERW-SDDITL---SNLRDSR 59

Query: 62  LTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWG 121
           L    I+  L+ +IK    L  T+ ++ +F P + ++  D+V  IEF+T KD+ + C  G
Sbjct: 60  LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNG 119

Query: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKEL 181
           +PP Y+LR+     +F  G  +PLW L ++D  +++ H H+V+FD+F+AANFH  F K L
Sbjct: 120 IPP-YILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKAL 176

Query: 182 NNISLEAHSDDRV-LFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240
           +    + H+ D + +++ +++ +S  NF           +     Q    Q  S  K  +
Sbjct: 177 SQFPKDTHALDILFVYEGNELQLSKTNF------DGMSQISVSPVQSLPLQCISVLKGAY 230

Query: 241 YNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAH---SSLCGTTVFGIVNNQRFNYLK 297
             T+K+    +          +T +  K +D+  +    ++LCGTTV G +N +R   L 
Sbjct: 231 RTTVKKSLNVIRRNFVANNQITTYESSK-SDVFKSMFNPNTLCGTTVSGSLNAERLASLL 289

Query: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRI 357
            + + E++C+ S +C I ++ LKPL++ F G+I F +PID+R+ L++ + LG+ +  L +
Sbjct: 290 ELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMV 348

Query: 358 ECPLSLIDDE-----LSADEFLANRXXXXXXXXXXXXLMEYQFNKVTKHVSDFIMAKLKS 412
           ECPLS I+D+     +S     +              L+EYQF ++T HV + +  K ++
Sbjct: 349 ECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKEKKQA 408

Query: 413 WEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSS 472
           W+K  F+   ++  K    +  I   + K I+IN V D+  + +     F   +  FTSS
Sbjct: 409 WQKRRFDMSSLKGKKLRRSNKII---RGKFIEINLV-DMGEAQDGQ---FHTKNVNFTSS 461

Query: 473 INRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
           +    L+S+S      +G+NI +HYP+S ++++FVECF+  +E
Sbjct: 462 LGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLE 504

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  240 bits (613), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 149/458 (32%), Positives = 250/458 (54%), Gaps = 38/458 (8%)

Query: 67  IAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPPPY 126
           I++ L+ +I+    +  TV +  +F P+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105

Query: 127 LLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNNISL 186
           + RH  NK++F  G  KPLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163

Query: 187 -EAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYNTLK 245
            E H++   +++   + +  ++          +  PA +P +      SF K++    LK
Sbjct: 164 NEPHNETLFVYEGGPLQLP-IDPDACSLPGVDVPYPASSPFV------SFVKNVCRYALK 216

Query: 246 RPFGYLTNQTSLGPSTSTTQLKKYNDILNA-HSSLCGTTVFGIVNNQRFNYLKSIVNQEH 304
            PFG L +  +     + + L +   +L     SL GTTV G +N+++ + L  ++++E 
Sbjct: 217 -PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNSKKLDSLLKLISKEE 275

Query: 305 ICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECPLSLI 364
           +C+RSF+C I ++ LKPL+++F G+I FSIP+DLR         G   K + ++CPL+LI
Sbjct: 276 VCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALI 335

Query: 365 DDELSADEFLANRXXXXXXXXX-------XXXLMEYQFNKVTKHVSDFIMAKLKSWEKNG 417
           DD +   E L NR                   L+EYQF +VT HV   + A+        
Sbjct: 336 DDRVF--ESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQT------- 386

Query: 418 FNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPT 477
            + D   + KY    C ++  K K+I+IN V D+  S       F+I +  FT S+   T
Sbjct: 387 -SGDWTGKRKYSK--CQLR--KKKIIEIN-VVDMGTS---PSARFQIKNMNFTDSLGSET 437

Query: 478 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515
            MSLS      +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 438 FMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  130 bits (327), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 129/244 (52%), Gaps = 13/244 (5%)

Query: 273 LNAHSSLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVF 332
           L   S +    +FG +  +RFN LK+++ +  ICLRS ICGI M+C KP +++F G I F
Sbjct: 14  LRKDSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRF 73

Query: 333 SIPIDLRKNLDLGESLGLFFKELRIECPLSLIDDELSADEFLANRXXXXXXXXXXXXLME 392
           SI +D++  +D     G+  K + ++CPL LIDD+   D                  ++E
Sbjct: 74  SIGVDMKPIVDDSSQFGILKKNIIVDCPLKLIDDKHYKD--------TDSESIKNGDILE 125

Query: 393 YQFNKVTKHVSDFIMAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDIS 452
            QF KVT  V++ +  KL+S  K+   ++      ++    + Q S +K+IQIND++DI 
Sbjct: 126 IQFRKVTDFVTEELSNKLQSMAKHFKRNN----CPFNFSSINSQISDSKVIQINDLTDIP 181

Query: 453 LSMN-NDEKAFKIISSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFE 511
            +    +   +       T  ++    MSLSY       ++I IHY ++  ++SFVECF 
Sbjct: 182 FTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFR 241

Query: 512 SFIE 515
           +FIE
Sbjct: 242 TFIE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 64/145 (44%), Gaps = 9/145 (6%)

Query: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLT 63
            R L+  EK  L Q+     NG IFS   SK        D  SD+ TL T     +S   
Sbjct: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNL 53

Query: 64  LPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123
              +  +LK LI     L  TV+E   F  L ++KT+D+V +I +   K  ++N     P
Sbjct: 54  QLLLLKSLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112

Query: 124 PPYLLRHAFNKTRFVPGSNKPLWTL 148
              L+   +  + F PGS KP   L
Sbjct: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 17/142 (11%)

Query: 63  TLPSIAATLKRLIKSQPALFATV---NEEWEFEPLKQ-LKTSDIVNVIEFETIKDKEVNC 118
           T   I   ++ ++   P L++ V   N     EPL+  L  SD+V   E E++ ++  N 
Sbjct: 34  TRSEIVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN- 92

Query: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVI-DEALLVFHGHDVLFDIFSAANFHKLF 177
                        F +  FV G+ KPLW + ++ D+   V     ++ D  SA  F   F
Sbjct: 93  -----------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSF 141

Query: 178 LKELNNISLEAHSDDRVLFDIS 199
           ++ LN    ++   D V+F  S
Sbjct: 142 MRSLNASHADSTFPDEVVFKPS 163

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 61/133 (45%), Gaps = 18/133 (13%)

Query: 70  TLKRLIKSQPALFATV---NEEWEFEPLKQ-LKTSDIVNVIEFETIKDKEVNCHWGVPPP 125
            L+R++ S   L+      N E    P+ + +K  D+V+ ++++T  ++E+N        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 126 YLLRHAFNKTRFVPGSNKPLWTLYVIDEA-LLVFHGHDVLFDIFSAANFHKLFLKELNNI 184
                 F K  F  G +KPLW + V+ +A  ++F    + FD  +   F    LK L  +
Sbjct: 95  -----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEEL 149

Query: 185 SLEAHSD-DRVLF 196
             +   D D +++
Sbjct: 150 KQDNDLDVDEIIY 162

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 11/118 (9%)

Query: 67  IAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIV-NVIEFETIKDKEVNCHWGVPPP 125
           I   +K  ++  P L++ V  + E   L+ +    ++  V+E+           +G+   
Sbjct: 38  ICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYT---------DYGLLDE 88

Query: 126 YLLRHAFNKTRFVPGSNKPLWTLYVI-DEALLVFHGHDVLFDIFSAANFHKLFLKELN 182
            +    F +  F  GS KPLW + V+ D   LV     V+ D  S   F K FL  LN
Sbjct: 89  DICNKIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLN 146

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 66/304 (21%), Positives = 122/304 (40%), Gaps = 73/304 (24%)

Query: 70  TLKRLIKSQPALFATV--NEEWEFEPLKQLKTS-----DIVNVIEFETIKDKEVNCHWGV 122
            L+  I + P L   +  N+E E+  ++ +K +     D+V  + +E  ++KE+N     
Sbjct: 44  ALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINS---- 99

Query: 123 PPPYLLRHAFNKTRFVPGSNKPLWTLYVIDE----ALLVFHGHDVLFDIFSAANFHKLFL 178
                    F    F   +++PLW + V+       LL+ H    LFD  SA    + F+
Sbjct: 100 --------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDHA---LFDGISAVKIWETFM 148

Query: 179 KELNNISLEAHSDDRVLFDISDVNIS-NLNFPKSIYDS---AKLHLPAMTPQIFHKQTQS 234
           ++LN  S           +I +++++  L  P+  ++    A  H   + P     + +S
Sbjct: 149 EKLNKSS-----------EIENIDVTVPLYIPEENHEGTLVASQHPYDIWPVPIAWKVKS 197

Query: 235 FFKSIFYN-----------------TLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHS 277
           F  +  +N                   K P G+L+      P    T  K  ND      
Sbjct: 198 FIATKLFNWYPQAIISPNSNLFEFKGYKFPEGFLSQY----PKDGVTSFKVRNDNTQKLI 253

Query: 278 SLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKD-FTGAIV-FSIP 335
            +    +  I+ N + N          + L S+I  I +I L+ + ++ +TG ++  SIP
Sbjct: 254 KMAPGKLETILKNCKTN---------AVSLTSYIVAIIIIALRNVTQESYTGNLLKVSIP 304

Query: 336 IDLR 339
           I+ R
Sbjct: 305 INTR 308

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 131 AFNKTRFVPGSNKPLWTLYVIDEALLVFHGHD-VLFDIFSAANFHKLFLKELNNISLEAH 189
            F +  F  G  KPLW L +  +   +    D   FD  SA  F K  L EL++I  +  
Sbjct: 99  VFQEINFKYGELKPLWKLIIASKINTIVLAMDHTFFDGSSATLFWKALLLELSSIDRDQL 158

Query: 190 SDDRVLFDISDVN 202
            D  V+F  ++++
Sbjct: 159 EDTDVVFSKANID 171

>TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {ON}
           Anc_8.326 YLR131C
          Length = 850

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 10  FEKKLLTQSLNDQRNGTIFSSTYSKSPNR--GNDADWNSDEVTLGTNSSKDDSRLTLPSI 67
            E++LL   L  Q+  T+F ++Y KS      N     S++ TL  NS ++DS    P+ 
Sbjct: 251 LEQQLLENRLEQQKLETVFKTSYDKSVENTLNNHTTGISEQDTLKLNSRENDSTPLRPTS 310

Query: 68  AATLKRLIKSQP 79
            +  +R++ S P
Sbjct: 311 ISPSRRIVTSNP 322

>ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212W SLI1 N-acetyltransferase confers resistance to
           the sphingolipid biosynthesis inhibitor myriocin (ISP-1)
           by inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 470

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 13/90 (14%)

Query: 95  KQLKTSDIVNVIEFETIKDKEVNCHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVI-DE 153
           + L+  D+V  +++    + ++N            + F    F   + KPLW + VI +E
Sbjct: 76  QSLELKDVVEFVDWAKFDEDKMN------------YVFQNYAFPYHTEKPLWKVLVIPNE 123

Query: 154 ALLVFHGHDVLFDIFSAANFHKLFLKELNN 183
             LV     VLFD  +     + FLK LN 
Sbjct: 124 RKLVLLMSHVLFDGMAGVIILQEFLKNLNQ 153

>KAFR0B05770 Chr2 (1190270..1197952) [7683 bp, 2560 aa] {ON}
           Anc_8.331 YDR150W
          Length = 2560

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 390 LMEYQ--FNKVTKHVSDFIMAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQIN 446
           L EYQ   NK+ K    ++  K+ S +K   ++DD R MK + +D  I+  + K +++N
Sbjct: 529 LNEYQKLVNKLEKPPLQYLTEKIASLQKTIVSNDDYRNMKRNLEDPSIEFLREKAVKLN 587

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,747,324
Number of extensions: 2749547
Number of successful extensions: 9320
Number of sequences better than 10.0: 46
Number of HSP's gapped: 9587
Number of HSP's successfully gapped: 46
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)