Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4443.493ON1731737661e-105
Smik_16.4023.493ON1731737266e-99
YPR149W (NCE102)3.493ON1731737223e-98
Suva_16.4783.493ON1661736363e-85
CAGL0I10494g3.493ON1721465688e-75
CAGL0L08448g3.493ON1731445462e-71
NDAI0B058803.493ON1821545091e-65
KAFR0C019703.493ON1791514969e-64
NDAI0G009303.493ON1761484784e-61
YGR131W (FHN1)3.493ON1741454767e-61
NCAS0E008003.493ON1741464742e-60
TDEL0D056103.493ON1751474663e-59
Suva_7.4193.493ON1741464602e-58
KNAG0B008003.493ON1821544516e-57
KNAG0A079503.493ON1821544386e-55
KLLA0D16280g3.493ON1691444351e-54
Smik_6.2273.493ON1741464272e-53
SAKL0F02750g3.493ON1701444211e-52
NCAS0F035603.493ON1831554203e-52
Skud_7.4423.493ON1741454152e-51
TPHA0D032803.493ON1841554082e-50
ZYRO0D09966g3.493ON1781444073e-50
KAFR0G037003.493ON1861464031e-49
Kpol_1017.63.493ON1871584022e-49
KLTH0F14850g3.493ON1711434002e-49
Kwal_55.212383.493ON1701443742e-45
TBLA0D029603.493ON1891453692e-44
TBLA0C044903.493ON1861343664e-44
Ecym_12363.493ON1691453047e-35
AFR312W3.493ON1681432516e-27
Suva_4.272.61ON322123691.3
Suva_9.1092.293ON49157672.5
Skud_9.832.293ON49157662.8
Smik_9.892.293ON49157663.4
Suva_8.2125.502ON53793653.8
KNAG0B038505.502ON55657645.1
Smik_4.212.61ON316126645.7
YOR161C (PNS1)5.502ON53964637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.444
         (173 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   299   e-105
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   284   6e-99
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   282   3e-98
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   249   3e-85
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   223   8e-75
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   214   2e-71
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   200   1e-65
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   195   9e-64
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   188   4e-61
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   187   7e-61
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   187   2e-60
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   184   3e-59
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   181   2e-58
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   178   6e-57
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   173   6e-55
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   172   1e-54
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   169   2e-53
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   166   1e-52
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   166   3e-52
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   164   2e-51
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   161   2e-50
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   161   3e-50
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   159   1e-49
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   159   2e-49
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   158   2e-49
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   148   2e-45
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   146   2e-44
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   145   4e-44
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   121   7e-35
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   101   6e-27
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     31   1.3  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...    30   2.5  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...    30   2.8  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...    30   3.4  
Suva_8.212 Chr8 complement(386129..387742) [1614 bp, 537 aa] {ON...    30   3.8  
KNAG0B03850 Chr2 complement(737681..739351) [1671 bp, 556 aa] {O...    29   5.1  
Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)     29   5.7  
YOR161C Chr15 complement(636939..638558) [1620 bp, 539 aa] {ON} ...    29   7.9  

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  299 bits (766), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 151/173 (87%)

Query: 1   MLAPADXXXXXXXXXXXXXXXXXXXXXXNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60
           MLAPAD                      NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120
           FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  284 bits (726), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 146/173 (84%)

Query: 1   MLAPADXXXXXXXXXXXXXXXXXXXXXXNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60
           MLA AD                      NTQD++SSRVN+CMFA AYGIFTDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120
           F EPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNN SYVDSN ITQGSGTRCRQA
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMS+FNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  282 bits (722), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 143/173 (82%), Positives = 145/173 (83%)

Query: 1   MLAPADXXXXXXXXXXXXXXXXXXXXXXNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60
           MLA AD                      NTQ R+SSRVN+CMFA AYGIFTDSLYGVFAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120
           F EPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNN SYVDSN ITQGSGTRCRQA
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  249 bits (636), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 126/173 (72%), Positives = 134/173 (77%), Gaps = 7/173 (4%)

Query: 1   MLAPADXXXXXXXXXXXXXXXXXXXXXXNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60
           MLAP D                      NTQ  NSSR+N+CMFA AY I TDSLYGVFAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120
           FFEPLAWPL+LF+LDFLNFVFTFTA       IRAHSC N++Y+ SN ITQGSG RCR+A
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173
           QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  223 bits (568), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 108/146 (73%), Positives = 125/146 (85%), Gaps = 3/146 (2%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           NT+ R+SSRVNFC+FAAAYGI TDSLYG+FANFFEPLAWPLVLF LDFLNFVFTFTAGTV
Sbjct: 29  NTRKRHSSRVNFCLFAAAYGIATDSLYGIFANFFEPLAWPLVLFVLDFLNFVFTFTAGTV 88

Query: 89  LAVGIRAHSCNNRSYVD-SNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMIS 147
           LAVGIRAHSCNN+ Y++    I QGSGTRCRQAQA VAF YFS AIFLAK +MS+ +++S
Sbjct: 89  LAVGIRAHSCNNKRYLERETKIVQGSGTRCRQAQALVAFFYFSMAIFLAKMIMSIVSVVS 148

Query: 148 NGAFGSGSFSKRRRTGQVGVPTISQV 173
           NGAFG+    +R+   +VGVP+ISQV
Sbjct: 149 NGAFGAK--LRRKHHTEVGVPSISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  214 bits (546), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 102/144 (70%), Positives = 119/144 (82%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVL 89
           T+DR+SSRVN+CMFAAAYGI TDSLYGVFANFFE LAWPL+LFTLDFLNF F  TAG VL
Sbjct: 30  TRDRHSSRVNYCMFAAAYGIATDSLYGVFANFFEILAWPLILFTLDFLNFAFMLTAGCVL 89

Query: 90  AVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNG 149
           AVGIRAHSCNN  Y ++N I QGS  RCR++QAAVAF +FS AIFLAK +MS+ N+ SNG
Sbjct: 90  AVGIRAHSCNNAHYRENNKIIQGSERRCRESQAAVAFFFFSMAIFLAKMIMSLLNIFSNG 149

Query: 150 AFGSGSFSKRRRTGQVGVPTISQV 173
           AFG+    +RR   +VGVP++SQV
Sbjct: 150 AFGTKFIRRRRNNAEVGVPSVSQV 173

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  200 bits (509), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 106/154 (68%), Positives = 120/154 (77%), Gaps = 9/154 (5%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLA-WPLVLFTLDFLNFVFTFTAGT 87
           NTQ  NSSR+NFCMFAAA+G+ TDS +GV  N F+ LA WP++LF  DFLNFVFTFTAGT
Sbjct: 29  NTQRNNSSRINFCMFAAAFGLLTDSFFGVAFNMFDALASWPILLFIFDFLNFVFTFTAGT 88

Query: 88  VLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMIS 147
           VLAV IRAHSC N  YV+SN ITQGS  RCR +QAAVAF YFSC IFLAK +MS  NM S
Sbjct: 89  VLAVAIRAHSCKNERYVNSNSITQGSENRCRMSQAAVAFFYFSCFIFLAKMIMSGINMAS 148

Query: 148 NGAFGSGSF----SKRR--RTG--QVGVPTISQV 173
           NG FGSG++    SKRR  R+G  +VGVPTISQV
Sbjct: 149 NGLFGSGTWAGSRSKRRTNRSGANEVGVPTISQV 182

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  195 bits (496), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 99/151 (65%), Positives = 120/151 (79%), Gaps = 6/151 (3%)

Query: 29  NTQD-RNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGT 87
           NTQ+  ++SRVN+CMFA A+G+F DS+YG+ ANFF+ LAWPL+LFTLDFLNF FTF+A T
Sbjct: 29  NTQNGHHNSRVNYCMFACAFGLFFDSIYGICANFFQVLAWPLLLFTLDFLNFAFTFSAAT 88

Query: 88  VLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMIS 147
            LAVGIRAHSC N+SY+DSN I +GSG RCR+AQA VAFLYFS AIF+AK +MS  N+  
Sbjct: 89  ALAVGIRAHSCGNQSYLDSNKIVRGSGQRCREAQALVAFLYFSTAIFIAKMIMSCINLFQ 148

Query: 148 NGAFGSGS---FSKRRR--TGQVGVPTISQV 173
           NGAF SGS    S+R++  T   GVP ISQV
Sbjct: 149 NGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  188 bits (478), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 112/148 (75%), Gaps = 3/148 (2%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           NTQ  ++SR+N+CMF   Y + TDS +G+ ANFFE L++P +LFTLDFLNF FTF AGTV
Sbjct: 29  NTQQGHNSRINYCMFTCVYCLLTDSFFGILANFFEFLSFPFILFTLDFLNFSFTFVAGTV 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LA GIR+HSCNN+SY+D N ITQGSG RCR++QA VAF YFS  IFL K  MS  +MI N
Sbjct: 89  LATGIRSHSCNNQSYLDRNKITQGSGNRCRESQALVAFFYFSMFIFLIKLAMSTISMIQN 148

Query: 149 GAFGSGSFSKRRR---TGQVGVPTISQV 173
           GAF +   S+RRR     +VGVP+ISQV
Sbjct: 149 GAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  187 bits (476), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 88/145 (60%), Positives = 109/145 (75%), Gaps = 1/145 (0%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVL 89
           TQ ++SSRVNFCMFAA YG+ TDSLYG  ANF+  L +P +L  LDFLNF+FTF A T L
Sbjct: 30  TQTKHSSRVNFCMFAAVYGLVTDSLYGFLANFWTSLTYPAILLVLDFLNFIFTFVAATAL 89

Query: 90  AVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNG 149
           AVGIR HSC N++Y++ N I QGS +RC Q+QAAVAF YFSC +FL K  ++   M+ NG
Sbjct: 90  AVGIRCHSCKNKTYLEQNKIIQGSSSRCHQSQAAVAFFYFSCFLFLIKVTVATMGMMQNG 149

Query: 150 AFGSGS-FSKRRRTGQVGVPTISQV 173
            FGS + FS+RR   Q+G+PTISQV
Sbjct: 150 GFGSNTGFSRRRARRQMGIPTISQV 174

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  187 bits (474), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 109/146 (74%), Gaps = 1/146 (0%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           NT+  N+SR+N+CMF  AY + TDS+YG+FANFF+ LA P + F LDFLNF FTF AGTV
Sbjct: 29  NTKTHNNSRINYCMFTCAYCLTTDSIYGIFANFFDILALPALCFCLDFLNFAFTFVAGTV 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LA GIRAHSC +  YV+SN ITQG   RCR++QA VAF YFS AIFLAK +MS  NMI N
Sbjct: 89  LATGIRAHSCKSEHYVNSNKITQGFKNRCRESQALVAFFYFSMAIFLAKLIMSTINMIQN 148

Query: 149 GAFGSGSFSKRRRT-GQVGVPTISQV 173
           GAF      +RRR   ++GVP+ISQV
Sbjct: 149 GAFTQHIGRRRRRNAAEIGVPSISQV 174

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  184 bits (466), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 95/147 (64%), Positives = 116/147 (78%), Gaps = 2/147 (1%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           +++D +SSRVNFCMFAAA+GI TDS YG+ AN +E  AWP++LF LDFLNF FTF+A T 
Sbjct: 29  SSEDGHSSRVNFCMFAAAFGIVTDSFYGILANIWEVFAWPVILFALDFLNFAFTFSAATA 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LAVGIR HSC N+ Y+DSN ITQGS  RCR AQA+VAF YFS  IFLAK +MS+  +I+N
Sbjct: 89  LAVGIRTHSCKNQDYLDSNNITQGSTQRCRLAQASVAFFYFSFFIFLAKMIMSLIGIITN 148

Query: 149 GAFGSGS--FSKRRRTGQVGVPTISQV 173
           G F S +   S+RR++ QVGVPTISQV
Sbjct: 149 GPFSSRTTLTSRRRKSAQVGVPTISQV 175

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  181 bits (460), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 89/146 (60%), Positives = 115/146 (78%), Gaps = 1/146 (0%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           ++Q ++SSRVNFCMFAAAYG+ TDS YG  AN +  L +P+++F LDFLNF+FTF AGT 
Sbjct: 29  SSQTKHSSRVNFCMFAAAYGLLTDSFYGCLANLWSSLTYPVIMFVLDFLNFLFTFIAGTA 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LAVGIR HSC+N++Y+D+N ITQGSG+RC QA+AAV F YFSC +FL K ++S+  M+ N
Sbjct: 89  LAVGIRCHSCSNKTYLDNNKITQGSGSRCHQAKAAVVFFYFSCILFLIKVVVSIAAMVQN 148

Query: 149 GAFGSGSFSKRRRT-GQVGVPTISQV 173
           G FG G+   RRR   Q+G+PTISQV
Sbjct: 149 GGFGFGNSFGRRRARRQMGIPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  178 bits (451), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 106/154 (68%), Gaps = 9/154 (5%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           NTQ  + SRVN+CMFAAAYGI TD LYG+ ANF+EPLAWPL+LFTLDFLNF FT TAG V
Sbjct: 29  NTQKFHISRVNYCMFAAAYGIATDGLYGLLANFWEPLAWPLILFTLDFLNFAFTLTAGIV 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LAVGIRAHSC N  Y + N I QGS  RCR +QAA AF +FS  IF+AK +MS  N+ SN
Sbjct: 89  LAVGIRAHSCKNVRYRERNHIIQGSENRCRISQAATAFFFFSMGIFIAKMVMSGINLASN 148

Query: 149 GAFGSGS---------FSKRRRTGQVGVPTISQV 173
           GAF + S                   GVP+ISQV
Sbjct: 149 GAFTTASSKFGRRRRHGGGVGVPETSGVPSISQV 182

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  173 bits (438), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 101/154 (65%), Positives = 115/154 (74%), Gaps = 9/154 (5%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           NTQ  +SSR+N+CMF AAYGI TDS YGV ANF+EPL+WPL+L  LDFLNFVFT TAG V
Sbjct: 29  NTQHGHSSRINYCMFTAAYGITTDSFYGVVANFWEPLSWPLLLGALDFLNFVFTLTAGCV 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LAVGIRAHSC N +Y + N I QGS  RCRQAQAAVAF +FS AIFLAK +MS+ N+ +N
Sbjct: 89  LAVGIRAHSCKNVAYRNKNKIVQGSENRCRQAQAAVAFFFFSMAIFLAKFIMSLVNIFTN 148

Query: 149 GAFGSGS-------FSKRRRTGQV--GVPTISQV 173
           G FGS         FSKR+RT  V  GVP IS V
Sbjct: 149 GPFGSAGSSPMGSRFSKRKRTQGVPQGVPNISTV 182

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  172 bits (435), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 86/144 (59%), Positives = 105/144 (72%), Gaps = 4/144 (2%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVL 89
           TQD +SSRVNF +FAA +GI  DSLY + ANF   LAWP++L +LDFLN+VFTF+A T L
Sbjct: 30  TQDHSSSRVNFAIFAAVFGIVFDSLYALIANFISALAWPIILVSLDFLNWVFTFSAATAL 89

Query: 90  AVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNG 149
           AVGIR  SC N S+   N I +GS  RCR+AQA+  FLYFS AIFL K ++S+ N I++G
Sbjct: 90  AVGIRGGSCTNDSFTSGNKIAEGSKDRCRKAQASTVFLYFSFAIFLVKFILSIVNAITSG 149

Query: 150 AFGSGSFSKRRRTGQVGVPTISQV 173
           AFG+ S     R  QVGVPTISQV
Sbjct: 150 AFGTSS----NRKTQVGVPTISQV 169

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  169 bits (427), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 87/146 (59%), Positives = 105/146 (71%), Gaps = 1/146 (0%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           +TQ ++SSRVNFCMF AAYG+ TDSLYG  ANF+  L +P +L  LD LNF+FTF A T 
Sbjct: 29  STQAKHSSRVNFCMFTAAYGLVTDSLYGFLANFWSSLTYPAILLALDILNFIFTFVAATA 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LAVGIR HSC N++Y++ N ITQ S +RC Q+QAAVAF YFSC +FL K  ++    I N
Sbjct: 89  LAVGIRCHSCKNKTYLEQNKITQASSSRCHQSQAAVAFFYFSCFLFLIKVTVTAAGTIQN 148

Query: 149 GAFGSGSFSKRRRT-GQVGVPTISQV 173
           G FG  S   RRR   Q+GVPTISQV
Sbjct: 149 GGFGFNSGFGRRRARRQLGVPTISQV 174

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  166 bits (421), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 108/144 (75%), Gaps = 3/144 (2%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVL 89
           TQD +S RVNF +F AA+ + TDS Y VFAN F   AWP++L T DFLNFVFTF+A T L
Sbjct: 30  TQDEHSPRVNFAIFTAAFALVTDSFYAVFANLFSAFAWPILLVTWDFLNFVFTFSAATAL 89

Query: 90  AVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNG 149
           AVGIR HSC N SY+ SN ITQGS  RCR+AQA VAFLYFS  IFL K ++SV N+ S+G
Sbjct: 90  AVGIRTHSCTNESYLFSNNITQGSTDRCRKAQATVAFLYFSFFIFLTKLVLSVINVFSSG 149

Query: 150 AFGSGSFSKRRRTGQVGVPTISQV 173
           AFGSGS S+R     VGVPTISQV
Sbjct: 150 AFGSGSGSRR---ANVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  166 bits (420), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 97/155 (62%), Positives = 117/155 (75%), Gaps = 10/155 (6%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLA-WPLVLFTLDFLNFVFTFTAGT 87
           +TQ+  SSRVN+CMFAAA+G+ TDS +G+ AN  + L+ WP++LF  DFLNFVFTFTAGT
Sbjct: 29  STQNHGSSRVNYCMFAAAFGLLTDSFFGMAANLIDFLSSWPIILFVFDFLNFVFTFTAGT 88

Query: 88  VLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMIS 147
           VLAVGIR HSCNNR Y++SN I QGSG RCR +QAAVAF YF+  +FLAK +MS  +M S
Sbjct: 89  VLAVGIRCHSCNNRRYLESNKIIQGSGIRCRVSQAAVAFFYFAAFVFLAKMIMSAISMAS 148

Query: 148 NGAFGSGSFSKRRR---------TGQVGVPTISQV 173
           NGAFGSGSF  RR+         T   GVPTIS+V
Sbjct: 149 NGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTISEV 183

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  164 bits (415), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 107/145 (73%), Gaps = 1/145 (0%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVL 89
           TQ   SSRVNFCMFAAAYG+ TDS YG  ANF+  L +P +L  LDFLNF+FTF A T L
Sbjct: 30  TQTNGSSRVNFCMFAAAYGLITDSFYGFLANFWSSLTYPAILLVLDFLNFLFTFAAATAL 89

Query: 90  AVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNG 149
           AVGIR HSC N++Y++ N ITQGS +RC Q+QAAVAF YFSC +FL K  +SV  M+ NG
Sbjct: 90  AVGIRCHSCKNKTYLEQNNITQGSSSRCHQSQAAVAFFYFSCFLFLIKVTVSVAGMMQNG 149

Query: 150 AFG-SGSFSKRRRTGQVGVPTISQV 173
            FG +  + +RR   Q+GVPTISQV
Sbjct: 150 GFGFNTGYGRRRARRQMGVPTISQV 174

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  161 bits (408), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 108/155 (69%), Gaps = 11/155 (7%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFE-PLAWPLVLFTLDFLNFVFTFTAGTV 88
           TQ+++SSRVN+C+F   + + TD+ YG  AN +  PLAWP++LF  DFLNF FTFTAGTV
Sbjct: 30  TQNQHSSRVNYCIFVPPFALVTDTFYGALANIWSTPLAWPIILFCFDFLNFAFTFTAGTV 89

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           LAVG R HSC N+SY+DSN ITQGS  RCR+AQAA AF YFS  IFLAK +MS  N+ +N
Sbjct: 90  LAVGTRTHSCTNQSYLDSNNITQGSTDRCRKAQAATAFFYFSFFIFLAKLIMSSINLFTN 149

Query: 149 GAFGSGSF----------SKRRRTGQVGVPTISQV 173
           GA GS SF               + Q+GVP ISQV
Sbjct: 150 GALGSMSFGRRRGGAGVGVPGAASPQIGVPNISQV 184

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  161 bits (407), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 108/144 (75%), Gaps = 4/144 (2%)

Query: 34  NSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGI 93
           ++SRVNFCMFAAA+GI  DS YG+ AN F P A+P++LF LDFLNFVFTFTA T LAVGI
Sbjct: 35  HNSRVNFCMFAAAFGIVADSFYGILANIFVPFAFPVILFILDFLNFVFTFTAATALAVGI 94

Query: 94  RAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGA--- 150
           R HSC NR Y+DSN ITQGS +RCR+AQA VAF YF+  IFL K +MS  +++SNGA   
Sbjct: 95  RTHSCTNRHYLDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGS 154

Query: 151 -FGSGSFSKRRRTGQVGVPTISQV 173
             G  S  +R +   VGVPTISQV
Sbjct: 155 SSGFSSRRRRTQQANVGVPTISQV 178

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  159 bits (403), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/146 (61%), Positives = 107/146 (73%), Gaps = 5/146 (3%)

Query: 31  QDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVLA 90
           Q  NS+RVN+CMFA A+GI TDS+YG+FANFFE LAWP++LF  DFLNFVF FTAGTVLA
Sbjct: 32  QGHNSARVNYCMFAVAFGILTDSIYGLFANFFEQLAWPIILFVFDFLNFVFFFTAGTVLA 91

Query: 91  VGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNG- 149
           VGIRAH+CNN +Y +SN I +GS TRCR AQAAVAF YFS AIFL K + S+   IS G 
Sbjct: 92  VGIRAHNCNNEAYRNSNKIVRGSETRCRVAQAAVAFFYFSMAIFLVKGVFSIMKAISEGP 151

Query: 150 ----AFGSGSFSKRRRTGQVGVPTIS 171
               +       ++RR+   GVPT S
Sbjct: 152 FGSGSSFGFGSRRKRRSAGTGVPTTS 177

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  159 bits (402), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 108/158 (68%), Gaps = 14/158 (8%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFE-PLAWPLVLFTLDFLNFVFTFTAGTV 88
           T+  +SSRVN+CMF   + + TDS YG+ AN +  P AWP++LF  DFLNF FTFTAGTV
Sbjct: 30  TEKGHSSRVNYCMFVPPFAVVTDSFYGILANIWTTPFAWPIILFAFDFLNFAFTFTAGTV 89

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           L+VGIR HSC NR+Y+D+N I QGS  RCR+AQA++AF YFS  IF  K +MS  N++SN
Sbjct: 90  LSVGIRTHSCKNRNYIDNNKIIQGSTDRCRKAQASIAFFYFSFFIFFVKVVMSAINLLSN 149

Query: 149 GAFG--SGSFSKRRR-----------TGQVGVPTISQV 173
           GA G  + S  +RR            + QVGVP ISQV
Sbjct: 150 GAMGFSTPSIGRRRHHTANIGVPGASSPQVGVPNISQV 187

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  158 bits (400), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (74%), Gaps = 3/143 (2%)

Query: 31  QDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVLA 90
           +  N+ +VNF +F AA+G+  DSLY + ANF   LAWPL++   DFLNFVFTF A T LA
Sbjct: 32  KTHNNPQVNFAIFTAAFGLLFDSLYAIPANFVSALAWPLLIAVFDFLNFVFTFAAATALA 91

Query: 91  VGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGA 150
           V IR HSC N+ Y+DSN +TQGS  RCR+AQA+VAFLYFS  IFLAK  +S+ N+IS GA
Sbjct: 92  VAIRTHSCTNQDYLDSNTVTQGSTDRCRKAQASVAFLYFSFFIFLAKLGLSLVNLISVGA 151

Query: 151 FGSGSFSKRRRTGQVGVPTISQV 173
           FG+GS    RRTG VGVPTISQV
Sbjct: 152 FGAGS---SRRTGNVGVPTISQV 171

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  148 bits (374), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 104/144 (72%), Gaps = 3/144 (2%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVL 89
           T+D N+ +VNF +FAAA+G+  D+LY + ANF   LAWPL++   DFLNFVFTF A T L
Sbjct: 30  TRDNNNPQVNFAVFAAAFGLLFDTLYAIPANFISALAWPLLIAVFDFLNFVFTFAAATAL 89

Query: 90  AVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNG 149
           AV IR HSC N  YVD+N +TQGS  RCR+AQA+VAFLYF+  +FL K  +S+ N+ S G
Sbjct: 90  AVAIRVHSCTNSDYVDNNKVTQGSSDRCRKAQASVAFLYFAFFVFLVKLALSLVNVFSVG 149

Query: 150 AFGSGSFSKRRRTGQVGVPTISQV 173
           AF + S    R++  VGVPTISQV
Sbjct: 150 AFSTSS---GRKSANVGVPTISQV 170

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  146 bits (369), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 94/145 (64%), Gaps = 11/145 (7%)

Query: 29  NTQD-RNSSRVNFCMFAAAYGIFTDSLYGVFANFF-EPLAWPLVLFTLDFLNFVFTFTAG 86
           NT+   +SSRVN+CMF  A+G+ +DS YG+ AN   EP A+P +LF  DFLNFVFTFTAG
Sbjct: 29  NTEHGHHSSRVNYCMFPPAWGLVSDSFYGILANLVPEPFAFPPILFAFDFLNFVFTFTAG 88

Query: 87  TVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMI 146
           TVLAVGIR HSC N+ Y   N I QGS  RCR+AQA +AF YFS  +FL K L+++    
Sbjct: 89  TVLAVGIRTHSCTNKEYRRENYIIQGSERRCREAQACIAFFYFSMFLFLVKVLITLVTYF 148

Query: 147 SNGAFGSG---------SFSKRRRT 162
           + G  G           SF +R RT
Sbjct: 149 TGGELGQTGYGGGYGGRSFGRRPRT 173

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  145 bits (366), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 92/134 (68%), Gaps = 6/134 (4%)

Query: 34  NSSRVNFCMFAAAYGIFTDSLYGVFANFF-EPLAWPLVLFTLDFLNFVFTFTAGTVLAVG 92
           +S RVN+CMFAA + + TDS Y + ANF+  P AWP++L++ DFLNF FTFTAGTVL+VG
Sbjct: 35  HSPRVNYCMFAAPFALVTDSFYAIPANFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVG 94

Query: 93  IRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAF- 151
           IR HSC N+ Y+ SN ITQGS  RCR AQA++AF YFS  I+L + + S   M  NG F 
Sbjct: 95  IRTHSCLNKHYLFSNKITQGSTERCRLAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFK 154

Query: 152 ----GSGSFSKRRR 161
               G  SF   RR
Sbjct: 155 PEERGGASFRNSRR 168

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  121 bits (304), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 96/145 (66%), Gaps = 4/145 (2%)

Query: 29  NTQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTV 88
           N Q+R+ SRVNF +F A + +  DSLY V ANF   LAWP++L T D LN +FTF A T 
Sbjct: 29  NGQNRSHSRVNFGLFTAIFALLFDSLYSVLANFISALAWPILLITTDVLNLIFTFAAATA 88

Query: 89  LAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISN 148
           L   I  HSC+N  ++  N I++G   RCR+ QA+  FL+FS  IFLAK ++S  N++S 
Sbjct: 89  LGAAIGPHSCSNSGFLRGNDISEGREGRCRKVQASSVFLFFSFFIFLAKAVLSGLNIVST 148

Query: 149 GAFGSGSFSKRRRTGQVGVPTISQV 173
           GAF SGS    R+TG  GVPTISQV
Sbjct: 149 GAFSSGS---GRKTGG-GVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  101 bits (251), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 87/143 (60%), Gaps = 5/143 (3%)

Query: 31  QDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVLA 90
           Q  + SRVNF +F A + + TDS Y + ANF    AWP++   LD LN +FTF A T L 
Sbjct: 31  QRNSHSRVNFGLFTAVFALVTDSFYSIVANFISAFAWPIITIALDVLNLIFTFAAATALG 90

Query: 91  VGIRAHSCNNRSYVDSNGITQGSGTRCRQAQAAVAFLYFSCAIFLAKTLMSVFNMISNGA 150
             I AHSC+NR ++D N I++ S  RCR+ QA+  FL+FS  IFLAK + S  N+ S   
Sbjct: 91  QSIGAHSCSNRGFLDGNTISEQSTDRCRKVQASSTFLFFSFFIFLAKAVFSGLNIFS--- 147

Query: 151 FGSGSFSKRRRTGQVGVPTISQV 173
             SG+FS        GVPTISQV
Sbjct: 148 --SGAFSSGGSKRGGGVPTISQV 168

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 50/123 (40%), Gaps = 7/123 (5%)

Query: 32  DRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAV 91
           DR + + NF +      +F     G+       L +  + F  + +  +    A  VLA 
Sbjct: 36  DRGNKKTNFTLATGVISVFYLIALGILCLALPTLIYIGMYFCAELIMCMLWLAAFVVLAK 95

Query: 92  GIRAHSCNNR----SYVD--SNGITQGSGTR-CRQAQAAVAFLYFSCAIFLAKTLMSVFN 144
               HSC +R     Y D  S   T  +  R C  +QAA+AF      +FL   ++   N
Sbjct: 96  AQGQHSCKSRNSSGEYYDPYSGQYTTTNHRRACNSSQAAIAFAGLCFLLFLTSVVLLGVN 155

Query: 145 MIS 147
           +++
Sbjct: 156 ILT 158

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAG 86
           + D NS+        A+ G+ T SLY ++  +  P+ WPL + T   L FV +   G
Sbjct: 177 SNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPI-WPLSIQTASLLGFVLSMVCG 232

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAG 86
           + D NS+        A+ G+ T SLY ++  +  P+ WPL + T   L FV +   G
Sbjct: 177 SNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPI-WPLSIQTASLLGFVLSMVCG 232

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAG 86
           + D NS+        A+ G+ T SLY ++  +  P+ WPL + T   L FV +   G
Sbjct: 177 SNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPI-WPLSIQTASLLGFVLSMVCG 232

>Suva_8.212 Chr8 complement(386129..387742) [1614 bp, 537 aa] {ON}
           YOR161C (REAL)
          Length = 537

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 7/93 (7%)

Query: 79  FVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQAQ-AAVAFLYFSCAIFLAK 137
           F F F+A  V+A  ++    N      SNG    SG  C  ++   V  + F C  ++++
Sbjct: 238 FGFLFSA-VVVATYMKYDPANG-----SNGGCDVSGGSCSHSKLIGVLVVVFYCGYYISE 291

Query: 138 TLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTI 170
            + +V + + +G FGS  +  +   G    P +
Sbjct: 292 VIRTVIHCVISGTFGSWYYMSKSDQGMPKRPAL 324

>KNAG0B03850 Chr2 complement(737681..739351) [1671 bp, 556 aa] {ON}
           Anc_5.502 YOR161C
          Length = 556

 Score = 29.3 bits (64), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 113 SGTRCRQAQ-AAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVP 168
           SG  C  A+   +  L F C  ++++ + +V +M  +G FGS  +  +   G    P
Sbjct: 285 SGGNCSHAKLIGILVLVFFCGYYISEVIRNVIHMTVSGVFGSWYYMFKSDQGMPKWP 341

>Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)
          Length = 316

 Score = 29.3 bits (64), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 51/126 (40%), Gaps = 13/126 (10%)

Query: 32  DRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAV 91
           DR + + NF +      +F     G+       L +  + F  + +  +    A  VLA 
Sbjct: 36  DRGNKKTNFTLATGVISVFYLIALGILCLALPTLIYIGMYFCAELIVCMLWLAAFVVLAK 95

Query: 92  GIRAHSCNNRSYVDSNGI---------TQGSGTR-CRQAQAAVAFLYFSCAIFLAKTLMS 141
               HSC +    ++NG+         T  S  R C  +QAA+AF      +FL   ++ 
Sbjct: 96  AQGEHSCGS---TNANGLYYNPYSGQYTANSHRRACNSSQAAIAFSGLCFLLFLTSVILL 152

Query: 142 VFNMIS 147
             N+++
Sbjct: 153 GINVLT 158

>YOR161C Chr15 complement(636939..638558) [1620 bp, 539 aa] {ON}
           PNS1Protein of unknown function; has similarity to
           Torpedo californica tCTL1p, which is postulated to be a
           choline transporter, neither null mutation nor
           overexpression affects choline transport
          Length = 539

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 106 SNGITQGSGTRCRQAQ-AAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQ 164
           SNG    SG  C  ++   V  + F C  ++++ + +V + + +G FGS  +  +   G 
Sbjct: 261 SNGGCDVSGGSCSHSKLIGVLVVVFFCGYYISEVIRNVIHCVISGVFGSWYYMSKSDQGM 320

Query: 165 VGVP 168
              P
Sbjct: 321 PRWP 324

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,692,603
Number of extensions: 480477
Number of successful extensions: 1293
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1282
Number of HSP's successfully gapped: 43
Length of query: 173
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 71
Effective length of database: 41,785,467
Effective search space: 2966768157
Effective search space used: 2966768157
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)