Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4453.496ON2151978531e-117
Suva_16.4793.496ON2121977651e-103
Smik_16.4033.496ON2031977401e-100
YPR151C (SUE1)3.496ON2061977381e-99
ZYRO0D09812g3.496ON1851423392e-39
KNAG0A079603.496ON1771373322e-38
TPHA0D033003.496ON1961373315e-38
SAKL0F02618g3.496ON2531373331e-37
Kwal_55.212483.496ON2221483274e-37
KLTH0F14938g3.496ON2291563284e-37
Kpol_1017.43.496ON1841433167e-36
NDAI0B058903.496ON2781362941e-31
KLLA0E03983g3.496ON1911352481e-25
TDEL0D056403.496ON1241512246e-23
TBLA0D029403.496ON71441622e-14
Ecym_12333.496ON87441598e-14
CAGL0L08426g3.496ON1401581603e-13
NCAS0F035703.496ON230531653e-13
KAFR0G037103.496ON79391432e-11
YPL159C (PET20)8.682ON2531641487e-11
Skud_16.1238.682ON2551701442e-10
Suva_16.1518.682ON2531681442e-10
Smik_6.3568.682ON2531361391e-09
AFR315C3.496ON77411231e-08
NCAS0C013108.682ON2571381311e-08
TPHA0D012908.682ON2181541292e-08
KNAG0J017608.682ON2581371241e-07
TPHA0G015708.682ON255471124e-06
NDAI0K013208.682ON2581361063e-05
SAKL0H06380g8.682ON219461044e-05
ZYRO0F07480g8.682ON236321036e-05
KLLA0D06061g8.682ON249451002e-04
Kwal_26.88288.682ON22373983e-04
TDEL0A062708.682ON24235958e-04
Kpol_1072.128.682ON22269940.001
Kpol_1013.98.682ON26131920.002
KLTH0D11396g8.682ON22537900.004
TBLA0B038008.682ON32431900.004
CAGL0M02101g8.682ON26728850.015
KAFR0H023808.682ON22039830.024
Skud_14.423.62ON52480840.029
Kpol_1066.443.62ON479133780.16
Ecym_23908.682ON22731760.19
NCAS0A099403.62ON49427750.36
ZYRO0C02244g3.62ON46027730.57
TDEL0E007103.62ON476135730.61
TBLA0B085103.62ON501138720.89
TBLA0B027208.798ON50233701.5
KLLA0A07447g3.62ON486137682.5
YNL295W3.62ON52427673.5
Suva_14.443.62ON525143665.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.445
         (215 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   333   e-117
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   299   e-103
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   289   e-100
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   288   1e-99
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   135   2e-39
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   132   2e-38
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   132   5e-38
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   132   1e-37
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   130   4e-37
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   130   4e-37
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   126   7e-36
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   117   1e-31
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   100   1e-25
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    91   6e-23
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    67   2e-14
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    66   8e-14
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    66   3e-13
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    68   3e-13
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    60   2e-11
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    62   7e-11
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    60   2e-10
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    60   2e-10
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    58   1e-09
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    52   1e-08
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    55   1e-08
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    54   2e-08
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    52   1e-07
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    48   4e-06
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    45   3e-05
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    45   4e-05
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    44   6e-05
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    43   2e-04
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    42   3e-04
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    41   8e-04
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    41   0.001
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    40   0.002
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    39   0.004
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    39   0.004
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    37   0.015
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    37   0.024
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    37   0.029
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    35   0.16 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    34   0.19 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    33   0.36 
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    33   0.57 
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    33   0.61 
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    32   0.89 
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    32   1.5  
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    31   2.5  
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    30   3.5  
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    30   5.3  

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  333 bits (853), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 166/197 (84%)

Query: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60
           MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY
Sbjct: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXX 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLL       
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPA 120

Query: 121 XXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                    MHKNVLF               TWKYNPTVPNELLPFNWWSTSSMGMEYFP
Sbjct: 121 AEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180

Query: 181 EWKNVPSYMMRKLKPFD 197
           EWKNVPSYMMRKLKPFD
Sbjct: 181 EWKNVPSYMMRKLKPFD 197

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  299 bits (765), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 143/197 (72%), Positives = 155/197 (78%)

Query: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60
           MILLRKT+IRGL   R+RS++  A +QRRT TRLVNP+RQQHQQI+KQR+SK+FKN HF+
Sbjct: 1   MILLRKTEIRGLSSARVRSTMIFASVQRRTLTRLVNPVRQQHQQISKQRNSKLFKNAHFF 60

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXX 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+ SLQMLL       
Sbjct: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPA 120

Query: 121 XXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                     HKNV F               TWKYNPTVPNELLP+NWWSTSSMGMEYFP
Sbjct: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180

Query: 181 EWKNVPSYMMRKLKPFD 197
           EWKNVPSYMMRKLKPFD
Sbjct: 181 EWKNVPSYMMRKLKPFD 197

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  289 bits (740), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 143/197 (72%), Positives = 151/197 (76%), Gaps = 9/197 (4%)

Query: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60
           MILL +TKI+G+ F         A IQRRTH+RLVNPIRQQHQQITKQRSSKIFKNVHFY
Sbjct: 1   MILLTRTKIKGVSF---------ASIQRRTHSRLVNPIRQQHQQITKQRSSKIFKNVHFY 51

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXX 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK+ SLQMLL       
Sbjct: 52  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPI 111

Query: 121 XXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                     HKN+LF               TWKYNPTVPNELLPFNWWSTSSMGMEYFP
Sbjct: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171

Query: 181 EWKNVPSYMMRKLKPFD 197
           EW+N+PSYM RKLKPFD
Sbjct: 172 EWRNIPSYMTRKLKPFD 188

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  288 bits (738), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 143/197 (72%), Positives = 150/197 (76%), Gaps = 7/197 (3%)

Query: 1   MILLRKTKIRGLPFTRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFY 60
           MILL++TKIRG+       SV+   +QRRTH+RLVNPIRQQHQQITKQRSSKI KN HFY
Sbjct: 1   MILLKRTKIRGV-------SVSFVSLQRRTHSRLVNPIRQQHQQITKQRSSKILKNAHFY 53

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXX 120
           DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKR SLQ LL       
Sbjct: 54  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTN 113

Query: 121 XXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                     HKN+LF               TWKYNPTVPNELLPFNWWSTSSMGMEYFP
Sbjct: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173

Query: 181 EWKNVPSYMMRKLKPFD 197
           EWKNVP YMMRKLKPFD
Sbjct: 174 EWKNVPPYMMRKLKPFD 190

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  135 bits (339), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/142 (47%), Positives = 91/142 (64%), Gaps = 6/142 (4%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKR-----DSLQMLLXXX 116
           FRS+P+VPTTQ+LE+RELTRDIL+SGYRPVMYPVKENPLF+++ R     D LQ      
Sbjct: 25  FRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSG 84

Query: 117 XXXXXXXXXXXXXMHK-NVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMG 175
                          + +V+                TW+    +P++LLP++WWST+SMG
Sbjct: 85  LRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWWSTTSMG 144

Query: 176 MEYFPEWKNVPSYMMRKLKPFD 197
           ME+FPEW+ VP +++RKLKPFD
Sbjct: 145 MEFFPEWEGVPRHVVRKLKPFD 166

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  132 bits (332), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXX 121
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+  +  L  +         
Sbjct: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNK--LMAISHPEHDTEG 89

Query: 122 XXXXXXXXMHKNV-LFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                      N  LF               TWKY P +P ++LPFNWWS SS+ ME +P
Sbjct: 90  TEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYP 149

Query: 181 EWKNVPSYMMRKLKPFD 197
           EW +VP ++++ LKPFD
Sbjct: 150 EWSSVPKHVVKGLKPFD 166

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  132 bits (331), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (60%), Gaps = 1/137 (0%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXX 121
           F++LP+VPTT+YLE+ +LT DIL+SGYRP+ YPVKENPLFR+  + +   L         
Sbjct: 51  FKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEKN 110

Query: 122 XXXXXXXXMHK-NVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                       +VL                TWKYNPTVP  LLP+NWWSTS MGMEY+P
Sbjct: 111 NPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGMEYYP 170

Query: 181 EWKNVPSYMMRKLKPFD 197
           EW NVP   ++ LKPF+
Sbjct: 171 EWNNVPRRFLKTLKPFE 187

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  132 bits (333), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 79/137 (57%), Gaps = 1/137 (0%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKRDSLQMLLXXXXXXX 120
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    +R  L           
Sbjct: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSAKKEYK 82

Query: 121 XXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                       NV+                TW+YNP +P +LLP+N WS+S+M MEY+P
Sbjct: 83  NEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142

Query: 181 EWKNVPSYMMRKLKPFD 197
           EW NVP  +  KLKPFD
Sbjct: 143 EWLNVPKTIANKLKPFD 159

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  130 bits (327), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 88/148 (59%), Gaps = 3/148 (2%)

Query: 50  SSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSL 109
           +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF++    + 
Sbjct: 11  ASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQ 70

Query: 110 QMLLXXXXXXXXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWW 169
           ++                    KN +                TW+YNP +P++LLPF+ W
Sbjct: 71  RL---REEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLW 127

Query: 170 STSSMGMEYFPEWKNVPSYMMRKLKPFD 197
           S++SM MEY PEW  VP  ++ KL+PF+
Sbjct: 128 SSTSMAMEYHPEWLAVPRTVVNKLRPFN 155

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  130 bits (328), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 90/156 (57%), Gaps = 3/156 (1%)

Query: 42  HQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 101
           H++     +SK+ K      FRSLPKVPTTQYLE  ELTRDILYSGYRPV+YPVKENPLF
Sbjct: 3   HKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLF 62

Query: 102 RDKKRDSLQMLLXXXXXXXXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPN 161
           ++    + Q L                 M  N +                TW+YNP +P+
Sbjct: 63  KEAGWKT-QRLRGERGARKSSTVPQSSEM--NAMAGPLGTGGIGSGGVNGTWRYNPRIPS 119

Query: 162 ELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPFD 197
           +LLP+N WS +SM MEY PEW  VP  ++ KL+PF+
Sbjct: 120 KLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFE 155

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  126 bits (316), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 81/143 (56%), Gaps = 8/143 (5%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXX 121
           FRSLP+VPTTQ+LE+  LT DIL+SGYRP+ YPVKENPLFR+                  
Sbjct: 36  FRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDLVNAESN 95

Query: 122 XXXXXXXXMHK--------NVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSS 173
                    H         N L                TW++NP VP++LLP++WWSTS 
Sbjct: 96  SNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYSWWSTSI 155

Query: 174 MGMEYFPEWKNVPSYMMRKLKPF 196
           MGMEY+PEWKN+P  +++ LKP+
Sbjct: 156 MGMEYYPEWKNIPRKVVKDLKPY 178

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  117 bits (294), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 77/136 (56%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXX 121
           FR++PKVP T+YLE +EL++D+LYSGYRP+MYPVKENPLFR   + +             
Sbjct: 129 FRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTTSSS 188

Query: 122 XXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 181
                     +                   TW+Y+P +PN LLP   WS S MGMEY+PE
Sbjct: 189 SSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYPE 248

Query: 182 WKNVPSYMMRKLKPFD 197
           WK VP  +++ LKPFD
Sbjct: 249 WKGVPFNIVKNLKPFD 264

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  100 bits (248), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 75/135 (55%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXX 121
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+ K ++              
Sbjct: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71

Query: 122 XXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 181
                        +                TW+YNP +PN+LL    WS+S+MGME++PE
Sbjct: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131

Query: 182 WKNVPSYMMRKLKPF 196
           W +VP+ +   LKP+
Sbjct: 132 WNDVPNKVSASLKPY 146

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 90.9 bits (224), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 78/151 (51%), Gaps = 50/151 (33%)

Query: 50  SSKIFKNVHFYD--FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF-RDKKR 106
           SS++++     D  FR+LP+VPTT++LE + L+ DIL+SGYRPVMYPV+ENPLF R  K 
Sbjct: 17  SSRVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRGTKT 76

Query: 107 DSLQMLLXXXXXXXXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPF 166
           ++   L                                                + L  +
Sbjct: 77  EAPASL-----------------------------------------------ESNLPRY 89

Query: 167 NWWSTSSMGMEYFPEWKNVPSYMMRKLKPFD 197
           + WST++MG+E FPEW NVP  ++RKL+PFD
Sbjct: 90  DLWSTTTMGLERFPEWSNVPREVVRKLRPFD 120

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
           YPR151C
          Length = 71

 Score = 67.0 bits (162), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (79%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 105
            R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+ +
Sbjct: 16  LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGE 59

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
           Ashbya gossypii AFR315C
          Length = 87

 Score = 65.9 bits (159), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 34/44 (77%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKK 105
            R LP+VPTTQYL   EL  DI +SGYRP++YPVK+NPLFR  K
Sbjct: 10  LRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSK 53

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 66.2 bits (160), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 67/158 (42%), Gaps = 55/158 (34%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXX 121
           FR LPKVP T+YLE R L+ D+LY+GYRP++YP++ENPL                     
Sbjct: 8   FRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLL-------------------- 47

Query: 122 XXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELL--PFNWWSTSSMG---- 175
                    H NV                   K +    NELL  P      S+MG    
Sbjct: 48  --------CHSNV-----RETHYYGESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRM 94

Query: 176 ----------------MEYFPEWKNVPSYMMRKLKPFD 197
                           MEY+PEW+ VP  +++++KP++
Sbjct: 95  ADPSKVKLGLSYSIMGMEYYPEWEKVPRDVVKRIKPYE 132

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 43/53 (81%), Gaps = 6/53 (11%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR------DKKRDS 108
           FR LPKVP T+YLE ++L+++IL++GY+P+MYPV+ENPLF+      D KR++
Sbjct: 118 FRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKREN 170

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (75%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPFD 197
           WSTS +G++ +PEW NVP   ++ LKPFD
Sbjct: 189 WSTSILGLQDYPEWNNVPWNNIKNLKPFD 217

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
           Anc_3.496 YPR151C
          Length = 79

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%)

Query: 63  RSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLF 101
           ++LP+VPTT+YL+  +L  DILY+GYRPV+YP+KENPL 
Sbjct: 9   KNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 61.6 bits (148), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 75/164 (45%), Gaps = 49/164 (29%)

Query: 37  PIRQQHQQITKQRSSKIFKNVHF----YDFRSLPKVPTTQYLEARELTRDILYSGYRPVM 92
           P+ +Q++ ITK+  S + +  H      DF  LP+VP+T +L+  ++T ++LYSGYRP+ 
Sbjct: 72  PLIKQNKTITKKEHSDV-RGSHLKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRPLF 130

Query: 93  YPVKENPLFRDKKRDSLQMLLXXXXXXXXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXT 152
                NP     K D+   L                                        
Sbjct: 131 I----NPNDPKLKEDTGSTL---------------------------------------- 146

Query: 153 WKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           +++   + +   P + W +S+ G+E+F EW+N+PS +++ LKPF
Sbjct: 147 YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 49/170 (28%)

Query: 31  HTRLVNPIRQQHQQITKQRSSKIFKNVH----FYDFRSLPKVPTTQYLEARELTRDILYS 86
            T    P+ +Q +QI K  S+ I +  H      DF  LP+VP+T +L+  ++T ++LYS
Sbjct: 66  ETERTAPLIKQSEQIAKNDSTSI-RASHPRKKRRDFSWLPRVPSTSHLKHTDMTTNVLYS 124

Query: 87  GYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXXXXXXXXXXMHKNVLFXXXXXXXXXX 146
           GYRP+      NP     K D+   L                                  
Sbjct: 125 GYRPLFI----NPNDPKLKEDTGSTL---------------------------------- 146

Query: 147 XXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
                 +++   + +   P + W +S+ G+E+F EW+N+PS +++ LKPF
Sbjct: 147 ------YEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 73/168 (43%), Gaps = 49/168 (29%)

Query: 33  RLVNPIRQQHQQITKQRSSKIFKNVHFY----DFRSLPKVPTTQYLEARELTRDILYSGY 88
               P+ +Q + I K  S+ I +  H      DF  LP+VP+T +L+  ++T ++LYSGY
Sbjct: 68  ECTTPLIEQSEAIAKTDSTNI-RASHSRKKRRDFSWLPRVPSTSHLKHSDMTTNVLYSGY 126

Query: 89  RPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXXXXXXXXXXMHKNVLFXXXXXXXXXXXX 148
           RP+      NP     K D+   L                                    
Sbjct: 127 RPIFI----NPNDPKLKEDTGSTL------------------------------------ 146

Query: 149 XXXTWKYNPTVPNELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
               +++   + +   P + W +S+ G+E+F EW+N+PS +++ LKPF
Sbjct: 147 ----YEFAMKLDDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 60/136 (44%), Gaps = 44/136 (32%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXX 120
           DF  LPKVP+T +L+  ++T ++LYSGYRP+      NP     K D+   L        
Sbjct: 99  DFSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFI----NPNDPKLKEDTGSTL-------- 146

Query: 121 XXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                                           +++   + +   P + W +S+ G+E+F 
Sbjct: 147 --------------------------------YEFAMKLEDLNEPLSPWISSATGLEFFS 174

Query: 181 EWKNVPSYMMRKLKPF 196
           EW N+PS ++R LKPF
Sbjct: 175 EWDNIPSELLRNLKPF 190

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR151C
           (SUE1)
          Length = 77

 Score = 52.0 bits (123), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR 102
           FR LP+VP+TQ+L A ++  DIL+S +RP+ YPV +NPL R
Sbjct: 7   FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 59/138 (42%), Gaps = 31/138 (22%)

Query: 60  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXX 119
           +D+ +LPKV     L   E++ DILYSGYRP+         F+D +  S +         
Sbjct: 85  FDYSTLPKVEPITNLRHNEISTDILYSGYRPLFLN------FKDLENSSRKAEFGNS--- 135

Query: 120 XXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWW-STSSMGMEY 178
                      + + L+                   +P   +     N+W STS+ GME 
Sbjct: 136 -----------NNSTLYEIAMKLD----------DLSPEAISGSTSSNFWHSTSATGMEV 174

Query: 179 FPEWKNVPSYMMRKLKPF 196
           F EW NVP+ +++ LKPF
Sbjct: 175 FDEWDNVPNSILKNLKPF 192

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 63/154 (40%), Gaps = 38/154 (24%)

Query: 44  QITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD 103
           Q++   S K   +    D+  LPKVP T  +  RE+T + LYSGYRP         LF D
Sbjct: 74  QMSGGLSGKSLADKKVLDYSWLPKVPQTSSITHREITTNSLYSGYRP---------LFID 124

Query: 104 KKRDSLQMLLXXXXXXXXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNEL 163
            K+ +L                                           +++   + NEL
Sbjct: 125 NKKGTL----------------------------LGDVNSTAQDANSSIYEFAMKL-NEL 155

Query: 164 LPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPFD 197
              + W  S+ G+E + EW  VPS +++KLKP+D
Sbjct: 156 SEPSPWMMSATGLESYSEWDYVPSKVIKKLKPYD 189

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 54/137 (39%), Gaps = 33/137 (24%)

Query: 60  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXX 119
           Y +  LP VP+TQ++EA ++  ++LYSGYR         PLF D                
Sbjct: 91  YRYHPLPSVPSTQHIEANDMCTELLYSGYR---------PLFLDS--------------- 126

Query: 120 XXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYF 179
                     + + +L                +  Y   +  E  P   W+ S+ G+E +
Sbjct: 127 --------TALERGLLAAKEQASFTQSASPTGSTFYEIAMKLE-DPACIWANSATGLEKY 177

Query: 180 PEWKNVPSYMMRKLKPF 196
            EW N+P  +   LKPF
Sbjct: 178 TEWDNIPYSVANSLKPF 194

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 6/47 (12%)

Query: 60  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPV------KENPL 100
           +D+ SLPK PTT +L + E   D+ YSGYRP+   V      +ENP 
Sbjct: 101 FDYSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENPC 147

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W  S+ G E + EW N+P  ++  LK F
Sbjct: 169 WLFSATGSELYKEWDNIPKSVLDNLKCF 196

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 52/136 (38%), Gaps = 41/136 (30%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXX 120
           +F  LPK+     L  ++++  +LYSGYRP+  P   N  F+  ++++   L        
Sbjct: 90  NFSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQGQKNNGSTLYEFAMKLD 146

Query: 121 XXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180
                                              N T+         W TS+ G+E F 
Sbjct: 147 EFKKDK-----------------------------NSTI---------WDTSATGVETFT 168

Query: 181 EWKNVPSYMMRKLKPF 196
           EW NVP  ++R LKPF
Sbjct: 169 EWDNVPESVIRNLKPF 184

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 31/46 (67%)

Query: 46  TKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
           +K+R+         +D+  LPK P+T++L+ RE++ D+ YSGYRP+
Sbjct: 64  SKKRTQVELSGKKRHDYSWLPKAPSTEHLKLREISTDVFYSGYRPI 109

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (78%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ G E++ EW NVP+ +++KLKPF
Sbjct: 139 WVSSATGTEFYGEWDNVPTEVIKKLKPF 166

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%)

Query: 60  YDFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
           YD+  LP+VP+T YL  R+++  ILYSGYRP+
Sbjct: 83  YDYSWLPRVPSTNYLRPRDMSSKILYSGYRPL 114

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 162 ELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPFD 197
           EL   + W++S+ G E +PEW  VP  + RKLKPF+
Sbjct: 145 ELGEQSLWTSSATGQEIYPEWDYVPMEVQRKLKPFN 180

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 3/45 (6%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYP---VKENPLFR 102
           D+  LP+VPTT+++   E   D+LYSGYRP++      KEN L +
Sbjct: 108 DYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQ 152

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ G E+F EW NVPS +++ LKPF
Sbjct: 166 WVSSATGQEFFSEWDNVPSEIIKDLKPF 193

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 27  QRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHF-YDFRSLPKVPTTQYLEARELTRDILY 85
           +R++   +        +Q +K+R +   K      DF  LPK P+T +L+ R+++  +LY
Sbjct: 46  KRKSRKNVGQSAEPASEQSSKKRVAVELKGKQLKTDFSWLPKAPSTDHLKQRDVSTTLLY 105

Query: 86  SGYRP-VMYPVKE 97
           SGYRP V+ P  +
Sbjct: 106 SGYRPFVLAPADQ 118

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ G E++ EW  VP+ ++++L+PF
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPF 168

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%)

Query: 162 ELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           EL   + W TS+ G+EY+ EW ++P  + +KLKPF
Sbjct: 151 ELGDQSPWVTSATGLEYYREWDSIPGELQKKLKPF 185

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 39  RQQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
           R Q +++T + S +  K    +D+  LP+VP+T  L+ R+++  +LYSGYRP+
Sbjct: 71  RSQQKKMTVEISGRGRKQ-QRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYRPL 122

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 40  QQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENP 99
            Q  Q+ K  ++    N    D+  LPKVP+ + L  +++T DI YSG+RP+     E  
Sbjct: 72  SQKLQLNKYNNNTQLNNDLVVDYSWLPKVPSNKRLTHQDITTDIFYSGFRPLSIDPTE-- 129

Query: 100 LFRDKKRDS 108
              +K  DS
Sbjct: 130 -LENKDEDS 137

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 19/28 (67%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W++S+ GME + EW +VP  ++  L PF
Sbjct: 160 WTSSATGMERYREWHSVPEEVINSLTPF 187

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
           D+  LPKVP+T+ L  RE+    LYSGYRP+
Sbjct: 108 DYSWLPKVPSTENLNHREIRTSALYSGYRPI 138

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ GME + EW +VP  +++ LKPF
Sbjct: 175 WMSSATGMELYSEWDHVPLDVLKDLKPF 202

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKE 97
           DF  LPK P+T +L+ R+++  +LYSGYRP +    E
Sbjct: 81  DFSWLPKAPSTDHLKHRDVSTTLLYSGYRPFVLNSSE 117

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 22/28 (78%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ G E++ EW N+P+ +++KL+PF
Sbjct: 141 WISSATGTEFYGEWDNIPADVIKKLRPF 168

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 24/31 (77%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
           D+  LPKVPT + L+ R++  ++LYSGYRP+
Sbjct: 163 DYSWLPKVPTLKNLKQRDVMTNVLYSGYRPL 193

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 3/35 (8%)

Query: 162 ELLPFNWWSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           E+ P   W +S+ G+E + EW ++P  +++KLKP 
Sbjct: 231 EIFP---WMSSAAGLEVYSEWDSIPIEVLKKLKPL 262

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W +S+ G E + EW NVP  +++ LKPF
Sbjct: 174 WVSSATGSEMYAEWDNVPGDVIKDLKPF 201

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/70 (21%), Positives = 38/70 (54%)

Query: 27  QRRTHTRLVNPIRQQHQQITKQRSSKIFKNVHFYDFRSLPKVPTTQYLEARELTRDILYS 86
           +++ ++ + +  ++    +   +S K       YD+ +LP+V      + + ++ ++LYS
Sbjct: 78  KKQYNSGVTSAAQEAGGAVRDLKSEKAQTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYS 137

Query: 87  GYRPVMYPVK 96
           GYRP+ + V+
Sbjct: 138 GYRPLFFDVE 147

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 36.6 bits (83), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 27/39 (69%)

Query: 60  YDFRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKEN 98
           Y + +LP+VP+T  ++ ++L  ++L+S YRP+   +K +
Sbjct: 86  YKYSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 45/80 (56%), Gaps = 7/80 (8%)

Query: 15  TRIRSSVTLARIQRRTHTRLVNPIRQQHQQITKQRSS--KIF-KNVHFYDFRSLPKVPTT 71
           ++I+ +    ++     +  V+ ++Q +Q +    +S  K+F  N+H      +PKV +T
Sbjct: 62  SKIKRAYNGGKVAEGGGSHTVSALQQMNQSVDNVGTSRPKMFGSNLHLL----VPKVAST 117

Query: 72  QYLEARELTRDILYSGYRPV 91
           +Y+  +E+  + L++GYRP+
Sbjct: 118 EYIPIKEVHTEGLFAGYRPL 137

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 50/133 (37%), Gaps = 6/133 (4%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXXXXX 124
           LP+VP+T+ +   E+  D L++GYRP+   +   P+   +K   L   L           
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF--LGNCPIDDAEKGSELDRFLASFSDLKLLNN 131

Query: 125 XXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFPE-WK 183
                    +                     N      ++P   W  S  G+ Y    +K
Sbjct: 132 EDSDSKEVKIEDILEDIQNDIRNATNEDIGDNSRTRKPVVP---WDASISGLIYNDRPFK 188

Query: 184 NVPSYMMRKLKPF 196
           N+P+ ++ KLKPF
Sbjct: 189 NIPNEVVSKLKPF 201

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 61  DFRSLPKVPTTQYLEARELTRDILYSGYRPV 91
           D+   P  P T++L+  ++  D+LYSGYRP+
Sbjct: 85  DYSWFPVAPKTEHLKEGDIAVDLLYSGYRPL 115

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 169 WSTSSMGMEYFPEWKNVPSYMMRKLKPF 196
           W  ++ G   + EW NVP  ++R L+P+
Sbjct: 145 WVKNATGRVLYDEWDNVPQSVIRNLRPY 172

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 21/27 (77%)

Query: 65 LPKVPTTQYLEARELTRDILYSGYRPV 91
          +PKVPTT Y+ + E+  + L++GY+P+
Sbjct: 70 VPKVPTTDYIPSLEMQTEGLFAGYKPL 96

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 65 LPKVPTTQYLEARELTRDILYSGYRPV 91
          +P+VP T Y+ A E+  + L++GYRP+
Sbjct: 58 VPRVPPTDYISAPEIQTEGLFAGYRPL 84

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 32.7 bits (73), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 52/135 (38%), Gaps = 13/135 (9%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXXXXX 124
           LP+VP+T Y+   E+  + L++GYRP+   +  + L  + + ++L               
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF--LGNSSLRPETRTNALDNFFTSFANLKVTSE 132

Query: 125 XXXXXMH--KNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYFP-E 181
                    ++V+                     P +P        W  S  GM Y    
Sbjct: 133 SKNSAEEEVQDVIEELKRDSAQLNLKNSKGKNRKPIIP--------WDASISGMVYNDHS 184

Query: 182 WKNVPSYMMRKLKPF 196
           +K+VP  ++ KLKPF
Sbjct: 185 FKDVPKSVVSKLKPF 199

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 56/138 (40%), Gaps = 13/138 (9%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXXXXX 124
           +P+V +T+ + + E+  D L++GYRP+   + E+ + R +K   L               
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPLF--LGESSIKRRRKASPLDKFFHSVETHTRNRE 147

Query: 125 XXXXXMH-----KNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMGMEYF 179
                +       N+                   K  P  P  ++P   W  S  G+ Y 
Sbjct: 148 SGKSTLGIQDIIDNLRKDHEEENLEIEEHSDKNTKVEPRKP--VIP---WDASVSGIFYK 202

Query: 180 PE-WKNVPSYMMRKLKPF 196
            + +KNVP ++M KLKP+
Sbjct: 203 DQSFKNVPKHVMNKLKPY 220

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 62  FRSLPKVPTTQYLEARELTRDILYSG--YRPVM 92
           +  LP +P T YL A+ L +DI+ SG  Y P+ 
Sbjct: 273 YNHLPSLPDTLYLNAKNLGQDIISSGPLYSPIF 305

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 54/137 (39%), Gaps = 19/137 (13%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLXXXXXXXXXXX 124
           +P+VP+T YL   +L  + L++GY+P+   +  +PL    + ++  +LL           
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPL----ESNNNDVLLDGLFSSIRKLK 143

Query: 125 XXXXXMHKNVLFXXXXXXXXXXXXXXXTW----KYNPTVPNELLPFNWWSTSSMGMEYFP 180
                   N +                 +    +  P +P        W  S  G+ Y  
Sbjct: 144 NAQINSENNTVEIDVSDMLDDLKKDNQEYQRLHEKAPKIP--------WDASISGLVYND 195

Query: 181 E-WKNVPSYMMRKLKPF 196
           E +K VP  ++ KLKPF
Sbjct: 196 EPFKGVPRSVVSKLKPF 212

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 20/27 (74%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPV 91
           +P+V +T Y+  +E+  + L++GYRP+
Sbjct: 111 VPRVASTDYISNKEVHTEGLFAGYRPL 137

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 58/143 (40%), Gaps = 24/143 (16%)

Query: 65  LPKVPTTQYLEARELTRDILYSGYRPVM-----YP--VKENPLFRDKKR--DSLQMLLXX 115
           +PKV +T ++  +E+  + L++GYRP+      +P  V++   F D      ++Q++   
Sbjct: 112 VPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLPNIQLVDAS 171

Query: 116 XXXXXXXXXXXXXXMHKNVLFXXXXXXXXXXXXXXXTWKYNPTVPNELLPFNWWSTSSMG 175
                         + +  L                + K  P +P        W  S  G
Sbjct: 172 EKDGKLNVQEIIEDLQRTSL----RESISNMEQSSSSHKRRPVIP--------WDASISG 219

Query: 176 MEY--FPEWKNVPSYMMRKLKPF 196
           M Y   P +K++P  ++ KLKPF
Sbjct: 220 MVYNDMP-FKHIPKNVVSKLKPF 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,509,329
Number of extensions: 606445
Number of successful extensions: 2236
Number of sequences better than 10.0: 57
Number of HSP's gapped: 2258
Number of HSP's successfully gapped: 87
Length of query: 215
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 110
Effective length of database: 41,441,469
Effective search space: 4558561590
Effective search space used: 4558561590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)