Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4483.501ON2082087531e-102
Smik_16.4063.501ON2122126843e-91
YPR154W (PIN3)3.501ON2152156558e-87
Suva_16.4823.501ON2352176524e-86
TPHA0A057203.501ON2202204701e-58
KNAG0A079903.501ON2212224412e-54
SAKL0F02486g3.501ON2301124353e-53
Kpol_480.83.501ON2391144344e-53
NDAI0B059203.501ON2351144311e-52
TDEL0D056903.501ON2012104123e-50
NCAS0F036003.501ON2372384136e-50
Smik_6.2323.501ON2411123953e-47
Suva_7.4243.501ON2491133876e-46
YGR136W (LSB1)3.501ON2411123814e-45
KLTH0G02332g3.501ON2331123797e-45
Kwal_47.189053.501ON2361123702e-43
CAGL0F04829g3.501ON2022103672e-43
Skud_7.4473.501ON2381123667e-43
TBLA0C045303.501ON2221143552e-41
KAFR0G037403.501ON2341383451e-39
AFR320W3.501ON2571153409e-39
KLLA0E03873g3.501ON2201043134e-35
KNAG0B007503.501ON2171122985e-33
ZYRO0D09702g3.501ON1581562876e-32
Ecym_12283.501ON2531112781e-29
ZYRO0G20372gsingletonON150552197e-22
TBLA0D029103.501ON2691141943e-17
TBLA0B054702.502ON539741507e-11
KAFR0D033602.502ON455741507e-11
Ecym_27471.356ON452671411e-09
AEL017W1.356ON416721382e-09
TPHA0C040202.502ON485571383e-09
TBLA0D049501.356ON468691383e-09
NCAS0A089901.356ON434611356e-09
CAGL0K02761g2.502ON450591348e-09
Smik_8.472.502ON447731349e-09
CAGL0I08965g1.356ON437631331e-08
KLTH0H12980g1.356ON399691331e-08
Kwal_0.3711.356ON217631311e-08
Smik_8.811.356ON468511321e-08
TDEL0A027802.502ON451631322e-08
Suva_8.512.502ON456641312e-08
YHR016C (YSC84)1.356ON468611312e-08
Skud_8.681.356ON475511312e-08
Suva_15.1991.356ON457511312e-08
SAKL0D09702g1.356ON428681303e-08
KAFR0C044001.356ON459611294e-08
ZYRO0B01298g2.502ON411601285e-08
SAKL0E02200g2.502ON511551285e-08
TPHA0O012801.356ON454511285e-08
NCAS0B072501.356ON441511277e-08
Smik_7.3351.356ON460511278e-08
Ecym_24402.502ON459701278e-08
TDEL0D022401.356ON433601278e-08
Kpol_1056.372.502ON501521269e-08
KNAG0C020401.356ON464511261e-07
YFR024C-A (LSB3)1.356ON459511261e-07
TBLA0A025705.470ON493751251e-07
Suva_6.961.356ON455651251e-07
KLTH0D06138g2.502ON489571251e-07
KLLA0B13475g2.502ON508561242e-07
YHL002W (HSE1)2.502ON452521233e-07
AFR140C5.470ON388651223e-07
KNAG0A067102.502ON419671223e-07
Kpol_1008.251.356ON449801214e-07
KLLA0A08360g1.356ON423511206e-07
Skud_6.1081.356ON459511206e-07
NDAI0A043505.470ON459641206e-07
Kwal_26.79022.502ON532521198e-07
NDAI0G059601.356ON423551189e-07
NDAI0B045801.356ON424511189e-07
ZYRO0G00792g1.356ON469671181e-06
ABR008C2.502ON443801171e-06
Skud_8.432.502ON454521171e-06
TBLA0F034901.356ON511511171e-06
TPHA0A022101.356ON397511162e-06
TPHA0E015005.470ON457611162e-06
KAFR0A009701.356ON396511152e-06
NCAS0A119205.470ON463601152e-06
Ecym_23082.591ON678561162e-06
NCAS0A050802.502ON450521152e-06
NDAI0K021302.502ON459531153e-06
KAFR0E036405.470ON441571143e-06
KNAG0C046305.470ON516761118e-06
ZYRO0D11110g5.470ON459571101e-05
Skud_4.6615.470ON460551091e-05
SAKL0G03454g5.470ON468571092e-05
YDR388W (RVS167)5.470ON482561082e-05
CAGL0M01650g5.470ON466571082e-05
Smik_4.6585.470ON472561073e-05
KLLA0E03059g5.470ON428591073e-05
CAGL0A02145g1.356ON391561063e-05
KLTH0F15114g5.470ON435701064e-05
TDEL0A033405.470ON473611064e-05
Kwal_55.212875.470ON461561054e-05
Kpol_440.105.470ON470611055e-05
ABR082W2.591ON683821056e-05
YHR114W (BZZ1)2.159ON633591012e-04
ACR266W2.159ON626571002e-04
KNAG0I015801.356ON58151967e-04
Ecym_23165.470ON42176958e-04
Kpol_1072.562.159ON63758950.001
KLTH0E09790g2.159ON62252950.001
YLR191W (PEX13)7.365ON38684940.001
SAKL0G17600g4.335ON44159930.002
KLLA0C12551g2.591ON60758930.002
Smik_8.1922.159ON63359930.002
Skud_8.1752.159ON63359920.002
Smik_12.2517.365ON38863910.003
AGR306C5.170ON92358900.004
ZYRO0G10098g4.108ON139263900.005
Skud_12.2567.365ON40384890.005
SAKL0E10780g2.159ON62560890.007
TDEL0B052202.159ON61378890.007
Kwal_47.178942.159ON62152880.007
Ecym_47107.365ON39962880.008
Ecym_25266.366ON52451870.009
TPHA0F031007.365ON38163870.009
TPHA0B028902.159ON63452880.009
Suva_10.2877.365ON39263870.009
Kpol_325.126.366ON57050840.022
KAFR0J026506.366ON55350820.042
Suva_15.3102.159ON63452820.042
Kpol_2000.28.344ON22550800.058
SAKL0B11176g2.591ON63363810.067
Kwal_33.148357.365ON38462800.075
ACR230C7.365ON39862800.076
ZYRO0D17358g6.366ON66850800.077
KNAG0C029104.108ON124454810.077
KLLA0F23848g2.159ON64949800.078
TPHA0H023806.366ON52856800.082
NDAI0I002206.366ON61553800.086
TBLA0B096202.319ON94154800.087
NDAI0J008508.344ON24550790.088
KAFR0E031608.539ON55490800.090
Suva_2.564singletonON4320710.11
Smik_3.1866.366ON59153790.12
Smik_13.2022.591ON66363790.13
Kwal_26.83232.591ON62763780.13
Kpol_538.255.170ON70756780.13
Skud_3.1606.366ON58653780.14
KAFR0L015807.365ON34461770.15
CAGL0E01045g8.344ON21350760.16
AER140C4.335ON41456770.16
KLLA0E23365g8.539ON57565780.16
Suva_3.1246.366ON60053780.16
TBLA0F002806.366ON57675770.18
Kpol_534.62.319ON88653770.18
SAKL0A00594g6.366ON63651770.20
KAFR0B050602.382ON529109770.21
TBLA0I010807.413ON155591770.22
Kwal_47.169434.335ON46057760.23
Ecym_54262.159ON67256760.24
YCR088W (ABP1)6.366ON59253760.24
KLTH0H09416g4.45ON152870770.24
KLTH0B04818g7.365ON38061760.25
TDEL0E055204.45ON158959760.27
KNAG0I027006.366ON57550760.30
TBLA0C055602.159ON67353750.32
CAGL0C03597g6.366ON58053750.33
ZYRO0B02706g7.365ON39667750.35
KLLA0D16874g8.344ON22751740.36
SAKL0E06820g2.319ON90552750.36
SAKL0H15048g8.344ON20750730.37
Ecym_42288.344ON26152740.37
YMR032W (HOF1)2.591ON66963750.40
KAFR0B058608.344ON24950730.42
TPHA0F003804.45ON161845750.42
NCAS0A145707.419ON35553730.55
NCAS0D047406.366ON59467730.56
TDEL0C018207.365ON38963730.58
Ecym_11678.539ON55055730.60
NCAS0B060202.319ON86455730.67
CAGL0C01881g7.413ON99952730.76
KAFR0L018807.413ON93049720.78
TBLA0D004507.413ON100554720.80
Ecym_11474.335ON42256720.85
AGL237C6.366ON57851720.88
KLTH0E07744g4.108ON124967720.90
Suva_2.1184.108ON116697720.91
SAKL0E05302g2.382ON53567710.94
TDEL0G024902.319ON85053711.0
Kwal_23.64376.366ON63151711.1
CAGL0E03476g4.45ON156468711.1
SAKL0H24222g4.45ON152675711.1
Skud_13.1882.591ON66963711.1
Suva_2.3268.344ON24050701.1
TDEL0F046808.344ON26450701.2
TPHA0G009302.319ON82453711.2
CAGL0A04147g7.365ON39163701.2
SAKL0H10098g8.539ON55562711.2
Ecym_33662.319ON90653711.2
Skud_4.4208.344ON23350691.3
KLLA0E21891g2.382ON54767701.4
TDEL0A078106.366ON55850701.4
YBL007C (SLA1)4.108ON124469701.4
Skud_2.1044.108ON121451701.6
Smik_2.1134.108ON123051701.6
Kpol_1045.277.413ON88055701.6
YLL017WsingletonOFF10339661.7
YBL085W (BOI1)7.413ON98055701.7
TPHA0G025802.382ON54698691.8
ZYRO0A02662g2.319ON88653701.8
Smik_4.1512.382ON54558691.8
TPHA0K007207.413ON101169701.8
YDR162C (NBP2)8.344ON23650681.8
KLLA0D09306g4.45ON153772701.8
Suva_13.2012.591ON66863691.9
KLLA0E06953g7.419ON35752682.1
KNAG0E020502.382ON56567692.2
TBLA0H011608.344ON22450672.4
NDAI0A033304.108ON122667692.4
KNAG0B022307.413ON90454682.4
KLTH0H15708g2.382ON538120682.5
KLTH0A07348g6.366ON62651682.6
KLTH0G11682g8.344ON18750662.7
Kwal_34.158272.382ON53699682.8
Smik_2.357.413ON98573682.9
ZYRO0F13882g8.344ON28853672.9
KAFR0F007502.159ON60272673.2
TBLA0A006108.539ON59754673.3
Suva_10.4064.45ON158775683.3
Smik_4.4068.344ON23550663.4
Suva_2.337.413ON98255673.5
Kpol_457.12singletonON56751673.6
Kpol_1023.445.319ON133759673.6
NCAS0A034904.108ON123590673.6
TPHA0K006807.419ON35547663.9
TDEL0B030708.539ON54185673.9
ADR262C2.382ON53386664.0
NCAS0B069802.159ON63949664.1
Suva_5.2397.419ON36853664.2
CAGL0E02783g4.108ON120352674.2
KAFR0I023501.421ON250101664.2
Skud_2.237.413ON98255664.3
TBLA0E015604.45ON139473664.4
NCAS0A145307.413ON102394664.4
YDL085W (NDE2)2.382ON54558664.4
KLLA0A04983g4.108ON125164664.6
NDAI0A015007.413ON104754664.7
NDAI0B043202.159ON63253664.8
KLLA0F14575g5.170ON85155665.0
KLLA0F10175g6.366ON57650665.1
KNAG0B025207.365ON31461646.2
TDEL0F023804.108ON125564656.5
Suva_4.161singletonON24858646.5
TPHA0I033007.542ON75256656.7
KNAG0A050208.344ON27050646.9
KNAG0H035002.159ON63460656.9
AGL293C7.413ON98449649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.448
         (208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   294   e-102
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   268   3e-91
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   256   8e-87
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   255   4e-86
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   185   1e-58
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   174   2e-54
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   172   3e-53
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   171   4e-53
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   170   1e-52
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   163   3e-50
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   163   6e-50
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   156   3e-47
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   153   6e-46
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   151   4e-45
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   150   7e-45
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   147   2e-43
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   145   2e-43
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   145   7e-43
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   141   2e-41
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   137   1e-39
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   135   9e-39
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   125   4e-35
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   119   5e-33
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   115   6e-32
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   111   1e-29
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    89   7e-22
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    79   3e-17
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    62   7e-11
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    62   7e-11
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    59   1e-09
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    58   2e-09
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    58   3e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    58   3e-09
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    57   6e-09
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    56   8e-09
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    56   9e-09
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    56   1e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    56   1e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    55   1e-08
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    55   1e-08
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    55   2e-08
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    55   2e-08
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    55   2e-08
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    55   2e-08
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    55   2e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    55   3e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    54   4e-08
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    54   5e-08
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    54   5e-08
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    54   5e-08
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    54   7e-08
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    54   8e-08
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    54   8e-08
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    54   8e-08
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    53   9e-08
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    53   1e-07
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    53   1e-07
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    53   1e-07
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    53   1e-07
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    53   1e-07
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    52   2e-07
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    52   3e-07
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    52   3e-07
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    52   3e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    51   4e-07
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    51   6e-07
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    51   6e-07
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    51   6e-07
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    50   8e-07
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    50   9e-07
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    50   9e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    50   1e-06
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    50   1e-06
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    50   1e-06
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    50   1e-06
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    49   2e-06
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    49   2e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    49   2e-06
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    49   2e-06
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    49   2e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    49   2e-06
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    49   3e-06
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    49   3e-06
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    47   8e-06
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    47   1e-05
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    47   1e-05
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    47   2e-05
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    46   2e-05
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    46   2e-05
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    46   3e-05
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    46   3e-05
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    45   3e-05
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    45   4e-05
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    45   4e-05
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    45   4e-05
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    45   5e-05
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    45   6e-05
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    44   2e-04
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    43   2e-04
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    42   7e-04
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    41   8e-04
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    41   0.001
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    41   0.001
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    41   0.001
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    40   0.002
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    40   0.002
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    40   0.002
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    40   0.002
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    40   0.003
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    39   0.004
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    39   0.005
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    39   0.005
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    39   0.007
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    39   0.007
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    39   0.007
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    39   0.008
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    38   0.009
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    38   0.009
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    39   0.009
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    38   0.009
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    37   0.022
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    36   0.042
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    36   0.042
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    35   0.058
SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} simila...    36   0.067
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    35   0.075
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    35   0.076
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    35   0.077
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    36   0.077
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    35   0.078
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    35   0.082
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    35   0.086
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    35   0.087
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    35   0.088
KAFR0E03160 Chr5 complement(632974..634638) [1665 bp, 554 aa] {O...    35   0.090
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    32   0.11 
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    35   0.12 
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    35   0.13 
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    35   0.13 
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    35   0.13 
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    35   0.14 
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    34   0.15 
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    34   0.16 
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    34   0.16 
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    35   0.16 
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    35   0.16 
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    34   0.18 
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    34   0.18 
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    34   0.20 
KAFR0B05060 Chr2 (1043706..1045295) [1590 bp, 529 aa] {ON} Anc_2...    34   0.21 
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    34   0.22 
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    34   0.23 
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    34   0.24 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    34   0.24 
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    34   0.24 
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    34   0.25 
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    34   0.27 
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    34   0.30 
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    33   0.32 
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    33   0.33 
ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {...    33   0.35 
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    33   0.36 
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    33   0.36 
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    33   0.37 
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    33   0.37 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    33   0.40 
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    33   0.42 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    33   0.42 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    33   0.55 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    33   0.56 
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    33   0.58 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    33   0.60 
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    33   0.67 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    33   0.76 
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    32   0.78 
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    32   0.80 
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    32   0.85 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    32   0.88 
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    32   0.90 
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    32   0.91 
SAKL0E05302g Chr5 complement(431939..433546) [1608 bp, 535 aa] {...    32   0.94 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    32   1.0  
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    32   1.1  
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    32   1.1  
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    32   1.1  
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    32   1.1  
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    32   1.1  
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    32   1.2  
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    32   1.2  
CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {...    32   1.2  
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    32   1.2  
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    32   1.2  
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    31   1.3  
KLLA0E21891g Chr5 (1954118..1955761) [1644 bp, 547 aa] {ON} simi...    32   1.4  
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    32   1.4  
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    32   1.4  
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    32   1.6  
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    32   1.6  
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    32   1.6  
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    30   1.7  
YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein ...    32   1.7  
TPHA0G02580 Chr7 (533488..535128) [1641 bp, 546 aa] {ON} Anc_2.3...    31   1.8  
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    32   1.8  
Smik_4.151 Chr4 (279705..281342) [1638 bp, 545 aa] {ON} YDL085W ...    31   1.8  
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    32   1.8  
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    31   1.8  
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    32   1.8  
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    31   1.9  
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    31   2.1  
KNAG0E02050 Chr5 (419283..420980) [1698 bp, 565 aa] {ON} Anc_2.3...    31   2.2  
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    30   2.4  
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    31   2.4  
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    31   2.4  
KLTH0H15708g Chr8 complement(1356162..1357778) [1617 bp, 538 aa]...    31   2.5  
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    31   2.6  
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    30   2.7  
Kwal_34.15827 s34 (76814..78424) [1611 bp, 536 aa] {ON} YMR145C ...    31   2.8  
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    31   2.9  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    30   2.9  
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    30   3.2  
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    30   3.3  
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    31   3.3  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    30   3.4  
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    30   3.5  
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    30   3.6  
Kpol_1023.44 s1023 complement(93704..97717) [4014 bp, 1337 aa] {...    30   3.6  
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    30   3.6  
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    30   3.9  
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    30   3.9  
ADR262C Chr4 complement(1155907..1157508) [1602 bp, 533 aa] {ON}...    30   4.0  
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    30   4.1  
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    30   4.2  
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    30   4.2  
KAFR0I02350 Chr9 complement(473466..474218) [753 bp, 250 aa] {ON...    30   4.2  
Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)    30   4.3  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    30   4.4  
NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]...    30   4.4  
YDL085W Chr4 (303211..304848) [1638 bp, 545 aa] {ON}  NDE2Mitoch...    30   4.4  
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    30   4.6  
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    30   4.7  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    30   4.8  
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    30   5.0  
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    30   5.1  
KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.36...    29   6.2  
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    30   6.5  
Suva_4.161 Chr4 (293198..293944) [747 bp, 248 aa] {ON} YDL085W (...    29   6.5  
TPHA0I03300 Chr9 (729773..732031) [2259 bp, 752 aa] {ON} Anc_7.5...    30   6.7  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    29   6.9  
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    30   6.9  
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    29   9.8  

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  294 bits (753), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/208 (73%), Positives = 153/208 (73%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXXXXXX 120
           ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF        
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGSSN 120

Query: 121 XXXXXQYKAQELQQAPTQNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXSSHNHL 180
                QYKAQELQQAPTQNSAV            TNYY                SSHNHL
Sbjct: 121 LPPPPQYKAQELQQAPTQNSAVSSYQQQPFPPPSTNYYQQPQQQPQQAPPQQQPSSHNHL 180

Query: 181 KSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
           KSFGSKL              DIVNSIF
Sbjct: 181 KSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  268 bits (684), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 147/212 (69%), Gaps = 4/212 (1%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSASLINRSLT IRTELDFLKESNVIS+DVFDQINKSLP+RW+P SA+R+TSS SLEYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXXXXXX 120
           ALYQFDPQQDGDLGLKPGDK+QLLEKLSPEWYKGSCNGR GIFPANYVKPAF        
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120

Query: 121 XXXXXQYKAQELQQAPTQNSAVXXXXXXXXXXXXTNYY----XXXXXXXXXXXXXXXXSS 176
                QYKAQELQ  PTQNSAV            TNYY                    +S
Sbjct: 121 LPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPSTNYYQQPQQAPAPAPQQQQQQQQPNS 180

Query: 177 HNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
           HNHLKSFGSKL              DIVNSIF
Sbjct: 181 HNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  256 bits (655), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 135/215 (62%), Positives = 144/215 (66%), Gaps = 7/215 (3%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSASLINRSLT IRTELDFLK SNVIS+DV+DQINKSLP +W+P++A R+ S ASLEYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXXXXXX 120
           ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR GIFPANYVKPAF        
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGPSN 120

Query: 121 XXXXXQYKAQELQQAPTQNSAVXXXXXXXXXXXXTNYY-------XXXXXXXXXXXXXXX 173
                QYKAQELQQ PTQNSA             TNYY                      
Sbjct: 121 LPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQH 180

Query: 174 XSSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
            SSH+HLKSFGSKL              DIVN+IF
Sbjct: 181 QSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  255 bits (652), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 144/217 (66%), Gaps = 9/217 (4%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSASL+NRSLT IRTELDFLKESNVIS DVFDQINKSLPV+W+PSSA R ++SASLEYVE
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASLEYVE 78

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXXXXXX 120
           A+YQFDPQQDGDLGLK GDKVQLLEKLSPEWYKGSCNGR GIFPANYVKP F        
Sbjct: 79  AVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDGQHR 138

Query: 121 XXXXXQYKAQELQQAPTQNSAVXXXXXXXXXXXXTNYY---------XXXXXXXXXXXXX 171
                QYKAQELQQ PTQNS V            TNYY                      
Sbjct: 139 LPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPPPPQQQQQ 198

Query: 172 XXXSSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
              SS+NHLKSFGSKL              DIVNSIF
Sbjct: 199 QQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  185 bits (470), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 124/220 (56%), Gaps = 12/220 (5%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPS------SAARDTSSA 54
           MS SLINRSLTTIRTEL+FLKES VIS  VF +IN SLP R++PS      SA     S 
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXX 114
           +LEYVEA+Y+FDPQQDGDL ++PGDK+Q+LEK+SPEWYKGSCNG+VG+FP+NY KPAF  
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 115 XXXXXXXXXXXQYKAQELQQAPTQNSAVXXXXXXXXXXXXTNYY------XXXXXXXXXX 168
                           + QQ P Q                TNYY                
Sbjct: 121 STNASKSELTPVPPQYQQQQQPIQQVQSYHSYQQPFPPQSTNYYQQAPQQQQQQQQPEQQ 180

Query: 169 XXXXXXSSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
                 ++  HLKSFGSKL              DIVNSIF
Sbjct: 181 QQQHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  174 bits (441), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 123/222 (55%), Gaps = 15/222 (6%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPS----SAARDTSS--A 54
           MSASLINRSLT +RTELDFL+ES VIS + F++I  SLP +++P+    + +RD+S   A
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXX 114
            LEYVEALY F PQQDGDL L+PGDK+Q+LEK S EWYKG C G+VG+FP+NYVKPAF  
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSG 120

Query: 115 XXXXXXXXXXXQYKAQE------LQQAPTQNSAVXXXXXXXXXXXXTNYYXXXXXXXXXX 168
                       Y+ Q+      + Q P QN+               NYY          
Sbjct: 121 ESSAPKRPAGPPYQPQQQHLAAPMYQQP-QNTGYSQSSNPPFPPQSANYYPPQQQQQPQQ 179

Query: 169 XXXXXXSSHNH--LKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
                   H H   K FGS+L              DIVNSIF
Sbjct: 180 VVVEQQQPHKHNAFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  172 bits (435), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 93/112 (83%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSASLINRSLTTIRTELDFL+ES VIS + F QI+ SLP R++P++    +SS SLEYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           A+Y F  QQDGDL LKPGDK+Q+LEK S EWYKG CNG VG+FP+NYVKPAF
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAF 112

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  171 bits (434), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 77/114 (67%), Positives = 99/114 (86%), Gaps = 2/114 (1%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPS--SAARDTSSASLEY 58
           MS++ INRSLT+++TEL+FL++SNVIS + FDQIN  LP R +PS  S A + SS +LEY
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           VEA+Y+FDPQQDGDL ++PGDK+Q+LEK+SPEWYKG CNG+VG+FP+NYVKPAF
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAF 114

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  170 bits (431), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 2/114 (1%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSS--ASLEY 58
           MSASLINRSLT IRTELDFLKESNVIS + F+QIN  LP R++P+ +    SS   +LEY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           VEA+Y F+PQQ+GDL LK GDK+Q++EK SPEW+KG CNG+VGIFP+NYV+PAF
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAF 114

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  163 bits (412), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 113/210 (53%), Gaps = 11/210 (5%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSAS INRSL T+RTELDFL+ESNVIS +++D +N+SLP         ++ S+   EY+E
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP---------QNASNKGGEYME 51

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXXXXXX 120
           ALYQFDPQQDGDL L PGDK+++LEK S EW+KG CNGRVG+FPANYVK A+        
Sbjct: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRPSV 111

Query: 121 XXXXXQYKAQELQQAPTQNS--AVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXSSHN 178
                  +AQ      +  S                   Y                 SHN
Sbjct: 112 PPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQQEQQQQHHSHN 171

Query: 179 HLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
           HLK FGSKL              D+VNSIF
Sbjct: 172 HLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  163 bits (413), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/238 (42%), Positives = 119/238 (50%), Gaps = 31/238 (13%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASL---- 56
           MSAS INRSL TIRTELDFLKESNVIS + FDQI  +LPV+++P  A+R  S  S     
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPD-ASRAPSIHSSNNNQ 59

Query: 57  ------EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
                 E+VEA+Y F+PQQ GDL LKPGDK++++EK SPEW+KG CNG+ G+FP+NYVKP
Sbjct: 60  PQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119

Query: 111 AFXXXXXXXXXXXXXQYKAQELQQAPTQNSAVXX-XXXXXXXXXXTNYYXXXXXXXXXXX 169
           AF                 Q      TQNS               TNYY           
Sbjct: 120 AFSGSSGSVNKVARPNGPPQYQNSLQTQNSHTPSFQQPAPFPPALTNYYQQQQPQFIQTP 179

Query: 170 XXXXXS-------------------SHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
                                    SH+ LK FGSKL              DIVNSIF
Sbjct: 180 QQQQPQQVQQQPVQQQQPQQQEQHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  156 bits (395), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 89/112 (79%), Gaps = 1/112 (0%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSA+L+NRSL  IR EL+FL+ESNVIS D+FD IN  LP +WN ++ + + +    EYVE
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTE-EYVE 59

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           ALY F+ QQDGDL LK GDK+Q+LEK+SP+WYKG  N RVGIFPANYVKPAF
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAF 111

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  153 bits (387), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (79%), Gaps = 3/113 (2%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLE-YV 59
           MSASLINRSL  IR ELDFLKES VIS D+F+ IN  LP +W+ +   R   +AS+E +V
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVN--LRPVPNASVEEFV 58

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           EALY F+PQQ+GDL LK GDK+Q+LEK+SP+WY+G  N RVGIFPANYVKPAF
Sbjct: 59  EALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAF 111

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  151 bits (381), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 70/112 (62%), Positives = 87/112 (77%), Gaps = 1/112 (0%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSASL+NRSL  IR EL+FLKESNVIS D+F+ IN  LP +W+ +  +   +    EYVE
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE-EYVE 59

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           ALY F+ QQDGDL LK GDK+Q+LEK+SP+WY+G  N ++GIFPANYVKPAF
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAF 111

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  150 bits (379), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 89/112 (79%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSAS INRSL+T+RTEL+FL+ES+VI+ + +  I  +LP R++PS   +  S+   E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQGEFVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           A+Y F  QQDGDL L+ GDKV++LEK SPEW+KG CNGRVG+FP+NYVKPAF
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAF 112

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  147 bits (370), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 85/112 (75%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSAS INRSL+T+RTEL+FL+ESNVI+   +  I   LP R+ P  +     S+  E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           A+Y F  QQDGDL L+ GDK+++LEK SPEWYKG CNGRVG+FP+NYVKPAF
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAF 112

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  145 bits (367), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 107/210 (50%), Gaps = 10/210 (4%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MS S INRSL  IR ELDFL+ESNVIS   F +I   LP     + A+      SLEYVE
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPS----NGASPVPPPMSLEYVE 56

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXXXXXX 120
           ALY F PQQDGDL ++ GDK+Q+LEK S EWY+G+ NGR G+FP+NYV+PA         
Sbjct: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPA----AAPSA 112

Query: 121 XXXXXQYKAQELQQAPT-QNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXSS-HN 178
                 Y   +L   PT Q+                 YY                SS HN
Sbjct: 113 NLAPPAYDNPKLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQPVQQSSAHN 172

Query: 179 HLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
            LKSFGSKL              D+VNSIF
Sbjct: 173 GLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  145 bits (366), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 88/112 (78%), Gaps = 1/112 (0%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60
           MSASLINRSL  IR EL+FLKESNVIS ++F  I+ +LP +W+ +S + + +S   EYVE
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTE-EYVE 59

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           ALY F+ QQDGDL LK GDK+Q+LEK+S +WYKG  N  +GIFPANYVKPAF
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAF 111

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  141 bits (355), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 68/114 (59%), Positives = 87/114 (76%), Gaps = 3/114 (2%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASL--EY 58
           MS+SLIN+SL+TI TELDFL +SN I    + +I+  LP R  P   +R  S++S   E+
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR-APEVPSRQQSNSSKNEEW 59

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           VEA+YQFDPQQDGDL L PGDK+ + EK SPEW+KG CNG+VG+FP+NYV+PAF
Sbjct: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAF 113

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%)

Query: 177 HNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
           H HLK+FGSKL              D+VNSIF
Sbjct: 191 HKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  137 bits (345), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 91/138 (65%), Gaps = 28/138 (20%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAAR----------- 49
           MS++LINR++T I+TELDFL+ES +I+    D+I K LP +++PSS              
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 50  -----------DTSSAS------LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY 92
                      D +SA+      LEYVEALY F+PQQ+GDL L  GDKVQ+LEK S EWY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 93  KGSCNGRVGIFPANYVKP 110
           KG+CNG++G+FPANYVKP
Sbjct: 121 KGTCNGQIGMFPANYVKP 138

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  135 bits (340), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 6/115 (5%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDT---SSASLE 57
           MS++LINRSL TIRTEL FL +S VI+    +QI  +LP   NP+ A R     ++  +E
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEALRGAPANNAGPVE 57

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           YVEALY F  QQ GDL  K G+K+++LEK SPEWYKG CNG+VG+FP+NYVKPAF
Sbjct: 58  YVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAF 112

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  125 bits (313), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 6   INRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVEALYQF 65
           +  S+ TI++EL +LKE   ++   +  I   LP R  P     DT   + E VEALY F
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLP-RVRPQPPVADTMGQNNEIVEALYAF 62

Query: 66  DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
            PQQDGDL LKPGDK+++LEKLSPEWYKG CNG+VG+FP+NYVK
Sbjct: 63  QPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  119 bits (298), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 76/112 (67%), Gaps = 3/112 (2%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNP---SSAARDTSSASLE 57
           MS   +NRS+T IRTEL++L ES VIS D FD+ N+ LP  W+      A         E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
           YVEA++++ PQ+  DL L+ GDKV++LEKLS +WY+G   G+VG+FP+NYVK
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  115 bits (287), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 80/156 (51%), Gaps = 5/156 (3%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXX 116
           E+VEA+Y+FDPQQ+GDL L PGDK+++LEK SPEW++G CNGRVG+FP+NYVKPAF    
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63

Query: 117 XXXXXXXXXQYKAQELQQAPTQNSAVXXXXXXXXXXXXTNYY----XXXXXXXXXXXXXX 172
                    QY  + +   P+  +A+            TNYY                  
Sbjct: 64  DRPAAPPPPQYDQKAMASQPSGGNAM-WQQPSPYPPPSTNYYQPPPPQQQQPQPMVVQQE 122

Query: 173 XXSSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 208
               H+ L  FGSKL              D++NSIF
Sbjct: 123 QGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  111 bits (278), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 75/111 (67%), Gaps = 5/111 (4%)

Query: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASL--EY 58
           MS+SLINRSL  I+TEL+FL ESNVIS     QI   L    NP       +S  +  EY
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSML---SNPREGTMKAASQQVLKEY 57

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
           VEALY F PQQ GDL  K GDK+++LEK S +WYKG  NGRVG+FP+NYVK
Sbjct: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 89.0 bits (219), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (81%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPA 111
           EYVE LY+F PQ   DL +KPGDKV+++EKLS +WYKG CNG+ G+FPANYVKP 
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPV 69

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 79.3 bits (194), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 68/114 (59%), Gaps = 8/114 (7%)

Query: 4   SLINRSLTTIRTELDFLKESNVISSDVFDQINKSL-PVRWNPSSAARDTSSASL------ 56
           + I  + T IR  L+ L ++  IS + +D+I   L   R +PS+++    +         
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNG 67

Query: 57  -EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
            +YVEA+Y +  +Q GDL L PGD ++++ K SP+WY+G  NG+VG+FP NYVK
Sbjct: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%)

Query: 37  SLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC 96
           S+P   NP+    +   A ++ V A+Y     + G+L  K GD ++++E++  +W++GS 
Sbjct: 223 SVPNSNNPNQQIDEQKPAVVKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSL 282

Query: 97  NGRVGIFPANYVKP 110
            G VGIFP NYV P
Sbjct: 283 RGTVGIFPLNYVNP 296

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 44/74 (59%)

Query: 39  PVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNG 98
           PV    S   + ++SA ++ V A+Y F   +  +L  K GD + +LE++  +W++GS  G
Sbjct: 196 PVLQETSQQQQPSTSAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRG 255

Query: 99  RVGIFPANYVKPAF 112
           R+GIFP NYV P  
Sbjct: 256 RIGIFPLNYVTPIM 269

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 2/67 (2%)

Query: 45  SSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGI 102
           S++ RD  S+      ALY F  +QDGDL  + GD + +L+K +   +W+ G  NG+ GI
Sbjct: 384 SASIRDRPSSGTPKAVALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGI 443

Query: 103 FPANYVK 109
           FPANYV+
Sbjct: 444 FPANYVE 450

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 39  PVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSC 96
           P    P   +  TSS ++    ALY F  +Q GDL  + GD + +L++     +W+ G  
Sbjct: 342 PTSAKPDFGSHSTSSGAIPKAVALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRI 401

Query: 97  NGRVGIFPANYV 108
           NG+ GIFPANYV
Sbjct: 402 NGQEGIFPANYV 413

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 38/57 (66%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAF 112
           +  V A+Y+   Q++ +L  + GD + +LE++  +W++G+ +G++GIFP NYV P  
Sbjct: 231 IRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPII 287

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 43  NPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRV 100
           N S+ ++  ++ +L    ALY FD ++ GDL  + GD + +++K     +W+ G CNG  
Sbjct: 398 NTSTLSQRQTNNNLPKAVALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEE 457

Query: 101 GIFPANYVK 109
           GIFPANYV+
Sbjct: 458 GIFPANYVE 466

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYV 108
           +  AS E V ALY+F  +Q GDL  + GDK+ +L++     +W+ G  NG+ GIFPANYV
Sbjct: 373 SGHASNEAV-ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYV 431

Query: 109 K 109
           +
Sbjct: 432 E 432

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 39/59 (66%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
           +++ +  V ALY  +  +  +L  + GD + +LE++  +W++GS +G++GIFP NYV P
Sbjct: 210 TTSGIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%)

Query: 38  LPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCN 97
           LP + N  SA   +    ++ V ALY     +  +L  + GD + +LE++  +W+KG+  
Sbjct: 196 LPQQRNQPSAHTTSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALR 255

Query: 98  GRVGIFPANYVKP 110
           G++GIFP NYV P
Sbjct: 256 GKMGIFPLNYVTP 268

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 40/63 (63%), Gaps = 3/63 (4%)

Query: 49  RDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPAN 106
           RD SS + + V ALY F  ++ GDL  + GD + +++K   +  W+ G  NGR GIFPAN
Sbjct: 374 RDASSGAPKAV-ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPAN 432

Query: 107 YVK 109
           YV+
Sbjct: 433 YVE 435

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 43  NPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRV 100
           +PS+ +R  SS + + V ALY F  +Q GDL  + GD + +L+K     +W+ G  NG+ 
Sbjct: 330 SPSAHSRTASSGAPKAV-ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQE 388

Query: 101 GIFPANYVK 109
           GIFPANYV+
Sbjct: 389 GIFPANYVE 397

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 3/63 (4%)

Query: 49  RDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPAN 106
           R TSS + + V ALY F+ +Q GDL  + GD + +L+K     +W+ G  NG+ GIFPAN
Sbjct: 154 RSTSSGAPKAV-ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPAN 212

Query: 107 YVK 109
           YV+
Sbjct: 213 YVE 215

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           ALY F  +Q GDL  K GD + +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 40/63 (63%)

Query: 48  ARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANY 107
           A+ ++ A +  V A+Y    ++  +L  + GD + +LE++  +W++G+  G+VGIFP NY
Sbjct: 217 AKSSAPAVIRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNY 276

Query: 108 VKP 110
           V P
Sbjct: 277 VTP 279

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 51  TSSAS----LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPAN 106
           TS+AS    +  V A+Y     +  +L  + GD + +LE++  +W+KG+  GR+GIFP N
Sbjct: 214 TSAASGQSVVRRVRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLN 273

Query: 107 YVKP 110
           YV P
Sbjct: 274 YVTP 277

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%), Gaps = 3/61 (4%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYV 108
           T+SA+   V ALY F  +Q GDL  K GD + +L+K     +W+ G  NG+ GIFPANYV
Sbjct: 407 TNSATPTAV-ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYV 465

Query: 109 K 109
           +
Sbjct: 466 R 466

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           ALY F  +Q GDL  K GD + +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           ALY F  +Q GDL  K GD + +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 44  PSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVG 101
           P  + R  +S+      ALY F  +Q GDL  + GD V +L+K     +W+ G  NG+ G
Sbjct: 359 PPVSRRSPASSGAPKAVALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEG 418

Query: 102 IFPANYVK 109
           IFPANYV+
Sbjct: 419 IFPANYVE 426

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYV 108
           +SS++     ALY F  ++ GDL  + GD + +L+K     +W+ G  NGR GIFPANYV
Sbjct: 397 SSSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 456

Query: 109 K 109
           +
Sbjct: 457 E 457

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPA 111
           S+A  + V+ALY     +  +L  K GD + +LE++  +W++GS  G +GIFP NYV P 
Sbjct: 225 SAAPPKRVKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 35/55 (63%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
           ++ V A+Y     +  +L  K GD + ++E++  +W++G+  GRVGIFP NYV P
Sbjct: 230 IKRVRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTP 284

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  K GD + +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  + GD + +L+K     +W+ G  NGR GIFPANYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  + GD + +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 43  NPSSAARDTSSA-SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVG 101
           +P    R TS    ++ V A+Y  +  +  +L    GD + ++E++  +W++G+  G+VG
Sbjct: 214 HPGQEQRHTSQLFQVKKVRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVG 273

Query: 102 IFPANYVKPA 111
           IFP NYV P 
Sbjct: 274 IFPLNYVTPC 283

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
           SS++     ALY F  ++ GDL  + GD + +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 372 SSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
           V A+Y     +  +L  K GD + +LE++  +W+KG+  G +GIFP NYV P
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTP 291

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  + GD + +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  + GD + +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 37  SLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKG 94
           S+P  +  S+     S+ + E V ALY++  Q +GDL    G  ++++++ +   EW+ G
Sbjct: 416 SVPPSYT-SATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTG 474

Query: 95  SCNGRVGIFPANYVK 109
             NG+ G+FP NYVK
Sbjct: 475 KYNGQQGVFPGNYVK 489

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 47  AARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFP 104
           AA  + S S     AL+ F  ++ GDL  + GD V +L+K   +  W+ G  NGR GIFP
Sbjct: 389 AAPTSPSTSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFP 448

Query: 105 ANYVK 109
           ANYV+
Sbjct: 449 ANYVE 453

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPA 111
           ++  V AL+    ++  +L  + GD + ++E++  +W++G   GRVGIFP NYV P 
Sbjct: 213 TVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPV 269

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 35/56 (62%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPA 111
           +  V A+Y F+  +  +L  K GD + ++E++  +W++G+  G VGIFP NYV P 
Sbjct: 224 IRKVRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPV 279

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
           V ALY     +  +L  + GD + +LE++  +W+KG+  G +GIFP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 45  SSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKL-SPEWYKGSCNGRVGIF 103
           SS+A   ++A+ E   ALY F  Q DGDL       +++L++  +  W+ G  NGR G+F
Sbjct: 320 SSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLF 379

Query: 104 PANYV 108
           PANYV
Sbjct: 380 PANYV 384

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%)

Query: 44  PSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIF 103
           P    R+T + +++ V A+Y  +     +L  +  D + ++E+   +W+ GS   RVGIF
Sbjct: 204 PEVTKRETGTNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIF 263

Query: 104 PANYVKP 110
           P NYV P
Sbjct: 264 PLNYVTP 270

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 32  DQINKSLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP-- 89
           D+ + S P    PS      SS++ + + ALY F  ++ GDL  K GD + +L+K     
Sbjct: 369 DRDSHSRPAAEKPSFGGTRQSSSTPKAI-ALYSFAGEESGDLRFKKGDVITILKKSDSQD 427

Query: 90  EWYKGSCNGRVGIFPANYVK 109
           +W+ G  N   GIFPANYV+
Sbjct: 428 DWWTGRVNTSEGIFPANYVE 447

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  + GD + +++K   +  W+ G  NG+ GIFPANYV+
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVE 421

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  + GD + +L+K   +  W+ G  +GR GIFPANYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 48  ARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPA 105
           A   ++  +E V ALY +  Q  GDL    G  ++++E+ S   EW+ G  NG+ G+FP 
Sbjct: 392 AGSMAAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPG 451

Query: 106 NYVK 109
           NYV+
Sbjct: 452 NYVQ 455

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 34/52 (65%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
           V AL+    +   +L  + GD ++++E++  +W++GS  G++GIFP NYV P
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTP 280

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           E V ALY F  +Q GDL  K GD + +++K     +W+ G    + GIFPANYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           ALY F  ++  DL  + GD + +L+K     +W+ G  NGR GIFPANYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 45  SSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGI 102
           S +A DT S + + V ALY F  ++ GDL  + GD + +L+K     +W+ G   GR GI
Sbjct: 402 SPSAGDTFSNTPKAV-ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGI 460

Query: 103 FPANYVK 109
           FPANYV+
Sbjct: 461 FPANYVE 467

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 35  NKSLPVRWNPSSAARDTSSAS------LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLS 88
           N   P +  P++ A +TS         +  V+A++  +  +  +L  K GD + ++E++ 
Sbjct: 185 NGGQPPQQAPAALASETSLPEQPQPQIVRRVKAIFDLNASEPDELSFKKGDVITVIEQVY 244

Query: 89  PEWYKGSCNGRVGIFPANYV 108
            +W++G   G+VGIFP NYV
Sbjct: 245 KDWWRGLLRGKVGIFPVNYV 264

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
           V ALY     +  +L  +  D + +LE++  +W+KG+  G++GIFP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           ALY F  ++ GDL  + GD + +++K     +W+ G  +GR GIFPANYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           AL++F  +Q GDL    GD V +L+K     +W+ G  N + GIFPANYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYV 108
           T++ + EY  +LY++  Q  GDL    G  +Q++++ +   +W+ G  NG+ G+FP NYV
Sbjct: 394 TTAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYV 453

Query: 109 K 109
           +
Sbjct: 454 Q 454

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
           ALY F  +++GDL  K GD + ++++   +  W+ G+ NG+ G+FPANYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 4/60 (6%)

Query: 53  SASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP---EWYKGSCNGRVGIFPANYVK 109
           +A  E V ALY++  Q  GDL    G  ++++E+ +P   EW+ G  NG+ G+FP NYV+
Sbjct: 401 TAGGETVTALYEYQAQAAGDLSFPAGAVIEIVER-TPDVNEWWTGRYNGQQGVFPGNYVQ 459

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 58  YVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC---NGRVGIFPANYVK 109
           Y +ALY F +P ++  L  + GD + L EKL+ +WY G     NGR G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKP 110
           V ALY     +  +L    GD + +LE++  +W++G+  G  GIFP NYV P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPA 111
           V ALY        +L  K GD + +LE++  +W+KG    + GIFP NYV P 
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
            +E V ALY++  Q  GDL    G  ++++++ + E  W+ G  NG+ G+FP NYV+
Sbjct: 382 GMETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 41  RWNPSSAARDTSSAS-----LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYK 93
           ++ P+  A+    A+     +E V ALY +  Q  GDL    G  ++++++ +   EW+ 
Sbjct: 438 QYTPTPTAQPGMGAAPMPTGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWT 497

Query: 94  GSCNGRVGIFPANYVK 109
           G  NG+ G+FP NYV+
Sbjct: 498 GRYNGQQGVFPGNYVQ 513

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKL--SPEWYKGSCNGRVGIFPANYVK 109
           S+E V ALY +  Q  GDL       ++++++   + EW+ G  +G+VG+FP NYV+
Sbjct: 399 SVETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKL--SPEWYKGSCNGRVGIFPANYVK 109
           E V ALY +  Q  GDL    G  ++++++   + EW+ G  NG+ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGRVGIFPANYVK 109
            +E V ALY +  Q +GDL    G  ++++E+ +    W+ G  NG+ G+FP NYV+
Sbjct: 408 GVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP---EWYKGSCNGRVGIFPANYVK 109
           E V ALY +  Q  GDL    G  ++++++ +P   EW+ G  NG+ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP---EWYKGSCNGRVGIFPANYVK 109
           +E V ALY +  Q  GDL    G  ++++++ +P   EW+ G  NG+ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 464

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP---EWYKGSCNGRVGIFPANYVK 109
           E V ALY +  Q  GDL    G  ++++++ +P   EW+ G  NG+ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKL-SPEWYKGSCNGRVGIFPANYVK 109
           +SA +E   ALY +  Q +GDL    G  +Q++++  +  W+ G  NG  G+FP NYV+
Sbjct: 366 TSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYV 108
           S   V ALY F+ QQ GDL  K  D + + +K     +W+ G  +G  G+FPANYV
Sbjct: 333 SFPKVRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 42  WNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE--WYKGSCNGR 99
           + P + A    +++ E V ALY +  Q +GDL    G  ++++E+ +    W+ G  NG 
Sbjct: 366 YTPPTTA---PASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGY 422

Query: 100 VGIFPANYVK 109
            G+FP NYV+
Sbjct: 423 QGVFPGNYVQ 432

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYV 108
           T+  +   V ALY +  Q  GDL    G  ++++++     EW+ G  NG+ G+FP NYV
Sbjct: 409 TAPPAANTVTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYV 468

Query: 109 K 109
           +
Sbjct: 469 Q 469

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE---WYKGSCNGRVGIFPANYVK 109
           E V ALY +  Q +GDL    G  ++++E+ +P+   W+ G  NG  G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYV 108
           +++   E   +LY++  Q  GDL    G  ++++E+ +   EW+ G  NG+ G+FP NYV
Sbjct: 407 SAAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYV 466

Query: 109 K 109
           +
Sbjct: 467 Q 467

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 41/82 (50%), Gaps = 9/82 (10%)

Query: 33  QINKSLPVRW-NPSSAARDTSSASLEYVEALYQFDPQQDGD-LGLKPGDKVQLLEKLSPE 90
           Q  KS+ + W   +S  R      + Y  A+Y F    D D L  + GD + L EKL+ +
Sbjct: 603 QRTKSVAMEWPKVTSKGRRV----IGYARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTD 658

Query: 91  WYKGSC---NGRVGIFPANYVK 109
           WY G     NG+ G+ P NYV+
Sbjct: 659 WYIGEVHNGNGKQGLIPMNYVE 680

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCNGRVGIFPANYVK 109
           S+  +  +EA+Y ++ Q D ++ + PGD + ++       W  G C+G  G+FP +Y K
Sbjct: 575 STLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLLEK-LSPEWYK--GSCNGRVGIFPANYVK 109
           + LY +  + D ++ + PGDK+ L+ +     W K      G  G+ P  Y++
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIR 551

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 53  SASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE-WYKGSCNGRVGIFPANYV 108
           +A L+ V A+Y +  Q D ++ ++ GD +++L   +   W  G  NG  G+FP+NY 
Sbjct: 569 AAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSP--EWYKGSCNGRVGIFPANYVK 109
           AL+ F   + GDL  K GD + ++++     +W+ G  N R G+FPANYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 38  LPVRWNPSSAARDTSSASL---EYVEALYQFDPQQDGDLGLKPGDKVQLLEKL-SPEWYK 93
           +P  ++PS     T+ ++    E   +LY F  Q   DL       +++L++  S  W+ 
Sbjct: 342 MPPAYSPSPYTAYTTPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWT 401

Query: 94  GSCNGRVGIFPANYVK 109
           G  NG+ G+FP NYV+
Sbjct: 402 GRYNGQEGLFPGNYVR 417

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 53  SASLEYVEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCNGRVGIFPANYVK 109
           +AS+  VEA+Y ++   D +L +  G+ ++++       W  G  NG  G+FP++Y K
Sbjct: 580 TASIRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE-WYKGSCNGRVGIFPANYVK 109
           V+AL+ ++ Q D ++ ++ GD + +L+      W  G  NG+ G+FP NY +
Sbjct: 571 VKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNYCQ 622

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 62  LYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY---KGSCNGRVGIFPANYVK 109
           L+Q+  Q + ++ + PG+ + LL   S   +   K    G  G+ P +Y++
Sbjct: 496 LFQYQKQDNDEVSVSPGNAISLLTADSGSGWTRIKNDSTGEAGLVPTSYIE 546

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 33  QINKSLPVRWNPSSAARDTSSASLEYVEALYQFDPQQ-DGDLGLKPGDKVQLLEKLSP-- 89
           ++  S  +R +  + +     + LE+  ALY F P+  + ++ LK GD + +L K  P  
Sbjct: 285 KLQTSGTIRASQGNGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLG 344

Query: 90  ---EWYK-GSCNGRVGIFPANYVK 109
              +W+K  + NG +G  P NY++
Sbjct: 345 RDSDWWKVRTKNGNIGYIPYNYIE 368

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 58  YVEALYQF--DPQQDG---DLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           Y  ALY +  DP Q G   DL  K GD +++++K    W+ G      R G FP N+V+
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC---NGRVGIFPANYVK 109
           ++YV+A+Y + +P ++  L    GD + L+E ++ +WY G     N + G+ P NYVK
Sbjct: 547 VKYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCNGRVGIFPANYVK 109
           S+  +  +EA+Y ++ Q D ++ +  GD + ++       W  G C+G  G+FP +Y K
Sbjct: 575 STLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLLEK-LSPEWYK--GSCNGRVGIFPANYVK 109
           + LY +  Q D ++ + PGD++ L+ +     W K      G  G+ P  Y++
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIR 551

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCNGRVGIFPANYVK 109
           S+  +  +EA+Y ++ Q D ++ +  GD++ ++       W  G C+G  G+FP +Y +
Sbjct: 575 STLPVRTMEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLLEK-LSPEWYK--GSCNGRVGIFPANYVK 109
           + LY +  Q D ++ + PGDK+ L+ +     W K      G  G+ P  Y++
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIR 551

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 7/63 (11%)

Query: 54  ASLEYVEALYQFDPQQ-DGDLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPAN 106
           + LE+  ALY F P+  + ++ LK GD + +L K  P     +W+K  + NG +G  P N
Sbjct: 308 SKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYN 367

Query: 107 YVK 109
           Y++
Sbjct: 368 YIE 370

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY-----KGSCNGRVGIFPANYVKPA 111
           V A Y ++   DGDL  + G +++++     +WY      G+ N + GIFP NYV+ A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 39.3 bits (90), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 12/63 (19%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLS-PEWYKGSCNGRV---------GIFPANYV 108
           V+ALY ++PQ D +L +K  D + LLEK    EW+  +   RV         G+ P+NYV
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWW--TVKKRVIGLDAEEPTGLVPSNYV 65

Query: 109 KPA 111
           +PA
Sbjct: 66  EPA 68

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 33  QINKSLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDG-DLGLKPGDKVQLLEKLSP-- 89
           ++  S  ++ +  S +     + LE+  ALY F P+    ++ L  GD + +L K  P  
Sbjct: 302 KVQNSGAIQISKGSGSEPIDPSKLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIG 361

Query: 90  ---EWYK-GSCNGRVGIFPANYVK 109
              +W+K  + NG++G  P NY++
Sbjct: 362 KNSDWWKVRTKNGKIGYIPYNYIE 385

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 54  ASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE----WYKGSCNGRVGIFPANYVK 109
           +S+  +EALY +  Q D +L +  G  V++L+   P+    W  G  +G  G+FP +Y K
Sbjct: 569 SSVRTIEALYDYQAQGDDELSIYAGSVVKVLK---PDDGSGWTYGELDGAKGLFPTSYCK 625

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY---KGSCNGRVGIFPANYV 108
            LY +  Q   ++ + PGD + L+ K +   +   K S  G +G+ P++YV
Sbjct: 499 VLYPYAKQDADEVTINPGDLISLVTKDTGSGWTKIKNSTTGEMGLVPSSYV 549

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 33  QINKSLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEW 91
           +IN++  ++  P       ++     ++A Y ++ Q D +L L P D V ++       W
Sbjct: 536 EINEAAKIKEAPKVPPPRRTNMPTRTMQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGW 595

Query: 92  YKGSCNGRVGIFPANYVK 109
             G  NG  G+FP +Y +
Sbjct: 596 TYGELNGEKGLFPTSYCR 613

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPE-WYKGSCNGRVGIFPANYVK 109
           VEA+Y +  Q + +  L  GD + +L+      W  G  NG  G+FP +Y K
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 62  LYQFDPQQDGDLGLKPGDKVQLL-EKLSPEW--YKGSCNGRVGIFPANYV 108
           LY +  Q D ++ + PGD + LL       W   K    G+ G+ P  YV
Sbjct: 496 LYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYV 545

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 7/62 (11%)

Query: 55  SLEYVEALYQFDPQQDG-DLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPANY 107
           +LE+  A+Y F P+    +  LK GD + ++ KL P     +W+K  +  G VG  P+NY
Sbjct: 313 NLEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNY 372

Query: 108 VK 109
           ++
Sbjct: 373 IE 374

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           A Y ++  +D +L  K GD++  +E +  +W+ G     G  G+FP+NYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 7/63 (11%)

Query: 54  ASLEYVEALYQFDPQ-QDGDLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPAN 106
           ++LE+  AL+ F+P+ +  +L L  GD + +L K  P     +W+K  + NG  G  P+N
Sbjct: 304 SNLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSN 363

Query: 107 YVK 109
           Y++
Sbjct: 364 YIE 366

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCNGRVGIFPANYVK 109
           V+ALY ++ Q D ++ +  GD + +++      W  G  NG  G+FP++Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 54  ASLEYVEALYQFDPQQ-DGDLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPAN 106
           + LE+  ALY F P+    ++ LK GD + +L K  P     +W+K  + NG +G  P N
Sbjct: 312 SKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYN 371

Query: 107 YVK 109
           Y++
Sbjct: 372 YIE 374

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           A Y +D  +D +L    GDK+  +E +  +W+ G     G  G+FP+NYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           A Y ++  +D +L  +  DK+  +E +  +W+ G    NG  G+FP+NYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCNGRVGIFPANYVK 109
           +EA Y ++ + D ++ +  GD + ++       W  G C+G  G+FP +Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLLEKLSPE-WYK--GSCNGRVGIFPANYVK 109
           + LY +  Q   ++ + PGDK+ L+ + S   W K      G  G+ P  YV+
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 35.4 bits (80), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--VGIFPANYV 108
           ALY F P+ D +LGL+ GD V +  K    W      GR   G+ P  +V
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV 156

>SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain-containing protein
           required for cytokinesis
          Length = 633

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNG--------RVGIFPAN 106
           ++Y +ALY + +P ++  +  +  D + L ++L+ +WY G            R G+ PAN
Sbjct: 568 IKYAKALYTYMEPNENNLVNFRVDDYILLTKRLNQDWYLGEVYNAGGIEDRYRCGLVPAN 627

Query: 107 YVK 109
           Y++
Sbjct: 628 YIE 630

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 35.4 bits (80), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 55  SLEYVEALYQFDPQQDG-DLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPANY 107
           SLE+  A+Y F P+    +L LK GD + ++ K  P     EW++  +  G +G  P NY
Sbjct: 306 SLEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPYNY 365

Query: 108 VK 109
           ++
Sbjct: 366 LE 367

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 35.4 bits (80), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 55  SLEYVEALYQFDPQQDG-DLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPANY 107
           SLE+  A+Y F P+    +  LK GD + ++ +  P     +W+K  +  G VG  P NY
Sbjct: 313 SLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVPCNY 372

Query: 108 VK 109
           ++
Sbjct: 373 IE 374

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 35.4 bits (80), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG--SCNGRVGIFPANYV 108
           A Y +D  +D +L  +  DK+  +E +  +W+ G     G  G+FP+NYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 35.8 bits (81), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 61  ALYQFDPQQ--DGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYVKP 110
           ALY +D  Q  D +L  K  D   L +   P+W   +   +G VG  P NYV+P
Sbjct: 76  ALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEP 129

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 35.4 bits (80), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLL-EKLSPEWYKGSCNGRVGIFPANYV 108
           A Y +  Q   +L L+ GDK+++L E     W  G  NG  G+FP  Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 35.4 bits (80), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG--SCNGRVGIFPANYV 108
           +L    A Y +D  +D +L    G K+  +E +  +W+ G     G  G+FPANYV
Sbjct: 469 ALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 35.4 bits (80), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           +  A Y +D  ++ +L     DK+  +E +  +W+ G    NG  G+FP+NYV
Sbjct: 559 WATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRV-GIFPANYVK 109
           V+A Y +  Q  GDLG   GD V  + K++ +WY G    N +  G FP N+VK
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGD-VMEVTKITGDWYYGRLLRNRKCSGYFPNNFVK 67

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--VGIFPANYV 108
           ALY F+P+ D +LGLK  D V +  K    W       R   G+ P  YV
Sbjct: 111 ALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYV 160

>KAFR0E03160 Chr5 complement(632974..634638) [1665 bp, 554 aa] {ON}
           Anc_8.539 YBR200W
          Length = 554

 Score = 35.4 bits (80), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 22  ESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKV 81
           ++ ++    F+ INK+  +  NP S   +T +    Y   LY F  ++  +L    G+ +
Sbjct: 115 QNGIVPKQYFEAINKTSRIVCNPVSVNSNTGNLGSLYAIVLYDFKAEKSDELSSFVGENL 174

Query: 82  QLLEKLSPEWYKGSCNGRV---GIFPANYV 108
            +    + EW+     GR+   G+ P  +V
Sbjct: 175 FICAHHNYEWFIAKPIGRLGGPGLVPVGFV 204

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 32.0 bits (71), Expect = 0.11,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 90  EWYKGSCNGRVGIFPANYVK 109
           EW+ G  NG+ G+FP NYV+
Sbjct: 20  EWWTGRYNGQQGVFPGNYVQ 39

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           +  A Y +D  +D +L     DK+  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--------NGRVGIFPAN 106
           +EY +A+Y     +  G      GD + + E ++ +WYKG          N RVG+ P N
Sbjct: 595 IEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYN 654

Query: 107 YVK 109
           +++
Sbjct: 655 FIQ 657

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--------NGRVGIFPAN 106
           L+Y +ALY F +  +   +  + GD + L E+L  +W+ G            R GI P N
Sbjct: 562 LKYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYRYGIIPRN 621

Query: 107 YVK 109
           Y++
Sbjct: 622 YIE 624

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR-----VGIFPANYVK 109
           V A+  ++PQ   DL +  GDK+ +L      WY G    +      GIFP+++VK
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           +  A Y +D  +D +L     DK+  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  LEYVEALYQFDPQQDG-DLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPANYV 108
           LE+  A+Y F P+    ++ L+ GD + +L K        +W+K  + NG VG  P NY+
Sbjct: 259 LEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYI 318

Query: 109 K 109
           +
Sbjct: 319 E 319

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F+P+ D +LGLK GD + +  +    W   +     + G+ P  +V
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFV 150

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 58  YVEALYQFDPQQDGD--LGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           Y  ALY +DPQ +    L +K GD +Q++ +    W+ G        G+FP +YV+
Sbjct: 353 YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTKGLFPQSYVQ 408

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 45  SSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGS--CNGRVGI 102
           S  ++D SS   + ++ALY +  Q  G+L    GD   + ++ + +WY+ S   +G+ G+
Sbjct: 55  SGKSKDISSPE-KVIKALYNYQAQSAGELSFNKGDFFHVQQEEN-DWYEASNPADGKRGM 112

Query: 103 FPANY 107
            P NY
Sbjct: 113 VPKNY 117

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           +  A Y +D  +D +L     DK+  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 37  SLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG-- 94
           SLP R N  +    +  A      A Y ++  +D +L     DK+  +E +  +W+ G  
Sbjct: 501 SLPSREN--ATEEPSKPAGGATAIAQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGEL 558

Query: 95  SCNGRVGIFPANYVK 109
             +G  G+FP+NYV+
Sbjct: 559 ESSGEKGLFPSNYVE 573

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRV-GIFPANYV 108
           V A Y +  Q  GDLG   GD V  ++K++ +W+ G+   N +  G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGD-VMEVKKITGDWFYGTLLRNKKCSGYFPKNFV 61

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           A Y ++  ++ +L    GDK+  +E +  +W+ G     G  G+FP+NYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>KAFR0B05060 Chr2 (1043706..1045295) [1590 bp, 529 aa] {ON}
           Anc_2.382 YDL085W
          Length = 529

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 45/109 (41%), Gaps = 17/109 (15%)

Query: 6   INRSLTTIRTELD------FLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYV 59
           I   L TI  E+D       +KE N   SD  + I   + V W   +A RD   + +  +
Sbjct: 326 IQLKLNTIVKEVDSNYLKGLIKEQN---SDHMEHIPYGVLV-WATGNAPRDICQSLMSKL 381

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYV 108
           +       QQD   GL   DK+QLL      +  G C    G+FP   V
Sbjct: 382 K-------QQDSRRGLLINDKLQLLGAEDSIFAIGDCTFHPGLFPTAQV 423

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 26  ISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE--ALYQFDPQQDGDLGLKPGDKVQL 83
           I++   D  N SL +  + S+    TS+ + +Y     + ++  + D +L +KPGDK+Q+
Sbjct: 17  ITNSTNDDSNLSLDMDLSTSTQENLTSTPTKKYPMYIVINEYTKRMDDELDMKPGDKIQV 76

Query: 84  L---EKLSPEWYKGSC--NGRVGIFPANYVK 109
           +   E+ +  WY G     G  G++P  + +
Sbjct: 77  ITDDEEYNDGWYFGKNLRTGEEGLYPVVFTQ 107

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 58  YVEALYQFDP---QQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           Y  AL+ ++P    Q  DL  +  + +++++K    W+ G      + G FPANYV+
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVE 455

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 54  ASLEYVEALYQFDPQQDGDLGLKPGDKVQLL-EKLSPEWYKGSCNGRVGIFPANYV 108
            SL  V A+Y +  +   ++ ++ GD ++++ +     W  G   G  G+FP+NY 
Sbjct: 616 TSLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           +  A Y +D  +D +L     DK+  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 47  AARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG-SCNGRV----- 100
           AAR  S+  ++ V A   F P +   L L  GD V +L K    W+ G +  GR      
Sbjct: 15  AARAGSTRPVDVVVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSPQRVA 74

Query: 101 -GIFPANYVK 109
            G FP N+ +
Sbjct: 75  RGWFPHNFTR 84

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  LEYVEALYQFDPQQ-DGDLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPANYV 108
           LE+  A+Y F P+    +  L+ GD + ++ K  P     EW++  +  G VG  P+NYV
Sbjct: 310 LEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYV 369

Query: 109 K 109
           +
Sbjct: 370 E 370

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG---SCNGRV--GIFPANYVK 109
           ++ V A++ ++ +   +L L+ GD + ++ K    W+ G     NG+V  G FP NY +
Sbjct: 48  VDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCR 106

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           A Y +D  ++ +L     DK+  +E +  +W+ G    NG  G+FP+NYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 7/53 (13%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPE----WYKGSCNGRVGIFPANYVK 109
           ALY ++ Q D ++ L  GD +++++   P+    W  G  N +  +FP +Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVIK---PDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 32.3 bits (72), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLLEK-LSPEWYK--GSCNGRVGIFPANYVK 109
           + LY +    D ++ + PGD + ++EK     W K      G +G+ P++Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCN--GRVGIFPANYV 108
           +  A Y ++  +D +L  +  DK+  +E +  +W+ G     G  G+FP+NYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 396

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 50  DTSSASLEYVEALYQFDPQQDG-DLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGI 102
           +   + LE+  ALY F P+    +  LK G+ + ++ K  P     EW+K  +  G +G 
Sbjct: 307 EVDPSKLEFARALYDFTPENPQIEAPLKKGELMAIITKQHPSGNNSEWWKVRTKTGNMGY 366

Query: 103 FPANYVK 109
            P NYV+
Sbjct: 367 VPFNYVE 373

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--VGIFPANYVK 109
           A+Y F P+ D +L LK GD V +  K    W     + R   G+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           V+A+Y +  +++ DLG    D +++  K    WY G    N + G FPANYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--VGIFPANYV 108
           A+Y F P+ D +L LK GD V +  K    W       R   G+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG-SCNG-RVGIFPANYV 108
           V ALY F P+ D +L LK GD + +  K    W    + +G R G+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--------NGRVGIFPAN 106
           +EY +A+Y     +  G      GD + + E ++ +WYKG          N R+G+ P N
Sbjct: 601 IEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYN 660

Query: 107 YVK 109
           +++
Sbjct: 661 FIQ 663

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 32.7 bits (73), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--VGIFPANYV 108
           ALY F+P+ D +LGL  GD V +  +    W       R   G+ P  +V
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFV 166

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 70  DGDLGLKPGDKVQLLEKLSPEWYKG-SCNGRV---GIFPANYVKP 110
           D  L   PGDK+ +L K    W+ G   +G+V   G FP ++VKP
Sbjct: 50  DTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKP 94

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 59  VEALYQF--DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
           V+ALY +  D     +L  + GD +++ +     W     NG+ GI P+NYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 44  PSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG--SCNGRVG 101
           P  +A         +  A Y ++  +D +L     DK+  +E +  +W+ G    +G  G
Sbjct: 524 PRRSAEPEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKG 583

Query: 102 IFPANYV 108
           +FP+NYV
Sbjct: 584 LFPSNYV 590

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 54  ASLEYVEALYQFDPQQ-DGDLGLKPGDKVQLLEK-----LSPEWYK-GSCNGRVGIFPAN 106
           + LE+  ALY F P+    ++ LK GD + ++ K        EW+K  + +G +G  P N
Sbjct: 306 SKLEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVPFN 365

Query: 107 YVK 109
           Y++
Sbjct: 366 YIE 368

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVKPA 111
           ++ALY +  Q  G+L    G+ V ++ +   EW++ S   +GR G+ P +Y +P 
Sbjct: 69  LKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSYFEPV 122

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRV-GIFPANYVKP 110
           V A Y +  Q  GDLG   GD +++  +++ +W+ G    N +  G FP N+V P
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEVT-RVAGDWFYGRLLRNKKCAGYFPNNFVIP 66

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 64  QFDPQQDGDLGLKPGDKVQLL---EKLSPEWYKGSC--NGRVGIFPANYVKP 110
           ++  + + ++ +KPGDK+++L    +    WY+G      +VG++PA + +P
Sbjct: 10  EYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLL---EKLSPEWYKGSC--NGRVGIFP 104
           A+  +  + + ++ +KPGDK+Q++   E  +  WY G     G+ G+FP
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFP 81

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLS---PEWYKGS--CNGRVGIFPANYVK 109
           A+ ++  + D +L + PGDK+Q+L   S     WY G        G++P N+ +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQ 79

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 58  YVEALYQFDPQQDGD--LGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           Y   LY ++PQ +    L +K GD +Q++ +    W+ G        G+FP +YV+
Sbjct: 361 YATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLRTKTKGLFPQSYVQ 416

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 32.3 bits (72), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           A Y ++  +D +L  + GD +  ++ +  +W+ G     G+ G+FP+NYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 8/67 (11%)

Query: 53  SASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLS-PEWYK------GS-CNGRVGIFP 104
           +A L   +A++Q++PQ D +L +  GD + LL+K    +W+       GS     VG+ P
Sbjct: 2   TAFLGIYKAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVP 61

Query: 105 ANYVKPA 111
            NY++ A
Sbjct: 62  NNYIEEA 68

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query: 17  LDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLK 76
           L+    +     ++ D I +      +P     + ++ S +     Y F  +   +L +K
Sbjct: 308 LELHTGNTTTCEEIMDIIGEYKGASRDPGLKEVEMATKSKKRGVVQYDFLAESQDELTIK 367

Query: 77  PGDKVQLL-EKLSPEWYKGSC--NGRVGIFPANYVKP 110
            GDKV +L +K S +W+      +G+ G+ PA +V+P
Sbjct: 368 SGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEP 404

>SAKL0E05302g Chr5 complement(431939..433546) [1608 bp, 535 aa] {ON}
           highly similar to uniprot|P40215 Saccharomyces
           cerevisiae YMR145C NDE1 Mitochondrial external NADH
           dehydrogenase
          Length = 535

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 7/67 (10%)

Query: 42  WNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVG 101
           W   +A RD S + +  +E       +Q+   GL   +K+QLL      W  G C    G
Sbjct: 354 WATGNAPRDVSKSLMSQLE-------EQNSRRGLLINEKLQLLGAHESIWAIGDCTFYPG 406

Query: 102 IFPANYV 108
           +FP   V
Sbjct: 407 LFPTAQV 413

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRV-GIFPANYV 108
           V+A Y +  Q  GDLG   GD V  + +++ +W+ G    N +  G FP N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGD-VMEVTRITGDWFYGKLLRNKKCSGYFPNNFV 64

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           A Y  + ++  +L  K GDK+  +  +  +W+ G     G  G+FP+NYV+
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 51  TSSASLEYVEALYQFDP--QQDGDLGLKPGDKVQLLEKLSPEWYKG------SCNGRVGI 102
           T+   ++ V   ++F+   +++  L ++PGD V +L K    W+ G      S     G 
Sbjct: 14  TTVYPMDVVVVQFEFNAGNKKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGW 73

Query: 103 FPANYVKP 110
           FP NY KP
Sbjct: 74  FPQNYTKP 81

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 44  PSSAARDTSSASL----EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG---SC 96
           PS     +S ++L    + V A Y + P +   L L  GD V +L K    W+ G     
Sbjct: 7   PSHEETGSSGSTLVRPVDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDS 66

Query: 97  NGRV--GIFPANYVK 109
           N +   G FP NY K
Sbjct: 67  NNKASRGWFPCNYSK 81

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--------NGRVGIFPAN 106
           +EY +A+Y     +  G      GD + + E ++ +WYKG          + RVG+ P N
Sbjct: 601 IEYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYN 660

Query: 107 YVK 109
           +++
Sbjct: 661 FIQ 663

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F+P+ D +L L  GD V +  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON}
           Anc_8.344 YDR162C
          Length = 264

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F+P+ D +LGL  GD V +  +    W   +     + G+ P  +V
Sbjct: 121 ALYDFEPENDNELGLTEGDIVYISYRHGQGWLVAENQEGTKTGLVPEEFV 170

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG---SCNGRVGIFPANYV 108
           V+A Y +  Q  GDLG   GD +  + K + +WY G         G FP N+V
Sbjct: 7   VKARYGWSGQAKGDLGFLEGD-IMNVTKTTGDWYYGFLLRNKKSKGYFPKNFV 58

>CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191w PAS20
          Length = 391

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 54  ASLEYVEALYQFDPQQ-DGDLGLKPGDKVQLLEKLSP-----EWYK-GSCNGRVGIFPAN 106
           + LE+  ALY F P+    ++ LK GD V ++ K  P     +W+K  +  G+ G  P N
Sbjct: 314 SKLEFARALYDFTPENPQIEITLKKGDLVAIISKADPLGRSSDWWKVRNRAGQNGYAPYN 373

Query: 107 YVK 109
           Y++
Sbjct: 374 YLE 376

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 48  ARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGS--CNGRVGIFPA 105
           ++D SS   + ++A+Y +  Q  G+L    GD   +L +   EWY  S   +G+ G+ P 
Sbjct: 61  SKDISSPE-KVIKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMVPK 118

Query: 106 NY 107
           +Y
Sbjct: 119 SY 120

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           V ALY +  +Q  DLG    D ++ + K+  +W  G    N + G FP  YV+
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIE-VTKVKGDWLYGRLLRNKKTGYFPLGYVQ 63

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F+P+ D +L L  GD V +  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>KLLA0E21891g Chr5 (1954118..1955761) [1644 bp, 547 aa] {ON} similar
           to uniprot|P40215 Saccharomyces cerevisiae YMR145C NDE1
           Mitochondrial external NADH dehydrogenase
          Length = 547

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 7/67 (10%)

Query: 42  WNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVG 101
           W   +A R+ S   +  +E       QQ+   GL   DK+QLL      W  G C    G
Sbjct: 366 WATGNAPREVSKNLMAKLE-------QQNSRRGLLINDKMQLLGAEDSIWAIGDCTFFPG 418

Query: 102 IFPANYV 108
           +FP   V
Sbjct: 419 LFPTAQV 425

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYV 108
           A Y ++  ++ +L     DK+  ++ +  +W+ G    NG  G+FP+NYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 9/69 (13%)

Query: 49  RDTSSASLEYVEALYQFD--PQQDGDLGLKPGDKVQLL-EKLSPEWYKGSC----NGRVG 101
           R+   AS      + Q+D   +   +L +K GDKV +L +K S +W+   C    +G+ G
Sbjct: 346 REVEMASKSKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWM--CQLVDSGKSG 403

Query: 102 IFPANYVKP 110
           + PA +++P
Sbjct: 404 LVPAQFIEP 412

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 63  YQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSC--NGRVGIFPANYVKP 110
           Y F  +   +L +K GDKV +L+ K S +W+      +G+ G+ PA +++P
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEP 405

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 63  YQFDPQQDGDLGLKPGDKVQLL-EKLSPEWYKGSC--NGRVGIFPANYVKP 110
           Y F  +   +L +K GDKV +L +K S +W+      +G+ G+ PA +++P
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEP 409

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLL---EKLSPEWYKGSCNGRV---GIFPANYVK 109
           A+ ++  + + +L  KPGDK+Q++   E+ +  WY G  N R    G++PA + +
Sbjct: 38  AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGK-NLRTQQEGLYPAVFTQ 91

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 56 LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKG 94
          ++ VE  YQ+  +    L L+ GD + +L K S  W+ G
Sbjct: 28 IDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein
           implicated in polar growth, functionally redundant with
           Boi2p; interacts with bud-emergence protein Bem1p;
           contains an SH3 (src homology 3) domain and a PH
           (pleckstrin homology) domain
          Length = 980

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLE---KLSPEWYKGSCNGRV---GIFPANYVK 109
           A+ Q+  + + +L +KPGDK++++    + +  WY G  N R    G++PA + K
Sbjct: 20  AVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>TPHA0G02580 Chr7 (533488..535128) [1641 bp, 546 aa] {ON} Anc_2.382
           YDL085W
          Length = 546

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 13  IRTELDFLKESNVIS--SDVFDQINKSLPVRWNPSSAARDTSSASLEYVEALYQFDPQQD 70
           ++T +  +KE+ V +   DV ++    + V W   +A RD S   +  +E       +Q+
Sbjct: 335 LKTAVKEVKETTVTTKCGDVVEETPYGILV-WATGNAPRDVSLKLMSKLE-------EQN 386

Query: 71  GDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYV 108
              GL   DK++LL      +  G C    G+FP   V
Sbjct: 387 SRRGLLIDDKLRLLGGNGSIYSIGDCTFHAGLFPTAQV 424

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRV-GIFPANYV 108
           V+A Y +  Q  GDLG   GD V  + +++ +W+ G    N +  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGD-VMEVTRITGDWFYGRLLRNKKCSGYFPNNFV 65

>Smik_4.151 Chr4 (279705..281342) [1638 bp, 545 aa] {ON} YDL085W
           (REAL)
          Length = 545

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 25/58 (43%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYV 108
           T +  +E+ + L    P+Q    GL   DK++LL      +  G C    G FP   V
Sbjct: 366 TGNEPIEFSKTLLDRIPEQSNRRGLLINDKLELLGAEDSIYAIGDCTAHTGFFPTAQV 423

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 47  AARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLL---EKLSPEWYKGSCNGRV--- 100
           A  +  + SL    A+ ++  + + +L  +PGDK+Q+L   E+ +  WY G  N R    
Sbjct: 66  ATNNKGARSLPIYIAINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGR-NLRTQEE 124

Query: 101 GIFPANYVK 109
           G++PA + +
Sbjct: 125 GLYPAVFTQ 133

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F+P+ D +L L  GD V +  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFV 166

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 5/72 (6%)

Query: 43  NPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRV 100
           NP  A   T    L+ V A Y F+P +   L    GD + ++ K    W+ G    N  +
Sbjct: 10  NPPKAGLSTIIKPLDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSL 69

Query: 101 ---GIFPANYVK 109
              G FP +Y K
Sbjct: 70  VLRGWFPRSYTK 81

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--------NGRVGIFPAN 106
           +EY +A+Y     +  G      GD + + E ++ +W+KG          + RVG+ P N
Sbjct: 600 IEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYN 659

Query: 107 YVK 109
           +++
Sbjct: 660 FIQ 662

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 60  EALYQFDPQQDG--DLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
           EALY +   Q    ++  + G+ +++ +     W     NG  GI P+NYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>KNAG0E02050 Chr5 (419283..420980) [1698 bp, 565 aa] {ON} Anc_2.382
           YDL085W
          Length = 565

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 7/67 (10%)

Query: 42  WNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVG 101
           W   +A RD        V+ L    P+Q+   GL   DK+QLL   S  +  G C    G
Sbjct: 380 WATGNAPRDV-------VKDLMNKLPEQNSRRGLLINDKLQLLGAESSVFAIGDCTFFPG 432

Query: 102 IFPANYV 108
           +FP   V
Sbjct: 433 LFPTAQV 439

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F P+ D +L L  GD + +  K    W   +   N ++G+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query: 53  SASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLS-PEWYK------GS-CNGRVGIFP 104
           +A L   +A+Y ++PQ   +L LK  D + LLEK    +W+       GS     VG+ P
Sbjct: 2   TAFLGVYKAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVP 61

Query: 105 ANYVKPA 111
           +NY++ A
Sbjct: 62  SNYIEEA 68

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 62  LYQFDPQQDGDLGLKPGDKVQLLEK---LSPEWYKG---SCNGRVGIFPANYVK 109
           + ++  + + +L L PGD++++LE        WY G   S   +VG+FP  + K
Sbjct: 25  INRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTK 78

>KLTH0H15708g Chr8 complement(1356162..1357778) [1617 bp, 538 aa]
           {ON} similar to uniprot|P40215 Saccharomyces cerevisiae
           YMR145C NDE1 Mitochondrial external NADH dehydrogenase
          Length = 538

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 47/120 (39%), Gaps = 14/120 (11%)

Query: 24  NVISSDVFDQINKSLP---VRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDK 80
            VI++   D I + +P   + W   +A R+ S + +  +E        Q+   GL   +K
Sbjct: 337 TVITAKCGDDI-EDIPYGVLVWATGNAPREVSKSLMNRMEC-------QNSRRGLLINEK 388

Query: 81  VQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFXXXXXXXXXXXXXQYKAQELQQAPTQNS 140
           +QLL      W  G C    G+FP   V                 QYK  +L+    QNS
Sbjct: 389 LQLLGAEDSIWAIGDCTFYPGLFPTAQVA---HQEGEYLASVLKKQYKIDQLKWHTLQNS 445

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSC--NGRVGIFPANYVK 109
           A Y  + ++  +L  + GDK+  +  +  +W+ G     G  G+FP+NYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly
           similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 187

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F P+ D +L L+ GD + +  +    W   + +   R G+ P  YV
Sbjct: 73  ALYDFVPENDNELELREGDVLFIGYRHGQGWLVAENAERTRTGLVPEEYV 122

>Kwal_34.15827 s34 (76814..78424) [1611 bp, 536 aa] {ON} YMR145C
           (NDE1) - Hypothetical ORF [contig 272] FULL
          Length = 536

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 36/99 (36%), Gaps = 10/99 (10%)

Query: 42  WNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVG 101
           W   +A R+ S   +  +E+       Q+   GL   DK+QLL      W  G C    G
Sbjct: 355 WATGNAPREVSKNLMAKMES-------QNSRRGLLINDKLQLLGAEDSIWAIGDCTFYPG 407

Query: 102 IFPANYVKPAFXXXXXXXXXXXXXQYKAQELQQAPTQNS 140
           +FP   V                 QYK  +L     QNS
Sbjct: 408 LFPTAQVA---HQEGEYLATVLKKQYKIDQLNWHMVQNS 443

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 42/73 (57%), Gaps = 9/73 (12%)

Query: 43  NPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLE---KLSPEWYKGSCNGR 99
           N ++  R+T S  L Y+ A+ ++  + + +L ++PGDK++++    + +  WY G  N R
Sbjct: 4   NKNNLGRETGSFPL-YI-AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGR-NLR 60

Query: 100 V---GIFPANYVK 109
               G++PA + K
Sbjct: 61  TKEEGLYPAVFTK 73

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--VGIFPANYVKPA 111
           ALY F+P+ D +L L+ GD V +  +    W       R   G+ P  +V  A
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYA 185

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 3/72 (4%)

Query: 39  PVRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCN 97
           PVR  PS          +  +E ++ +  Q D ++ +  GD V +++      W  G  N
Sbjct: 533 PVRAKPSVPP--PRRKHVRTLEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELN 590

Query: 98  GRVGIFPANYVK 109
           G  G+ P +Y K
Sbjct: 591 GLKGLVPTSYCK 602

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRV---GIFPANYV 108
           Y   LY F+  ++ +L +  G+ + +      EW+ G   GR+   G+ P ++V
Sbjct: 165 YALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWFIGRPLGRIGGPGLVPISFV 218

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 11/75 (14%)

Query: 47  AARDTSSASLEYVEALYQFD--PQQDGD---LGLKPGDKVQLLEKLSPEWYKG----SCN 97
           A   TS   +  V A Y F+   ++DG    L ++ GD + +L K S  W+ G      +
Sbjct: 54  ATELTSIRPVGIVVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSS 113

Query: 98  GRV--GIFPANYVKP 110
           G+V  G FP N+ +P
Sbjct: 114 GKVDRGWFPQNFGRP 128

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY--KGSCNGRVGIFPANYV 108
           ALY F+P+ D +L L  G+ V +  K    W   +     + G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLE---KLSPEWYKGSCNGRV---GIFPANYVK 109
           A+ ++  + + +L +KPGDK++++    + +  WY G  N R    G++PA + K
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGS---CNGRVGIFPANYV 108
            LY F P++  +L    GDK+ +    + EW+  S    +G+  + P ++V
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>Kpol_1023.44 s1023 complement(93704..97717) [4014 bp, 1337 aa] {ON}
           complement(93704..97717) [4014 nt, 1338 aa]
          Length = 1337

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 37  SLPVRWNPSSAARDTSSASLEYVEALYQFDPQQD---GD---LGLKPGDKVQLLEKLSP 89
           +L +R N   +A  +    +E V++LY+FD  +D   GD   +  K G K  L+E + P
Sbjct: 416 ALVLRLNNIKSAITSKEQHMETVDSLYEFDEDEDNLYGDESSIDAKSGKKEILVESIQP 474

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 12/90 (13%)

Query: 25  VISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVEALYQFDP--QQDGDLGLKPGDKVQ 82
           VI SDV +      PV   PS+   +  + ++  ++ALY +     Q+ +L     D   
Sbjct: 48  VIGSDVVE------PVGLVPSNYIEE--APAISQMKALYDYTEAQNQEEELTFHENDIFD 99

Query: 83  LLEKLSPEWY--KGSCNGRVGIFPANYVKP 110
           + +   P+W   K   +  VG  P NYV+P
Sbjct: 100 VYDDKDPDWLLVKSRTSNEVGFIPGNYVEP 129

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 63  YQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
           YQ D     ++  + G+ +++ +     W     NG+VGI P+NYV+
Sbjct: 305 YQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 aa]
           {ON} Anc_8.539 YBR200W
          Length = 541

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 7/85 (8%)

Query: 31  FDQINKSLPVRWNPSSAAR----DTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEK 86
           F+ I+K+ P   N S  +R    D S     Y   LY F  ++  +L    G+ + +   
Sbjct: 121 FEVIDKTRPHSRNGSIVSRRSSHDQSKMGTLYAIVLYDFQAEKSDELTAYAGENLFICAH 180

Query: 87  LSPEWYKGSCNGRV---GIFPANYV 108
            + EW+     GR+   G+ P  +V
Sbjct: 181 HNYEWFIAKPIGRLGGPGLVPVAFV 205

>ADR262C Chr4 complement(1155907..1157508) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR145C
           (NDE1) and YDL085W (NDE2)
          Length = 533

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 26  ISSDVFDQINKSLP---VRWNPSSAARDTSSASLEYVEALYQFDPQQDGDLGLKPGDKVQ 82
           I++   DQ+ + LP   + W   +A RD S + ++ ++       QQ    GL   DK+Q
Sbjct: 335 ITTKCGDQLEE-LPYGVLVWATGNAPRDVSKSLMKKLD-------QQTSPRGLLINDKLQ 386

Query: 83  LLEKLSPEWYKGSCNGRVGIFPANYV 108
           LL      +  G C    G+FP   V
Sbjct: 387 LLGAEDSIYAMGDCTFYPGLFPTAQV 412

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLE-KLSPEWYKGSCNGRVGIFPANYV 108
           A Y +  Q D ++ +  GD + ++       W  G  NG  G+FP +Y 
Sbjct: 590 AKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSYC 638

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 59  VEALYQFDPQQDG--DLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVK 109
            +ALY +D   D   ++  +  + +Q+ +     W     NG  GI P+NYV+
Sbjct: 306 AKALYPYDADGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLL-EKLSPEWYKGS--CNGRVGIFPANYVK 109
           ALY F+ +   +L ++ GD V ++ +K S +W+      NG+ G+ PA +++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE 428

>KAFR0I02350 Chr9 complement(473466..474218) [753 bp, 250 aa] {ON}
           Anc_1.421 YCR004C
          Length = 250

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 8/101 (7%)

Query: 3   ASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVEAL 62
           A  + + + +   + D  +    +S DV  Q+N   P +  P+     T +   EY   L
Sbjct: 19  AKSVQKGIESAGGKADIYRVEETLSDDVLSQMNA--PAK--PADIPIATENTLTEYDAFL 74

Query: 63  YQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIF 103
           +   P + G L   P       +K    W +GS NG+VG F
Sbjct: 75  FGV-PTRFGTL---PAQWSSFWDKTGSLWAQGSLNGKVGGF 111

>Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLE---KLSPEWYKGSCNGRV---GIFPANYVK 109
           A+ ++  + + +L +KPGDK++++    + +  WY G  N R    G++PA + K
Sbjct: 20  AVNEYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGR-NLRTEEEGLYPAVFTK 73

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1394

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 18/73 (24%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY------KGSCNGRV--------- 100
           ++ V  ++ F P     L L+ G  + ++EK S  W+       G+ +G           
Sbjct: 9   IDIVVVIHNFTPTSSNMLPLQSGSIIYVIEKNSNGWWDGVQLVAGTQSGSFSPKSGSTQK 68

Query: 101 ---GIFPANYVKP 110
              G FPANY KP
Sbjct: 69  IIRGWFPANYTKP 81

>NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]
           {ON} Anc_7.413 YBL085W
          Length = 1023

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 15/94 (15%)

Query: 30  VFDQINKSLPVRWNPSSAARDTSSASLEYVEA--------LYQFDPQQDGDLGLKPGDKV 81
             +Q+N + P R   +S    + S +    +A        + ++  + + +L ++PGDK+
Sbjct: 8   TLEQLNSTSPSRIRNASIESSSYSGNFHPEDAKSYPMYICINEYTKRMEDELDMRPGDKI 67

Query: 82  QLL---EKLSPEWYKGSCNGRV---GIFPANYVK 109
           Q+L   E+    WY G  N R    G++P  + +
Sbjct: 68  QVLIDDEEYDDGWYFGR-NLRTQEEGLYPVTFTQ 100

>YDL085W Chr4 (303211..304848) [1638 bp, 545 aa] {ON}
           NDE2Mitochondrial external NADH dehydrogenase, catalyzes
           the oxidation of cytosolic NADH; Nde1p and Nde2p are
           involved in providing the cytosolic NADH to the
           mitochondrial respiratory chain
          Length = 545

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 26/58 (44%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYV 108
           T +  +++ + L    P+Q    GL   DK++LL   +  +  G C    G FP   V
Sbjct: 366 TGNEPIDFSKTLMSRIPEQTNRRGLLINDKLELLGSENSIYAIGDCTAHTGFFPTAQV 423

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLS-PEWYK------GSCNGR-VGIFPANY 107
           L   +ALY +  Q D +L +K GD + LLEK S  +W+       GS     VG+ P  Y
Sbjct: 5   LGVYQALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLL-EKLSPEWYKGSC--NGRVGIFPANYVK 109
            +A+Y F      +L +K GD + +L ++ S +WY       G+ GI PA +V+
Sbjct: 415 AKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVE 468

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLL---EKLSPEWYKGSC--NGRVGIFPANYVK 109
            + ++  + + +L ++PGDK+++L   E+ +  WY G     G  G++P  + +
Sbjct: 46  CINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYPVVFTQ 99

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKVQLL-EKLSPEWYK--GSCNGRVGIFPANYVK 109
           + LY +  Q   ++ + PGD + LL       W K      G  G+ P  YVK
Sbjct: 497 KVLYAYAKQDTDEISISPGDSISLLAADTGSGWTKIRNDTTGESGLVPTTYVK 549

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGS---CNGRV--GIFPANYV 108
           VEAL+ +    + DL    G  + +LE    EW+ G     +G+   GIFP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGS--CNGRVGIFPANYV 108
           A Y ++  +D +L  +  +++  ++ +  +W+ G    +G  G+FP+NYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.365
           YLR191W
          Length = 314

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 56  LEYVEALYQFDPQQDG-DLGLKPGDKVQLLE------KLSPEWYKGSCNGRVGIFPANYV 108
           L++  ALY F P+    ++ LK GD + ++       + S  W   + +G VG  P NYV
Sbjct: 244 LKFARALYDFVPENAKIEVPLKKGDLMAIISEKDTFGRDSQWWRVRTRDGNVGYIPYNYV 303

Query: 109 K 109
           +
Sbjct: 304 E 304

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLS-PEWYK------GS-CNGRVGIFPANY 107
           L   +ALY ++PQ   +L ++  + + LLEK    EW+       GS  +  VG+ P+NY
Sbjct: 5   LGVYKALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNY 64

Query: 108 VKPA 111
           V+ A
Sbjct: 65  VEQA 68

>Suva_4.161 Chr4 (293198..293944) [747 bp, 248 aa] {ON} YDL085W
           (REAL)
          Length = 248

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%)

Query: 51  TSSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYV 108
           T +  +E  + L    P+Q    GL   DK++LL      +  G C    G FP   V
Sbjct: 77  TGNEPIELSKVLMGKVPEQTNKRGLLINDKLELLGAEESVYAIGDCTAHTGFFPTAQV 134

>TPHA0I03300 Chr9 (729773..732031) [2259 bp, 752 aa] {ON} Anc_7.542
           YPR185W
          Length = 752

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 3   ASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEY 58
           A L  R LT I TEL  L+ S+ +  D   +INK +PV+    S + D    ++EY
Sbjct: 243 AHLEQRKLTPIWTELGLLRISSSLRIDTKFEINKIVPVK----SKSTDNGYKNIEY 294

>KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.344
           YDR162C
          Length = 270

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGR--VGIFPANYV 108
           ALY F+P+ D +L LK  D V +  K    W       R   G+ P  +V
Sbjct: 141 ALYDFEPENDNELELKEEDVVYISYKHGQGWLVAENEQRTKTGLVPEEFV 190

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 52  SSASLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWY---KGSCNGRVGIFPANYV 108
           +S+S E  + LY +  Q D ++ + PGD ++L+   S   +   +    G  G+ P  Y+
Sbjct: 499 ASSSDEENKVLYAYTQQDDDEISVTPGDVIELVTPDSGSGWTQIRNVTTGAEGLVPTTYI 558

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 61  ALYQFDPQQDGDLGLKPGDKVQLL---EKLSPEWYKGSC--NGRVGIFP 104
           A+ ++  + + +L +KPGDK++++   ++ +  WY G     G  G++P
Sbjct: 34  AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYP 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,515,794
Number of extensions: 521225
Number of successful extensions: 1661
Number of sequences better than 10.0: 280
Number of HSP's gapped: 1555
Number of HSP's successfully gapped: 303
Length of query: 208
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 103
Effective length of database: 41,441,469
Effective search space: 4268471307
Effective search space used: 4268471307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)