Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4463.498ON45645622560.0
YPR152C (URN1)3.498ON46546116130.0
Smik_16.4043.498ON46046115830.0
Suva_16.4803.498ON45244214540.0
Kwal_47.188953.498ON4434476004e-72
Kpol_480.113.498ON4634725833e-69
KAFR0G037203.498ON4094455741e-68
TDEL0D056603.498ON4424565595e-66
KLTH0G02398g3.498ON4624595581e-65
KNAG0A079703.498ON3884405503e-65
TPHA0A056903.498ON4784855521e-64
SAKL0F02552g3.498ON4784835354e-62
CAGL0L08404g3.498ON4103664721e-53
KLLA0E03939g3.498ON4354464461e-49
NDAI0B059003.498ON5225114475e-49
NCAS0F035803.498ON4133964362e-48
Ecym_12313.498ON3292493402e-35
ZYRO0D09768g3.498ON4602283201e-31
AFR317C3.498ON3282212954e-29
TBLA0D029303.498ON2761561752e-13
TBLA0C009302.649ON658811000.001
ZYRO0E00682g2.649ON57082960.004
KLLA0E18239g2.649ON57174930.009
KNAG0M024702.649ON60682880.036
Smik_11.2432.649ON579103870.044
TPHA0L020202.649ON58375860.052
Skud_11.2172.649ON58375840.10
YKL012W (PRP40)2.649ON58376830.14
CAGL0L05368g2.649ON59026820.17
NCAS0C051102.649ON60471810.23
Suva_11.2162.649ON58575800.34
Kpol_1073.42.649ON53075790.38
TDEL0B074402.649ON57075780.54
KAFR0A002302.649ON55675770.65
NDAI0G046002.649ON64784760.91
ACL120W5.135ON16356730.97
Kwal_23.64356.364ON18183731.2
Kwal_14.9392.649ON56238722.5
KLTH0C00924g2.649ON56428704.7
YHR020W1.352ON68887705.6
Skud_10.2425.135ON17031667.9
Ecym_53323.117ON31355688.0
ADR159C2.649ON56929688.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.446
         (456 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   873   0.0  
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   625   0.0  
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   614   0.0  
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   564   0.0  
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   235   4e-72
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   229   3e-69
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   225   1e-68
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   219   5e-66
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   219   1e-65
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   216   3e-65
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   217   1e-64
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   210   4e-62
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   186   1e-53
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   176   1e-49
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   176   5e-49
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   172   2e-48
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   135   2e-35
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   127   1e-31
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   118   4e-29
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    72   2e-13
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    43   0.001
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    42   0.004
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    40   0.009
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    39   0.036
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    38   0.044
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    38   0.052
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    37   0.10 
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    37   0.14 
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    36   0.17 
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    36   0.23 
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    35   0.34 
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    35   0.38 
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    35   0.54 
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    34   0.65 
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    34   0.91 
ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic hom...    33   0.97 
Kwal_23.6435 s23 (1580033..1580578) [546 bp, 181 aa] {ON} YCR086...    33   1.2  
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    32   2.5  
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    32   4.7  
YHR020W Chr8 (143996..146062) [2067 bp, 688 aa] {ON} Protein of ...    32   5.6  
Skud_10.242 Chr10 complement(434105..434617) [513 bp, 170 aa] {O...    30   7.9  
Ecym_5332 Chr5 (677482..678423) [942 bp, 313 aa] {ON} similar to...    31   8.0  
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    31   8.2  

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/456 (93%), Positives = 427/456 (93%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120
           VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD
Sbjct: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120

Query: 121 KIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXXXXXX 180
           KIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSS        
Sbjct: 121 KIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSEEEEEEEE 180

Query: 181 XXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIEND 240
               DDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIEND
Sbjct: 181 EEEEDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIEND 240

Query: 241 PDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDVLEPTKYHYLAQILAKAGTI 300
           PDFYTIGDDAVREGFFEEWC                 VGDVLEPTKYHYLAQILAKAGTI
Sbjct: 241 PDFYTIGDDAVREGFFEEWCGHEHSDSAAAEASGSEDVGDVLEPTKYHYLAQILAKAGTI 300

Query: 301 PPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLR 360
           PPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLR
Sbjct: 301 PPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLR 360

Query: 361 DHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNIVVAADPRYYVV 420
           DHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNIVVAADPRYYVV
Sbjct: 361 DHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNIVVAADPRYYVV 420

Query: 421 GILDKTMVWVRWLAAEGEPSGRFTPAGAGSRPISPE 456
           GILDKTMVWVRWLAAEGEPSGRFTPAGAGSRPISPE
Sbjct: 421 GILDKTMVWVRWLAAEGEPSGRFTPAGAGSRPISPE 456

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/461 (66%), Positives = 362/461 (78%), Gaps = 6/461 (1%)

Query: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
           WQEFKTPAG +YYYNK TKQS+WE P+ K  S+ E+  K  + ERKPTFSLEL++ WHL+
Sbjct: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWHLI 64

Query: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVDK 121
           I NDGTK Y+N DSK FKN+ISQE DS+C +L+ESLDKEKLVLLIGVARGY MR+ED+DK
Sbjct: 65  IYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREEDIDK 124

Query: 122 IFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSS-XXXXXXXX 180
           I ES NEEI+LFK+NQ+E  R DE +EE GDV  PL+E HTGL+SGYGSSS         
Sbjct: 125 ILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEEDEEEDE 184

Query: 181 XXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIEND 240
               ++ EQ +N+D +IIDDLN+IDT D DER +FF LFDRY+LDKFSTWSLQSKKIEND
Sbjct: 185 EEDEENEEQIVNQDISIIDDLNRIDTDDIDERNIFFELFDRYKLDKFSTWSLQSKKIEND 244

Query: 241 PDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGD---VLEPTKYHYLAQILAKA 297
           PDFY I DD VRE  FEEWC                   D   VLEPTKYHYLAQI+A A
Sbjct: 245 PDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTKYHYLAQIVANA 304

Query: 298 GTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQD 357
           GTI PD +PQDIRKQQK LYKAY+IKEY+PSKR+QDKFVSQLLFYYKTF LEQRKEIF D
Sbjct: 305 GTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCD 364

Query: 358 CLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNI--VVAADP 415
           CLRDHERDF GAV+S+R++  LI +WQ +L+APAD +S+E++LL+IE+RC +  +V  +P
Sbjct: 365 CLRDHERDFTGAVESLRQDKELIDRWQTLLKAPADSSSIEDILLSIEHRCCVSPIVVTEP 424

Query: 416 RYYVVGILDKTMVWVRWLAAEGEPSGRFTPAGAGSRPISPE 456
           RYYVVGIL+KT+VWVRWLAAE  PS RFTP GAG+ PI+PE
Sbjct: 425 RYYVVGILEKTVVWVRWLAAEVGPSSRFTPVGAGNEPINPE 465

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/461 (66%), Positives = 356/461 (77%), Gaps = 11/461 (2%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +WQEFKTP G +YYYNK TKQSQWE P+ K  SD E+  K  ++ER PTF+LELID WHL
Sbjct: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63

Query: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120
           +ICNDGTK Y+N DSK+FK++I QES  +C AL+ESLDK+KLVLLIG+ARGY +++ED+D
Sbjct: 64  IICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDID 123

Query: 121 KIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSS-XXXXXXX 179
           KIFESLNEEI+LFKKNQ+   R  E  EE G V   L E HTGLISGYGSSS        
Sbjct: 124 KIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSEEEEEEEE 183

Query: 180 XXXXXDDGEQDLNKDATIIDDLNQIDTGDAD---ERGLFFRLFDRYELDKFSTWSLQSKK 236
                D  EQ +N++ +IIDDLN ID  D D   ER LFF+L DRY+LDKFSTWSLQSKK
Sbjct: 184 EEEEEDHAEQGVNQNVSIIDDLNHIDADDIDEGRERSLFFQLCDRYKLDKFSTWSLQSKK 243

Query: 237 IENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDVLEPTKYHYLAQILAK 296
           IENDP+FY I DD VREG FEEWC                   +VLEPTKYHYLAQI+AK
Sbjct: 244 IENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDE-----SNVLEPTKYHYLAQIVAK 298

Query: 297 AGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQ 356
           AG I PDA+PQDIRK+QK LYKAYRIKEYVP KREQD+FVSQLLFYYKTF+LEQRK IFQ
Sbjct: 299 AGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQ 358

Query: 357 DCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNI--VVAAD 414
           DCL DHERDF GA+ S+R+++ LIS+WQA+LE P DG S+E+VLL+IE RC +  +V AD
Sbjct: 359 DCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVSAIVVAD 418

Query: 415 PRYYVVGILDKTMVWVRWLAAEGEPSGRFTPAGAGSRPISP 455
           PRYYVVGIL+KT+VWVRWLAAEG P  RFTPAGAG+ PI+P
Sbjct: 419 PRYYVVGILEKTVVWVRWLAAEGAPPSRFTPAGAGNGPINP 459

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/442 (65%), Positives = 340/442 (76%), Gaps = 16/442 (3%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +WQEFKTPAG RY+YNK TK+S+W+ PDFK  S  ++  K  ++ERKP F+LELID WHL
Sbjct: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65

Query: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120
           +ICNDGTKFYYN +S + K EI +E   QC+AL+ SLDKEKL+LLIGVARGY++R+EDV+
Sbjct: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125

Query: 121 KIFESLNEEINLFKKNQNEA--GRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXXXX 178
           KIFESLNEEI+LFKKNQ      + DE NEE GD   P + +  GL+SGYGSSS      
Sbjct: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGSSSEEEEEE 185

Query: 179 XXXXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIE 238
                    E+  N DA IIDDLNQID+GD +ERGLFF+L DRYELDKFSTWSLQ KKIE
Sbjct: 186 ---------EEPENDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIE 236

Query: 239 NDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDVLEPTKYHYLAQILAKAG 298
           NDPDFY +GD AVRE  FEEWC                   D+LEPTK+HYLAQI+AKA 
Sbjct: 237 NDPDFYKVGDAAVRESLFEEWCASASASASGNESEDEDD-ADLLEPTKFHYLAQIVAKA- 294

Query: 299 TIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDC 358
            I PD +PQDIRKQQK L+KAYRIKEYVPSKR+QD+FVSQLLFYYKTFSLEQRKEIFQ+C
Sbjct: 295 EIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQEC 354

Query: 359 LRDHERDFAGAVKSIRRESGLISQWQAVLE-APADGASVEEVLLNIEYRCNI--VVAADP 415
           LRDHERDFA AV+S+R++ GLIS+WQA+L    ADGASVE+ LL+IE+RC +  +  ADP
Sbjct: 355 LRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIALADP 414

Query: 416 RYYVVGILDKTMVWVRWLAAEG 437
           RYYV+GILDKT  WVRWLAAEG
Sbjct: 415 RYYVLGILDKTAGWVRWLAAEG 436

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  235 bits (600), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 159/447 (35%), Positives = 239/447 (53%), Gaps = 37/447 (8%)

Query: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
           W+E+KTP G +YYYN  TK+S +E PD     DQ +  K+ +++ KP F+L L + W L+
Sbjct: 5   WREYKTPDGSKYYYNLNTKKSTYEIPD-DFDEDQNSGRKSRKLDAKPLFALSLFNDWALI 63

Query: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVDK 121
           ICN G +F+YNS+S   + ++  E+  +   L+  LD+EKLVLL+GVA+G+D  D +V  
Sbjct: 64  ICNTGLRFFYNSESHTSRWDLDDEASLE---LLAKLDREKLVLLVGVAKGFDPGDRNV-- 118

Query: 122 IFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXXXXXXX 181
            ++ L++ I+  K++ N      E  EE    + P       L+SGYGSS          
Sbjct: 119 -YQELSDSISELKEDSNNRDFRKETAEE----SIPTAVPGQSLVSGYGSSDESDKDEDEE 173

Query: 182 XXXD------DGEQDLNKDATIIDDLNQI-DTGDADERGLFFRLFDRYELDKFSTWSLQS 234
              +      +     N     +DDL  +    D      F  LF +Y +D +STW++QS
Sbjct: 174 EEENDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQS 233

Query: 235 KKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVG--------DVLEPTK 286
           +KI +DP FY I +DA R+  FE WC                 +         D LEP++
Sbjct: 234 RKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSLEPSR 293

Query: 287 YHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTF 346
           YHYLA I++K+  I    +P+DIR  QKEL+K +RIK+ + SKREQD F+S+LLFYYK  
Sbjct: 294 YHYLAHIVSKSK-ITSSTLPKDIRTDQKELFKQFRIKDSL-SKREQDAFLSKLLFYYKRM 351

Query: 347 SLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIE-- 404
           + EQR  IF+  L   ++     +K+  R S ++S        P +  ++E  LL +E  
Sbjct: 352 TPEQRIAIFKRFLEGKKKALKKGLKNQERLSTILS----TPSLPQENYAIETQLLILEDC 407

Query: 405 ---YRCNIVVAADPRYYVVGILDKTMV 428
              +  N  +  D +YYV+GI DKT+ 
Sbjct: 408 IDTHGSNAFLQEDVQYYVLGIKDKTVA 434

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  229 bits (583), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 162/472 (34%), Positives = 246/472 (52%), Gaps = 56/472 (11%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +W+EF  P G +YYYN K+K+S W  PD     D E  +        P F   L++ WHL
Sbjct: 5   IWKEFNAPDGRKYYYNIKSKESTWTKPD--SLYDTEKGKVGSDRAGAPLFVFPLLNGWHL 62

Query: 61  VICNDGTKFYYNSDSKVFKNEISQE-SDSQCSALVESLDKEKLVLLIGVARGYDMRDEDV 119
           +IC  G K+YYN   KV  + IS+E SD     L+ ++DK+KL+LLI VARGY+    D 
Sbjct: 63  IICVGGEKYYYN---KVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNW--PDY 117

Query: 120 DKIFESLNEEINLFKKNQNEAGRVDEAN----------EEPGDVNPPLKEHHTGLISGYG 169
           +K+++ L +E  L   +  +  + +  +           + G+V   +   +TGLI GY 
Sbjct: 118 EKLYDELLKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNV---VAVSNTGLIGGYL 174

Query: 170 SSSXXXXXXXXXXXXDDG---EQDLNK--DATIID-DLNQIDTG-----DAD---ERGLF 215
           SS              +    E+DL K  D   +D +LN ID G     D D    + LF
Sbjct: 175 SSDDEESSDENQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLEKSKSLF 234

Query: 216 FRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXX 275
            RLF+ ++LD +S+W LQ KKI+N PD++ I D++ RE  FE WC               
Sbjct: 235 TRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTNFE 294

Query: 276 XXVGDVL--------EPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVP 327
               + L        EPTK+HYLA I++KA  I  D +  DI++  K L+K ++IK+++ 
Sbjct: 295 GEDEETLTSDEEDDFEPTKFHYLAHIISKAD-IAADTIFLDIKENNKSLFKEFKIKDFIK 353

Query: 328 SKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVL 387
           SK++Q+ F S+LLF+YK F L +RK +F   L+++E      + S       I   + ++
Sbjct: 354 SKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSN------IEIVRHII 407

Query: 388 EAPADGA-SVEEVLLNIEYRC---NIVV--AADPRYYVVGILDKTMVWVRWL 433
           +   D A  +E  LL IE      N++V  A DP+YY++GI DK ++   +L
Sbjct: 408 KNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYL 459

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  225 bits (574), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 163/445 (36%), Positives = 240/445 (53%), Gaps = 60/445 (13%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +W+E++ P G +YYYN +TK++ WE P           E A R E +P F + L++ W L
Sbjct: 4   IWKEYRAPNGKKYYYNTETKKTTWEKP-----------EAAKREEIEPVFVIRLMNDWKL 52

Query: 61  VICNDGTKFYYNSDSKVFKNEISQE-SDSQCSALVESLDKEKLVLLIGVARGYDMRDEDV 119
           VICN+G K+Y +++     NE ++E SD +   L+E  DKEKLV LIG+ARGY +  E+V
Sbjct: 53  VICNNGMKYYLDNE-----NEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAI--ENV 105

Query: 120 DKIFESLNEEINLFKKN-QNEAGRVD-EANEEPGDVNPPLKEH---HTGLISGYGSSSXX 174
           +KI+ ++ EE+   K++ +NE  R+  EA  E  ++   LKE       L+ GY SS   
Sbjct: 106 EKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREI--VLKEAEKPRMNLVEGYDSSESE 163

Query: 175 XXXXXXXXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQS 234
                         + LN         N  D G + ++  F  LFDRY LDKFS WS++ 
Sbjct: 164 EEEEEED-----DYEFLN---------NVADEGLSGDKAKFMELFDRYGLDKFSEWSMEM 209

Query: 235 KKIENDPDFYTIGDDAVREGFFEEWCX-----XXXXXXXXXXXXXXXXVGDVLEPTKYHY 289
            K+  DPDFY + DD  RE  FE WC                          LEPTK+HY
Sbjct: 210 NKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDEEAKEGGEPEEHEERPLEPTKFHY 269

Query: 290 LAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTF-SL 348
           L+QI++K+  I    + QDI++Q K L+K Y+IK+++ S +EQ+KFVS+LLFYYKTF  +
Sbjct: 270 LSQIVSKS-EIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQV 328

Query: 349 EQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCN 408
           E R + F D LR+   ++  ++  +   S  I +         D  ++E  LL IE  CN
Sbjct: 329 EDRTKQFNDFLREKNANYT-SMSDMNTLSEHIKR--------NDTYAIETTLLQIE--CN 377

Query: 409 IV--VAADPRYYVVGILDKTMVWVR 431
               V +D RYY++ +  KT+  V+
Sbjct: 378 FPQDVLSDVRYYILDLKQKTIELVK 402

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  219 bits (559), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 147/456 (32%), Positives = 241/456 (52%), Gaps = 40/456 (8%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +W  F  P+G +YYYN +TK+S W+ P+   + D  N    L  E +P +++ L++ W L
Sbjct: 4   LWTTFTAPSGEKYYYNLRTKESTWKRPE-SFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62

Query: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120
           VI + G K+Y++S ++     +    D + + L+ ++DK K++LL+ +ARGY+    D  
Sbjct: 63  VIDDIGGKYYFDSSTEEASWTLE---DPESAELLSTIDKNKIILLVAIARGYNTNVGD-- 117

Query: 121 KIFESLNEEINLFKKNQ----NEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXX 176
           ++++ + +++   +K            ++ +E     +   ++  +GLI+GY SS     
Sbjct: 118 RVYQEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSEEEEN 177

Query: 177 X--XXXXXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQS 234
                     + G+ DL K+    +D +QI       R  FF+L  R++ D +STWS+Q+
Sbjct: 178 EIDSDVEKLNNLGDDDLPKENH--EDESQI-------RNDFFQLLQRHQCDPYSTWSIQA 228

Query: 235 KKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXX----------XXXXXXXXVGDVLEP 284
           +KI+ DP FY I DD++RE  FEEWC                             D LEP
Sbjct: 229 RKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQDLVDEDNLDDDSREEEEEDELEP 288

Query: 285 TKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYK 344
             +HYLA I++KA  I P  + QDI+ Q K  +K Y+IK++V SK +Q+ FVS+LLFYYK
Sbjct: 289 LPFHYLAHIVSKAN-ITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYK 347

Query: 345 TFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIE 404
            F+L++RKEIF D L  H R      K++ +ES  +    +      D  ++E  LL +E
Sbjct: 348 KFTLDERKEIFHDLLESHSRSIK---KNLEQESESMRSTLSEEAGSNDAYAIETKLLKME 404

Query: 405 YRCNIV-----VAADPRYYVVGILDKTMVWVRWLAA 435
               +      +A DP+YYV+GI DK +  + +L +
Sbjct: 405 NLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTS 440

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  219 bits (558), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 153/459 (33%), Positives = 237/459 (51%), Gaps = 40/459 (8%)

Query: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
           W+E+KTP G +YYYN  TK+S  + PD      Q    K+ R++   TF + L + W L 
Sbjct: 10  WREYKTPDGTKYYYNVNTKRSTTDKPD-DFEESQSFRSKSRRVDPGVTFVVPLSNDWVLS 68

Query: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVDK 121
           +C +G +F+Y S ++  + +I  E   +  +LV   DK KLVLL+  ARG+D+ + DV  
Sbjct: 69  VCENGQRFFYKSSTEESRWDIEDEESLRILSLV---DKNKLVLLLATARGFDIGERDV-- 123

Query: 122 IFESLNEEINLFKKNQN--EAGRVDEANEEP----GDVNPPLKEHHTG---LISGYGSSS 172
            ++ L E+IN  K+++   E   V EA EEP    G+ +   +E       LIS Y SS 
Sbjct: 124 -YQELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRTLISAYESSD 182

Query: 173 XXXXXXXXXXXXDDGEQDLNKDATIIDDLNQIDTG-DADERGLFFRLFDRYELDKFSTWS 231
                        +   D     + I+DLN      +   + +F  LFD Y+LD +STW+
Sbjct: 183 EDGDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEATKQMFTSLFDEYDLDPYSTWN 242

Query: 232 LQSKKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDV---------- 281
           +QSKKI ++P FY +  DA R   FE+WC                 V             
Sbjct: 243 MQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQAVSSDGDGDDDDTST 302

Query: 282 --LEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQL 339
             LEPT+YHYLA I++KA  + P  +P+D+R +QK+L+K ++IKE +  K++QD+F+S+L
Sbjct: 303 DELEPTRYHYLAHIVSKA-EVAPSTLPRDLRSEQKQLFKQFKIKESL-GKKQQDEFLSKL 360

Query: 340 LFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEV 399
           LFYYK  + EQR E+    L+   +      ++I +   ++SQ     + P  G ++E  
Sbjct: 361 LFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQQ----DLPTSGFAIESQ 416

Query: 400 LLNIEYRCNI-----VVAADPRYYVVGILDKTMVWVRWL 433
           LL +E   +I      +  + +YYV+GI  KT     +L
Sbjct: 417 LLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFL 455

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  216 bits (550), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 155/440 (35%), Positives = 227/440 (51%), Gaps = 65/440 (14%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +W+E++ P G +YY+N  T ++ W++P    ++ +   E ++    KP + + L++AW+L
Sbjct: 4   VWREYRAPNGKKYYHNTTTGETTWDSP----YTRKPQRELSI----KPQYVIPLLNAWNL 55

Query: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120
           VICN+G KFY N D     + +    D+  S L+  +D+EKL+LLIGVARGY     D  
Sbjct: 56  VICNNGAKFYLNPDG----DPVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSGD-- 109

Query: 121 KIFESLNEEINLFK----KNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXX 176
           K++ S+ EEI+  K     ++       E  EEP + N   +   + L+SGYGSSS    
Sbjct: 110 KVYNSVLEEISFLKDDLANDKAPLAEERELQEEPLETNVQSEPVPSALVSGYGSSSDGSD 169

Query: 177 XXXXXXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKK 236
                    D               N+I          +F LF  Y LDK+S WS++S K
Sbjct: 170 DEEEVPPDTDA--------------NRIS---------YFNLFSEYGLDKYSVWSIESLK 206

Query: 237 IENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDVLEPTKYHYLAQILAK 296
           I NDP F+ I DD  RE  FEEWC                   D L PTKYHYL+QI+AK
Sbjct: 207 ISNDPRFHIISDDRQREEIFEEWCCSGVVDDSEDEGYSSG--DDDLSPTKYHYLSQIVAK 264

Query: 297 AGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQ 356
           + T+ P  + QDI++++  L+K Y IK+++ SKREQ++FVSQLLFYYK F+LE+R ++F 
Sbjct: 265 S-TVTPTTIFQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFT 322

Query: 357 DCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEV---LLNIEYRCNIVVAA 413
             + +      G V S                +PAD A+ E++   LL +E      V  
Sbjct: 323 KFIAESR---TGTVPSPT--------------SPADSATPEDIETNLLQMESHLPPTVLD 365

Query: 414 DPRYYVVGILDKTMVWVRWL 433
           +  YY + I  K  V  R L
Sbjct: 366 NTVYYTLDIKTKQSVLHRML 385

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  217 bits (552), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 157/485 (32%), Positives = 249/485 (51%), Gaps = 67/485 (13%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +W+EF  P G +YYYN KTK++ W+ P+  +F  + N     + +  P F+  L + W+L
Sbjct: 5   VWKEFIAPNGQKYYYNLKTKKTTWDEPE-SLF--EGNAVSQGQKDESPVFAFPLFNDWYL 61

Query: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARG--YDMRDED 118
           VI + G KFY+N+   +   E+  E ++Q   L++S+DK+KL+LL+GVARG  YD   + 
Sbjct: 62  VISSLGKKFYFNAVENISVLELHDELNTQ---LLQSIDKQKLILLVGVARGFIYDEYLQV 118

Query: 119 VDKIFESL----NEEINLFKKNQNEAGRVDEANEEPGDVNPP--LKEHHTGLISGYGSSS 172
            ++I E+L    NE  N +K+ Q     V + +EE  D   P  L     G+++ Y SSS
Sbjct: 119 YEEIMENLDFVKNEISNEYKELQ---VNVAQESEESADKQDPGDLIATDNGIVNDYYSSS 175

Query: 173 XXXX--XXXXXXXXDDGEQDLNKDATII------------DDLNQIDTGDAD-ERGLFFR 217
                         D  E +L ++  I             ++LN ++T D +  +  +F+
Sbjct: 176 DEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQ 235

Query: 218 LFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXX 277
           LF++Y+L+ FSTWS QSK + +DPDFY I D+++RE  FEEWC                 
Sbjct: 236 LFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDD 295

Query: 278 VGDV------------------------LEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQ 313
             D                         LEPTKYHYL+ I++KA  I PD + QDI+K  
Sbjct: 296 QTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKAN-ISPDTIFQDIKKDN 354

Query: 314 KELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSI 373
           K+L+K ++I +++ SKR+ + F S+L+FYYK F   QR++IF+  L   E++     K +
Sbjct: 355 KKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGIL---EQNKTAINKHV 411

Query: 374 RRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNIV-----VAADPRYYVVGILDKTMV 428
              S  +   + +  +  +    E  LL +E    +      +A DP+YY++GI DK   
Sbjct: 412 VEHSDKV--LETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLEC 469

Query: 429 WVRWL 433
              +L
Sbjct: 470 LKNYL 474

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  210 bits (535), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 154/483 (31%), Positives = 230/483 (47%), Gaps = 64/483 (13%)

Query: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
           W EF TP+G +YYYN +TKQS  E P    F DQ++  K  +++ KP + + L   W LV
Sbjct: 5   WNEFTTPSGDKYYYNLETKQSTLEKP--AGFDDQKS-RKRQKLQHKPKYLVPLDKGWSLV 61

Query: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSA-LVESLDKEKLVLLIGVARGYDMRDEDV- 119
           +CN GTKFY+N       NE     D  CS  L++ LDKEKLVLLIG++RGY     +V 
Sbjct: 62  LCNTGTKFYHNK----ITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGYYCPRRNVY 117

Query: 120 DKIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXXXXX 179
           D+I   L    +   + Q     +  A+EE  +     +E   GL++GYGSS        
Sbjct: 118 DEIINDLKFLKDKSLEKQGVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSDDSEDENI 177

Query: 180 XXXXXDDGEQDLNK-------------DATIIDDLNQI-DTGDADERGLFFRLFDRYELD 225
                    +   +             D   ID+LN + +    D +  F  LFD+Y LD
Sbjct: 178 EEEEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKNRFTILFDKYNLD 237

Query: 226 KFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDV---- 281
            +S W  QS+KI  DPDFY + + + R+  FE+WC                   D     
Sbjct: 238 PYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANINENDADQRQ 297

Query: 282 --------------------------LEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKE 315
                                     LEPT++HYL+ I++K+ +I    +  DI+K+ K 
Sbjct: 298 ESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKS-SIEQTTIFLDIKKENKA 356

Query: 316 LYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSIRR 375
           L+K +RIK  +  K++Q+ F S+LLFYYK   LEQRK IFQ  L          ++++ +
Sbjct: 357 LFKTFRIKSSL-KKKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLSKLDIIRSNLRNVEK 415

Query: 376 ESGLISQWQAVLEAPADGASVEEVLLNIEYRCNI-----VVAADPRYYVVGILDKTMVWV 430
              + ++       PAD  ++E  LL +E   +I      +  +  YY++GI DKT+   
Sbjct: 416 LRDIATEQ----STPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKDKTIQLK 471

Query: 431 RWL 433
           ++L
Sbjct: 472 QFL 474

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  186 bits (472), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 205/366 (56%), Gaps = 40/366 (10%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +W+E+  P G++YYYN KT+++ W  PD    ++Q++      +E KP  + EL+  W L
Sbjct: 8   LWKEYTAPNGLKYYYNTKTQETTWTKPD----TEQKDETADKEIEIKPLVAFELLAGWAL 63

Query: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120
           +I +DG+K YYN +   +  +IS     +C  L++ L+K++L+LLIG+ RGY  R    D
Sbjct: 64  IIFSDGSKKYYNCNESQWSRKISH---PECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKD 120

Query: 121 KIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXXXXXX 180
            + E + E+I+  +++ N A +  E  +    VN    E+    + GY SS         
Sbjct: 121 LVNE-IREDIDFIREDMN-AAKTSEDMKSGSTVNNL--ENTKNALLGYYSS--------- 167

Query: 181 XXXXDDGEQDLNKDATII----DDLNQIDTGD------ADERGLFFRLFDRYELDKFSTW 230
               DD E+   +D   +    D+ N ++  D       D +  +F LF ++EL+K+STW
Sbjct: 168 ----DDEEEPAKRDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTW 223

Query: 231 SLQSKKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDVLEPTKYHYL 290
            ++S+K+  DP+FY I DDAVRE  FEEWC                   D  EPTKYHYL
Sbjct: 224 RIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGDPG---DDQFEPTKYHYL 280

Query: 291 AQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQ 350
           +Q++A    + PD +P+DI K +K + K YRIK+Y  +K EQ +F+S++L +YK  SLE 
Sbjct: 281 SQLVANYD-LKPDTIPEDIIKDKKLI-KKYRIKDYT-TKSEQRQFLSKMLAWYKHMSLED 337

Query: 351 RKEIFQ 356
           RK++FQ
Sbjct: 338 RKQMFQ 343

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  176 bits (446), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 226/446 (50%), Gaps = 50/446 (11%)

Query: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
           W+ FK P+G  YY+N ++K S  E P  K F  Q+   K LR+   P F L L + W+LV
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKP--KEFGSQQAGMKELRV---PVFCLPLRNYWNLV 58

Query: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMR-DEDV- 119
           IC DG+KF++N +S V + +++   D +  AL++ +D   L LLIGVARG+++R D DV 
Sbjct: 59  ICKDGSKFFHNDESNVSQFKLA---DDESKALLDKVDTSLLALLIGVARGFNLRNDRDVY 115

Query: 120 DKIFESLNEEINLFKKNQN----EAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXX 175
            +I + L  +++   K QN    E  +V  +N +  D +    E    L+SGY SSS   
Sbjct: 116 GEIRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKS----ESSNILVSGYSSSSDDS 171

Query: 176 XXXXXXXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSK 235
                    +D      K+   +  LN  +         F +L +  +LD +STWS+Q+K
Sbjct: 172 GEESEVEEKNDPSSIDVKEEDTLPSLNNTEI-----ESKFIQLLNEIQLDPYSTWSIQAK 226

Query: 236 KIENDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGD---------VLEPTK 286
           +I +DP +Y I  +  R+  F+ WC                   +          LEPTK
Sbjct: 227 RIMHDPRYYLITSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEEDSDVTLEPTK 286

Query: 287 YHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTF 346
           YHYLA I++KA  I P+ +  +I+K+ K L+K   I + + +K+EQ++F S+++ YYK  
Sbjct: 287 YHYLAHIISKAN-ITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRM 344

Query: 347 SLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYR 406
              QR E+F+  +++  R F          S  +SQ   + E P+D   +E  LL +E  
Sbjct: 345 DNLQRTELFKKMMKNKLR-FPPI-------SEKLSQL-MLEETPSDSFKLETQLLQLENA 395

Query: 407 CNIV-------VAADPRYYVVGILDK 425
             I+       +  +  YY++GI DK
Sbjct: 396 LLILDNLQNSYMQNEIMYYILGIKDK 421

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  176 bits (447), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 148/511 (28%), Positives = 236/511 (46%), Gaps = 76/511 (14%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVE--KAL---RMERKPTFSLELI 55
           +W+E+KTP G +YYYN +TKQS WE P F  +   +N    KAL     E +  F+ +L+
Sbjct: 11  IWKEYKTPNGKKYYYNIETKQSTWEKP-FSFYKTNKNNSNTKALGQTHHEIENKFAFKLL 69

Query: 56  DAWHLVICNDGTKFYYN--SDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYD 113
           + W+L++ +DG+KFYYN  S+  V K    +E +     L++ LDK  L+ LIG+ RGY+
Sbjct: 70  NEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYN 129

Query: 114 MRDEDVDKIFESLNEEINLFKKN----QNEAGRVDEANEEPGDVNPPLKEHHTGLISGYG 169
               D+  ++E +   I   K++    Q E     E  EE  +     ++  +G I G  
Sbjct: 130 DPSIDIKGLYEEIVANIGFLKQDILTEQMEIEDGGEDEEEEEEEKEEKEDDVSGKIEGKS 189

Query: 170 SSSXXXXXXXXXXXXDD------------GEQDLNKDATIIDDLNQIDTGDADE------ 211
           S              D+               +   D   ++ LN + +   +E      
Sbjct: 190 SGDDKDVEGNASNKPDNISTDEMREEEGEERFEDEDDNDELNTLNNLTSKGGEEGEDNIN 249

Query: 212 ------RGLFFRLFDRYELDKFSTWSLQSKKIENDPD-FYTIGDDAVREGFFEEWCXXXX 264
                 +  FF L D+ +LD +STWS+QS++I   P  FY+I +D+ RE  FE+WC    
Sbjct: 250 ASVQKVKQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRV 309

Query: 265 XXXXXXXXXXXXXV-GDV----------------------LEPTKYHYLAQILAKA-GTI 300
                          GD                       LEPTKYHYL++++ K   +I
Sbjct: 310 HSTGLYSSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSI 369

Query: 301 PPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLR 360
              ++ QDI++Q K L+K YRIK+++P K+E +K VS LLFYYK  S ++R + FQ+ + 
Sbjct: 370 NERSIFQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVT 429

Query: 361 DHERDFAGAVKSIRRESGLISQWQAVLEAPADG-ASVEEVLLNIEY--------RCNIVV 411
            H   +   +K    E   I +  +  +A A+    +E+ +L IE            +  
Sbjct: 430 KH---YGEKIKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTA 486

Query: 412 AADP---RYYVVGILDKTMVWVRWLAAEGEP 439
           A D     YY++G+  K       +    +P
Sbjct: 487 AVDTPGLEYYIIGLRAKHSALATLIHRTAQP 517

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  172 bits (436), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/396 (29%), Positives = 194/396 (48%), Gaps = 48/396 (12%)

Query: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
           +W+E+K P G +YYYN KTK++ W  P      ++E  E     E K  F+ EL D W+L
Sbjct: 6   LWREYKAPNGRKYYYNVKTKETTWTKP-----VEEEKPEPGDNKEVK--FAFELFDGWYL 58

Query: 61  VICNDGTKFYYNS-DSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDV 119
           +I  DG K +Y+S + K +    +++       ++E +DKEK++LLIG+ RG+      +
Sbjct: 59  LIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHI 118

Query: 120 DKIFESLNEEINLFKKN-QNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSXXXXXX 178
             +++ + ++IN  K+   N+A  ++  N                       +       
Sbjct: 119 KGVYDDIAQDINFLKQEILNDAMELERLN-----------------------AEAEEEES 155

Query: 179 XXXXXXDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIE 238
                    EQD +    + +   + +  D  +R   F LF+ + LD +STWSLQS+KI 
Sbjct: 156 EKEEALPQEEQDDHTVELLNNLEEEEEEQDVKDR--LFHLFESFNLDVYSTWSLQSRKIS 213

Query: 239 NDPDFYTIGDDAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDVLEPTKYHYLAQILAKA- 297
           N  D++ + DD  RE  FE+WC                      EPTKYHYL++I+ +  
Sbjct: 214 NQADYFLVHDDTQREEMFEDWCAMKVAQLPEDESEAEDDDY---EPTKYHYLSEIMYQLR 270

Query: 298 GTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQD 357
             I  D V  DI +  + L+K Y IK+++P +RE    VS+LLFYYK F+  +R+ +F D
Sbjct: 271 DEINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHD 330

Query: 358 CL---------RDHERDFAGAVKSIRRESGLISQWQ 384
            +          D + D AG++   + E+ ++ QW+
Sbjct: 331 YVSQRYGLLPGEDVDNDDAGSLSGEQMETRIL-QWE 365

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  135 bits (340), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 128/249 (51%), Gaps = 31/249 (12%)

Query: 204 IDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCXXX 263
           +  G   E   F  LFDRYEL+ +S+WSLQS+K+++DP+FYT+ DD  R   FE+WC   
Sbjct: 79  VRVGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMK 138

Query: 264 XXXXXXXXXXXXXXVGDV-----------LEPTKYHYLAQILAKAGTIPPDAVPQDIRKQ 312
                           +            LEP K+HYL+ I++K+ TI P  V  D++ +
Sbjct: 139 LAKAGGDSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKS-TIKPQTVFSDVKTE 197

Query: 313 QKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKS 372
            K L+K + I E  P K+EQ +FVS LLFYYK  S ++R EIF++ L             
Sbjct: 198 NKLLFKNFNIDETHP-KQEQRQFVSSLLFYYKKKSSKERVEIFKNLLD----------TK 246

Query: 373 IRRESGLISQWQAVLEA---PADGASVEEVLLNIEYRCNI-----VVAADPRYYVVGILD 424
           ++ E     Q Q +L+    P D   +E  L+ +E    +      +  D +YYVVG+ D
Sbjct: 247 VKHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRD 306

Query: 425 KTMVWVRWL 433
           KT++   +L
Sbjct: 307 KTILIKEFL 315

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  127 bits (320), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 122/228 (53%), Gaps = 14/228 (6%)

Query: 209 ADERGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCXXXXXXXX 268
            D++ L+  LF RY+L+ +S W  + KKI +DPDF  + DD+VRE  FEEWC        
Sbjct: 228 GDKKALW-DLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQ 286

Query: 269 XX----XXXXXXXVGDVLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKE 324
                          + LEPTKYHYLA I++K+  I P  +  DI+   K  +K Y IK+
Sbjct: 287 VEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKS-NITPTTIFMDIKNDNKSSFKKYNIKD 345

Query: 325 YVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQ 384
           ++ SK++Q+ FVS+LLFYYK   LE+RKE+F   L+ + +      +++  +   +    
Sbjct: 346 FLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIE---ENLSNDMDKVRHCL 402

Query: 385 AVLEAPADGASVEEVLLNIEYRCNIV-----VAADPRYYVVGILDKTM 427
           A      D  +VE  L  +E    +      +  +P+YY++GI DK +
Sbjct: 403 AQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKML 450

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  118 bits (295), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 109/221 (49%), Gaps = 14/221 (6%)

Query: 215 FFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCXXXXX-XXXXXXXX 273
            + LF+R ELD +S W  +S KI  D  FY +GDD  R+  FE+WC              
Sbjct: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNAVLED 159

Query: 274 XXXXVGDVLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQD 333
                   L PT++HYLA I++K+ T+ PD V  D+R++ KEL+    +   +  K+EQ 
Sbjct: 160 GEEAEEVELVPTRFHYLAHIVSKS-TVRPDTVYSDVRREHKELFDQLEVD--ILDKKEQR 216

Query: 334 KFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADG 393
           +FV+ LLFYYK      R E+F+  L  H    A    +       + +     E P D 
Sbjct: 217 RFVAGLLFYYKKMDAALRGEVFRKLLHAHR---AAITAAFLENDAQLRELLEYDELPQDS 273

Query: 394 ASVEEVLLNIEYRCNIVVAA------DPRYYVVGILDKTMV 428
            S+E  L  +E +C  +  A      + +YYV+G+ DK +V
Sbjct: 274 YSIETDLFIVE-KCIGLHGALSKLQSEIKYYVLGVKDKLVV 313

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 1  MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQE 36
          +W+  K+  G  YYYN +T ++ W+ PD    SD E
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGE 37

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 77/156 (49%), Gaps = 12/156 (7%)

Query: 192 NKDATIIDDLNQIDTGD---ADERGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGD 248
           N+D  + + L  ID  +    ++   FF L DR  +D +S W L++KKI +DP FY I  
Sbjct: 49  NEDDVLKELLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPT 108

Query: 249 DAVREGFFEEWCXXXXXXXXXXXXXXXXXVGDVLEPTKYHYLAQILAKAGTIPPDAVPQD 308
           D  RE  FE+WC                 +        YH LA+++     I  + + +D
Sbjct: 109 DVEREKLFEQWCYGKLHSREEETTQPQLALA-----LPYHDLAEMIC-CFDIQSNTIYKD 162

Query: 309 IRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYK 344
           IRK  K++ +  +I E + SK EQ+KF ++LL   K
Sbjct: 163 IRKANKKMVR--QIDEKI-SKNEQEKFGTKLLGILK 195

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQE-NVEKALRMER---KPTFSLEL--I 55
          W++ K P G  YYYN KTK+S+W+ P     +++  + EK + +++   K    LE   +
Sbjct: 5  WKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLEFLKL 64

Query: 56 DAWHLVICNDGTKFYYNSDSK 76
            W      +G  +YYN D+K
Sbjct: 65 HGWRTAQTKEGRIYYYNVDTK 85

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 15/82 (18%)

Query: 1  MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
          +W+E K  +G  YYYN KT +S+WE P  ++ S+QE +                   W  
Sbjct: 6  LWKEAKDTSGRIYYYNAKTGESKWEKPR-ELLSEQELILAK--------------HGWKS 50

Query: 61 VICNDGTKFYYNSDSKVFKNEI 82
             +DG  +YYN+ +K  + E+
Sbjct: 51 SKTSDGKLYYYNAQTKTSRWEL 72

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIF 32
          W+  KT  G  YYYN +TK S+WE PD   F
Sbjct: 48 WKSSKTSDGKLYYYNAQTKTSRWELPDLPEF 78

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 16/74 (21%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
          WQE K P G  YYYN  T Q+ WE P+ ++F++          ERK      L   W   
Sbjct: 3  WQETKDPQGRVYYYN-DTGQTTWEKPE-ELFTE---------FERKL-----LKYGWKTA 46

Query: 62 ICNDGTKFYYNSDS 75
          +  DG  +YY SD+
Sbjct: 47 LAEDGRVYYYKSDT 60

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 14/82 (17%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENP-DFKIFSD---------QENVEKALRMERKPTFS 51
          W++ + P G  YY+N++T++SQWE P ++++  D          + VEKA     + +  
Sbjct: 4  WEQARDPQGRVYYFNRETRKSQWEKPAEWEVTDDGAVAAGGAPTKKVEKAT----QGSSG 59

Query: 52 LELIDAWHLVICNDGTKFYYNS 73
            +   W      DG  ++YNS
Sbjct: 60 EPVKGTWKSAKTKDGKVYFYNS 81

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 26/103 (25%)

Query: 1  MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
          +W+E K   G  YYYN  TK+S WE P  ++ S++E + +               + W  
Sbjct: 3  IWKEAKDANGRVYYYNSLTKKSTWEKPK-ELVSEEEQLLRE--------------NGWRA 47

Query: 61 VICNDGTKFYYNSDSK-------VFKNEI----SQESDSQCSA 92
              +G  +YYN  ++       VF+ ++     +ESD+  SA
Sbjct: 48 AKTKEGKVYYYNPATRETSWTIPVFEKKVQTTAKKESDTTASA 90

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 17/75 (22%)

Query: 1  MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
          +W+  K   G  YYYN KT  SQWE P   + +D E +++                 W +
Sbjct: 6  LWRTAKDSNGKVYYYNTKTGVSQWEKPG--VSADIETLKQH---------------GWGV 48

Query: 61 VICNDGTKFYYNSDS 75
              DG  +YYNS +
Sbjct: 49 ARTKDGKLYYYNSST 63

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDF 29
          W   +T  G  YYYN  T +S+WE P F
Sbjct: 46 WGVARTKDGKLYYYNSSTGESRWEAPKF 73

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
          W+E K   G  YYYN  TK+S WE P  ++ S QE + +               + W   
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKPT-QLVSKQEQLLQE--------------NGWRAA 48

Query: 62 ICNDGTKFYYNSDSK 76
             +G  +YYN+ ++
Sbjct: 49 KTAEGKVYYYNTTTR 63

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 15/76 (19%)

Query: 1  MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
          +W+E K  +G  YYYN  TK+S WE P  ++ S +E + +               + W  
Sbjct: 3  IWKEAKDASGRIYYYNTLTKKSTWEKPK-ELISQEELLLRE--------------NGWKA 47

Query: 61 VICNDGTKFYYNSDSK 76
              DG  +YYN  ++
Sbjct: 48 AKTADGKVYYYNPTTR 63

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENP 27
          W   KT  G  YYYN KTK+S+W+NP
Sbjct: 46 WNVAKTKEGKVYYYNVKTKESRWDNP 71

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 17/76 (22%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDA-WHL 60
          W++     G  YYYN  TK+S+W+ P      D  ++++ LR            DA W++
Sbjct: 5  WKKATDSNGKVYYYNTVTKESRWDKP----VEDTTDLKQKLR------------DAGWNV 48

Query: 61 VICNDGTKFYYNSDSK 76
              +G  +YYN  +K
Sbjct: 49 AKTKEGKVYYYNVKTK 64

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 9/71 (12%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
          W+  K   G  YYYN  TK+S+W+ P         ++E +   +      LE I  W   
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRP--------ASMEGSTNNDDSDKMLLEQI-GWKSN 61

Query: 62 ICNDGTKFYYN 72
          + N+G  +YYN
Sbjct: 62 VTNEGKVYYYN 72

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
          W+E K   G  YYYN  TK+S WE P+ ++ S QE + +               + W   
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPE-ELVSQQEQLLQE--------------NGWKAA 48

Query: 62 ICNDGTKFYYNSDSK 76
             +G  +YYN  ++
Sbjct: 49 KTAEGKIYYYNPSTR 63

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDF 29
          W+  KT  G  YYYN  T+Q+ W  P F
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIPAF 72

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 1  MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60
          +W+E K   G  YYYN KT +S+WE P  +  S QE + K               + W +
Sbjct: 4  IWKEAKDNNGRVYYYNSKTGESRWEKP-VEAPSKQEQLLKK--------------NGWSI 48

Query: 61 VICNDGTKFYYNSDS 75
               G  +YYN+ +
Sbjct: 49 GKSKAGKIYYYNTKT 63

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
          W+E     G  YYYN K  +S+WE P  ++F+++E V               L   W   
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKPQ-ELFTEEELV--------------LLKHGWKSS 51

Query: 62 ICNDGTKFYYNSDSK 76
             +G  +YYNS +K
Sbjct: 52 RTAEGKIYYYNSITK 66

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDF 29
          W+  +T  G  YYYN  TK+S+WE P F
Sbjct: 48 WKSSRTAEGKIYYYNSITKESRWEKPIF 75

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 17/75 (22%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61
          W+  K P G  YYYN  TK+S WE P  K F++ +          +P+      + W   
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKP--KNFAEPD----------QPS-----ANDWKTG 46

Query: 62 ICNDGTKFYYNSDSK 76
             DG  +YYN  ++
Sbjct: 47 KTKDGKTYYYNVKTR 61

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
          {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 14/84 (16%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPD--FKIFS-----------DQENVEKALRMERKP 48
          W+  K   G  YYYN  TK+S+WE P     I +              N +  +++E+  
Sbjct: 14 WRSAKDAKGRIYYYNLITKESKWEKPKELLPITAATSTTVRTSTISTNNAKTNIKIEKDD 73

Query: 49 TFSLELIDAWHLVICNDGTKFYYN 72
             +E I  W   +  DG  +YYN
Sbjct: 74 ASIMENI-GWKSNVTADGKTYYYN 96

>ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJR017C (ESS1)
          Length = 163

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 9/56 (16%)

Query: 13 YYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLVICNDGTK 68
          YYYN +TK+SQWE P     +D ++ + A  +   P      +   HL+I + G++
Sbjct: 23 YYYNPETKESQWEVP-----ADTDSEQLARHLAEHPV----QVRCLHLLIKHAGSR 69

>Kwal_23.6435 s23 (1580033..1580578) [546 bp, 181 aa] {ON} YCR086W
           (CSM1) - Hypothetical ORF [contig 17] FULL
          Length = 181

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 85  ESDSQCSALVES-LDKEKLVL--LIGVARGYDMRDEDVDKIFESLNEEINLFKKNQNEAG 141
           E+ SQ  A V+S LD   +++  L+   R      E+ D+  ESL +++   K    EAG
Sbjct: 2   EAISQYKAAVQSRLDNADVLVSKLVHENRMLAQEMENKDQEIESLRKQLEAVKSRSEEAG 61

Query: 142 RVDEANEEPGDVNPPLKEHHTGL 164
           +  EA EE  D+   L EH  G+
Sbjct: 62  KRTEAAEEELDIIKDLFEHLCGV 84

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVE 39
          W+  +T  G  YYYN+ + +S+WE P F+    +E VE
Sbjct: 45 WKTGETEGGKLYYYNESSGESRWEVPTFESDEKEEAVE 82

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDF 29
          W+  KT  G  YYYN++T +S WE P F
Sbjct: 45 WKTGKTDEGQVYYYNQETGKSCWEIPTF 72

>YHR020W Chr8 (143996..146062) [2067 bp, 688 aa] {ON} Protein of
           unknown function that may interact with ribosomes, based
           on co-purification experiments; has similarity to
           proline-tRNA ligase; YHR020W is an essential gene
          Length = 688

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 306 PQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERD 365
           P+DI K Q  + +    K+YV S  E +  + ++L   +    ++ KE+F D  R    +
Sbjct: 543 PKDIEKNQVVVVRRNDSKKYVVSFDELEARIPEILEEMQGDLFKKAKELF-DTHRVIVNE 601

Query: 366 FAGAVKSIRRESGLISQWQAVLEAPAD 392
           ++G V ++ +++ +++ W  V+E   D
Sbjct: 602 WSGFVPALNKKNVILAPWCGVMECEED 628

>Skud_10.242 Chr10 complement(434105..434617) [513 bp, 170 aa]
          {ON} YJR017C (REAL)
          Length = 170

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%), Gaps = 3/31 (9%)

Query: 13 YYYNKKTKQSQWENPDFKIFSDQENVEKALR 43
          Y++N +TK SQWE P+    +D+E + + LR
Sbjct: 27 YFFNTETKHSQWEEPE---GTDKEQLHEYLR 54

>Ecym_5332 Chr5 (677482..678423) [942 bp, 313 aa] {ON} similar to
           Ashbya gossypii AER033W
          Length = 313

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%)

Query: 279 GDVLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQD 333
           G  L+P++Y +L   L +  +I P  + +D+     + YK  ++K  + S R+ D
Sbjct: 130 GTRLKPSQYKHLISTLNRLSSIDPQLLNEDVLSTVSQYYKKTKLKPSIESVRQLD 184

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 2  WQEFKTPAGIRYYYNKKTKQSQWENPDFK 30
          W+   T  G  YYYN++T +S+WE P+ +
Sbjct: 44 WKVATTEDGNVYYYNRETGESRWEKPELE 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,152,825
Number of extensions: 2306537
Number of successful extensions: 7868
Number of sequences better than 10.0: 82
Number of HSP's gapped: 8036
Number of HSP's successfully gapped: 100
Length of query: 456
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 343
Effective length of database: 40,524,141
Effective search space: 13899780363
Effective search space used: 13899780363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)