Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4433.491ON42042019210.0
Smik_16.4013.491ON42742714590.0
YPR148C3.491ON43543414450.0
Suva_16.4773.491ON42343013670.0
TDEL0D055903.491ON3444199921e-133
SAKL0F02794g3.491ON3974269291e-122
ZYRO0D10010g3.491ON3824239181e-121
KLTH0F14806g3.491ON3584228891e-117
Kwal_55.212273.491ON3764228831e-116
KLLA0E04621g3.491ON3894258151e-105
Kpol_1017.73.491ON3784227911e-102
Ecym_12383.491ON3934367614e-97
TBLA0D029803.491ON4434327646e-97
TPHA0D032703.491ON3884277334e-93
NDAI0B058503.491ON4732997083e-88
KAFR0G036803.491ON4154417025e-88
CAGL0L08492g3.491ON3854126919e-87
NCAS0F035403.491ON4442676706e-83
AFR309C3.491ON3644326577e-82
KNAG0A079303.491ON4523095157e-60
TDEL0H022407.221ON3382382011e-16
KLTH0A03894g7.221ON3232421958e-16
Kwal_47.181487.221ON3232411941e-15
SAKL0F08162g7.221ON3302381941e-15
NDAI0A026607.221ON3642461834e-14
Kpol_1070.197.221ON3112381815e-14
ZYRO0D16522g7.221ON3582491825e-14
Suva_9.1597.221ON3252451781e-13
CAGL0L00891g7.221ON3412431736e-13
Smik_9.1507.221ON3262451719e-13
KAFR0I019507.221ON3302411711e-12
Ecym_43777.221ON3332181701e-12
KLLA0E04511g7.221ON3022811682e-12
ADL115W7.221ON3332401682e-12
KNAG0D017607.221ON3422391692e-12
TBLA0D042007.221ON3312401656e-12
Kpol_478.227.221ON3502221656e-12
YIL041W (GVP36)7.221ON3262451647e-12
Skud_9.1287.221ON3292451621e-11
NCAS0A133807.221ON3292451514e-10
TPHA0C012307.221ON3052471495e-10
TPHA0B027507.221ON3632731435e-09
TBLA0B015807.221ON3862731401e-08
Kwal_56.24080na 1ON41096703.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.443
         (420 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   744   0.0  
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   566   0.0  
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   561   0.0  
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   531   0.0  
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   386   e-133
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   362   e-122
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   358   e-121
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   347   e-117
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   344   e-116
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   318   e-105
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   309   e-102
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   297   4e-97
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   298   6e-97
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   286   4e-93
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   277   3e-88
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   275   5e-88
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   270   9e-87
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   262   6e-83
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   257   7e-82
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   202   7e-60
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    82   1e-16
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    80   8e-16
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    79   1e-15
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    79   1e-15
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     75   4e-14
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    74   5e-14
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    75   5e-14
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    73   1e-13
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    71   6e-13
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    70   9e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    70   1e-12
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    70   1e-12
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    69   2e-12
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    69   2e-12
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    70   2e-12
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    68   6e-12
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    68   6e-12
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    68   7e-12
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    67   1e-11
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    63   4e-10
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    62   5e-10
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    60   5e-09
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    59   1e-08
Kwal_56.24080 s56 (839584..840816) [1233 bp, 410 aa] {ON} [conti...    32   3.7  

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/420 (89%), Positives = 374/420 (89%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MSGYFSGFSLNKITDSIATAAHKTQDT             DPETRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
           TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180
           GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES
Sbjct: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180

Query: 181 NETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEK 240
           NET                  LSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEK
Sbjct: 181 NETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEK 240

Query: 241 LINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAPIS 300
           LINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAPIS
Sbjct: 241 LINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAPIS 300

Query: 301 PDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXXXXXXXXX 360
           PDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTI          
Sbjct: 301 PDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDLEENKLLE 360

Query: 361 XXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLEN 420
                FVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLEN
Sbjct: 361 KLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLEN 420

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/427 (70%), Positives = 326/427 (76%), Gaps = 7/427 (1%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MSGYFS FSLNKITDSIATAAHKT DT             DP+TRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
           T+SDISKLPPQYQFLEKKSDSLEKVC+RILLVSKTFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180
           GWFGS+KSE  NKKK SNHDDAFLPRSFAQAISKAAVDCE EFQ+L+ DEKA LKKK ES
Sbjct: 121 GWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRES 180

Query: 181 NETXXXXXXX------XXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEF 234
            +                         LSNLIKVFDSWSTCYKNIDEGK EMDS M+KEF
Sbjct: 181 TKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKEF 240

Query: 235 NKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVS 294
           NKKLEKLIN+DFK+VHELRKKVE SRLKFDTMRYEVK+KEA+L AQK   ++E   K VS
Sbjct: 241 NKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTKDVS 300

Query: 295 ANAPISPDENPTTEDESPISK-DLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXX 353
           AN   S +E P+T DE   S  + E +SKKE +   ADDA V+KED K ++ D+  +   
Sbjct: 301 ANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKEDPKDDKKDDTPLEES 360

Query: 354 XXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLK 413
                       FVSNTT AVE MEEI DSS+ILGL+KLFQNFQLVYFRQCVQEVEANLK
Sbjct: 361 EENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLK 420

Query: 414 VLNSLEN 420
           VLN LEN
Sbjct: 421 VLNGLEN 427

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/434 (71%), Positives = 337/434 (77%), Gaps = 15/434 (3%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MSGYFSGFSLNKITDSIATAAHKTQDT             DP+TRLSIKSRTRFVQESLG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
           TVSDISKLPPQYQFLEKKSDSLEKVC+RILLVSKTFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180
           GWFGS+KSE++ KKK SNHDDAFLPRSFAQAISKAAVDCECEFQ+L+ +EKA LKKK ES
Sbjct: 121 GWFGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKES 180

Query: 181 NETXXXXXXXXXXXX---------XXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMI 231
            +T                           LSNLIKVFDSWSTCYKNIDEGKAEMDS M+
Sbjct: 181 IKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMV 240

Query: 232 KEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAET-----SK 286
           KEFNKKLE LIN+DFKKVH+LRKKVE+SRLKFDTMRYEVK+KEA+L+A+KAE      SK
Sbjct: 241 KEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEAHSK 300

Query: 287 EVDDKAVSANAPISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQ-G 345
           +V  K +SAN   S DE P+TEDE P S+  E +SKKE +    DD A  KED K+N+  
Sbjct: 301 DVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVADRKEDLKSNKVN 360

Query: 346 DEPTIXXXXXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCV 405
           DEP I               FVSNTT AVE MEEITDSS+ILGL+KLFQNFQLVYFRQCV
Sbjct: 361 DEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCV 420

Query: 406 QEVEANLKVLNSLE 419
           QEVEANLKVLN LE
Sbjct: 421 QEVEANLKVLNGLE 434

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/430 (65%), Positives = 321/430 (74%), Gaps = 17/430 (3%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MSGY+     NKITDSIATAAHKTQDT             DP+TRLSIKSRTRFVQESLG
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
           TVSDISKLPPQYQFLEKKSDSLEKVC+RILLVSKTFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180
           GWFGS+K+E+A+KKK SNHDD FLPRSFAQAISKAAVDCE EF++L+Q+EK  LK+K E+
Sbjct: 116 GWFGSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEA 175

Query: 181 NE----TXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNK 236
            +    T                  LSNLIKVFDSWSTCYKNIDEGKAEMDS M+KEFNK
Sbjct: 176 KKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNK 235

Query: 237 KLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSAN 296
           KLEKLIN+DFKKVHELR+KVE+SRLKFDTMRYE KSKE +L+AQK ETSKE D+   SAN
Sbjct: 236 KLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDNSAN 295

Query: 297 A-----PISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKAN-QGDEPTI 350
           +      ++ ++    ED++ + +  E   K ET  + A+D     E+ K     ++P +
Sbjct: 296 STSLEEALTAEKKAEKEDDAKVPE--EEPKKVETDVTTANDDIDTNENPKQQPTNNQPPV 353

Query: 351 XXXXXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEA 410
                          FVSNTT AVE MEEITDSS+IL LVKLFQNFQLVYFRQC QEVEA
Sbjct: 354 EDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEA 413

Query: 411 NLKVLNSLEN 420
           NLKVLN +EN
Sbjct: 414 NLKVLNGMEN 423

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  386 bits (992), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 215/419 (51%), Positives = 264/419 (63%), Gaps = 79/419 (18%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MSGY S FSLNKITD++A AAHKTQDT             DP+ +LS+K+RTR++QE+LG
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
           T+ D SKLPPQYQ LEKKSD+LEK C+RILLV++TFEVEGYDYPPNLTESISDWWS+NKD
Sbjct: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116

Query: 121 GWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSES 180
           GWFG++K E   K   S+  DAFLPRSF+QAISKAA DC   F +L++            
Sbjct: 117 GWFGTKKPEKT-KNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQE------------ 163

Query: 181 NETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEK 240
                                +SN+ K+FDSWS CYKNIDEGK EMDS + KEFN KLEK
Sbjct: 164 -----------HGDEDEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEK 212

Query: 241 LINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAPIS 300
           +IN+DFKKVH  RKKVE+SRLKFDT+RYE+K KE     + A+ S E D+         S
Sbjct: 213 IINEDFKKVHASRKKVEESRLKFDTVRYEIKLKE----TENAKKSTETDE--------AS 260

Query: 301 PDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXXXXXXXXX 360
            DE   TE+E P + + +   ++      ++  A                          
Sbjct: 261 KDETK-TEEEPPKTSEEDKLLEELEDEFVSNTTA-------------------------- 293

Query: 361 XXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLE 419
                       AVEIM E+T+S++ILGL KLFQNFQLVYFRQCVQEVEA+LK+L +LE
Sbjct: 294 ------------AVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  362 bits (929), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 206/426 (48%), Positives = 272/426 (63%), Gaps = 36/426 (8%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MSGYFS FSL+K+T+SI++AAHKTQD              DP+ +LS+K R  ++QE+LG
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQD--KLSTAIANIQLDDPQAKLSLKVRKHYLQETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
            + DISKLPPQYQFLEKK DSLEK+CRR+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118

Query: 121 G---WFGSRKSENAN-KKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKK 176
           G   +   +K E +  K +  + ++ FLPRSFAQA+SKAA D     ++LK ++K   + 
Sbjct: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQD 178

Query: 177 KSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNK 236
           + E  +                   +++LI +F++WS C + ID+ KAEMDS M KEFNK
Sbjct: 179 EDEDEDE-----------------DINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNK 221

Query: 237 KLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDK--AVS 294
           KL+KLIN+DFKKVH LRKKVE+SRLKFDT+RYE+  KE   + QKA+  +E ++K   V 
Sbjct: 222 KLDKLINEDFKKVHSLRKKVEESRLKFDTLRYELNLKEK--EQQKAKAKEEENEKVDVVE 279

Query: 295 ANAPISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXXX 354
            NAP    +    E       DL+ D K      + D A+ + E  +  + D        
Sbjct: 280 QNAPEEKAKTEGQETSEGKEHDLKADEK-----LSEDTASKIPESVENEEVD----NEDP 330

Query: 355 XXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKV 414
                      FVS+TT AVEIM EITDSS+IL LVKLF  FQL+Y RQCVQE+EA+ K+
Sbjct: 331 EHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKI 390

Query: 415 LNSLEN 420
           L+ L+N
Sbjct: 391 LDGLDN 396

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  358 bits (918), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 263/423 (62%), Gaps = 44/423 (10%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MS YFS FS   + DSIA AAH+TQD              DP+TRLSIK+RTR+++E+LG
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQD--KLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
            V +ISKLPPQY  LE+KSD+LEK C+R+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118

Query: 121 GWFGSRKSENANKKKV---SNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKK 177
           GWFGS K +   + K+    +  D  +PRSFAQAI+KA+ +C   +Q+ ++ EK  + + 
Sbjct: 119 GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDED 178

Query: 178 SESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKK 237
            +                        NL+++F++ S CY+NIDEGK EMD ++ +EFN K
Sbjct: 179 EDD----------------------VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDK 216

Query: 238 LEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANA 297
           LE+L+N+DFKK+H LR KVE+SRLKFDTMRYE++ KE + K +   T          ANA
Sbjct: 217 LEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLKEKEEKEENENT----------ANA 266

Query: 298 PISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXXXXXX 357
               DE P+ +++   + +   + +K T    A+     K +   N   EP +       
Sbjct: 267 ----DEGPSNKNQQEPTNEPAKEEEKPTPAEPAEAQHTTKTE---NSNKEPMVEKPEDNK 319

Query: 358 XXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNS 417
                   FVSNT+ AVE M  I + S+IL L+KLFQN QLVY+RQCVQE+EA+LK LN 
Sbjct: 320 LLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLND 379

Query: 418 LEN 420
           LEN
Sbjct: 380 LEN 382

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  347 bits (889), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/422 (46%), Positives = 251/422 (59%), Gaps = 69/422 (16%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MS YF GFSLNK+T+SI   AHKTQDT             DP+ +LS+K+R  ++QE+LG
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
           T+ DISKLPPQYQFLEKK DSLEKVCRR+L+V+KT+EVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 121 GWFGSRKSENANKKKVSNHD--DAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKS 178
           G FG   S    KK     D  +A +PRSFAQAISKAA D      +LK +E+       
Sbjct: 119 GLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKA----- 173

Query: 179 ESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKL 238
                                  +++LIK+F++WS C  N+D+ KAEMD+ M+KEFN KL
Sbjct: 174 -------------SAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKL 220

Query: 239 EKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAP 298
              + + FK    LRKKVEDSRLKFDTMRYE+K  E + K ++A              A 
Sbjct: 221 TAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEA--------------AQ 266

Query: 299 ISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXXXXXXX 358
            +  + P  EDE+  SKD            ++D+A  + E  +    DE           
Sbjct: 267 QTESQKPQ-EDEAEASKD----------SDSSDEAQKLLEKLE----DE----------- 300

Query: 359 XXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSL 418
                  FVSNTT AVE M EITDS++I+ LVKLF NFQL+Y++QCVQ +E ++  LN L
Sbjct: 301 -------FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNEL 353

Query: 419 EN 420
           E 
Sbjct: 354 EG 355

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  344 bits (883), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/422 (46%), Positives = 241/422 (57%), Gaps = 51/422 (12%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MS YF GFS NK+TD++  AAHKTQDT             DP+  LS+K+R  ++QE+LG
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
           T+ DISKLPPQYQ LEKK DSLEK CRR+L+V+KTFEVEGYDYPPNL+ES+SDWWS NK+
Sbjct: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 121 GWFGSRKSENANK--KKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKS 178
           G FG   S   +K  +  +    A +PRSFAQAI+KAA D      +LK  E+       
Sbjct: 119 GLFGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQA----- 173

Query: 179 ESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKL 238
                                  ++ LIK+F +WS C   ID+GKAEMD+ M KEFN+KL
Sbjct: 174 -------------SADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKL 220

Query: 239 EKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAP 298
             LI + FK    LR+KVEDSRLKFDTMRYEVK  E + K Q  E  K            
Sbjct: 221 NALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSK-QAMENEK------------ 267

Query: 299 ISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXXXXXXX 358
                      ES +S   EG    ETS          KE+   N   +  +        
Sbjct: 268 -------AQFKESDLSSKEEGADANETSNEVGKSVTKTKEEQATNDAAQELL-------- 312

Query: 359 XXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSL 418
                  FVSNTT AVE M EITDS+++L LVKLF NFQLVY RQCVQ++EA+L  LN L
Sbjct: 313 -EKLEDEFVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNEL 371

Query: 419 EN 420
           E 
Sbjct: 372 EG 373

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  318 bits (815), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/425 (43%), Positives = 248/425 (58%), Gaps = 49/425 (11%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLGTVSD 64
           FS  SLN ITDSI+ AA +TQ+              DPETRLSI  R   +QE+LGTV D
Sbjct: 2   FSKLSLNNITDSISNAAQRTQE--QFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD 59

Query: 65  ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGWFG 124
           IS+LP QY+FLE+KSD+LEK+C+R+LLV+KTFEVEGYDYPPNLTES +DWWS NKD  F 
Sbjct: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFS 119

Query: 125 -SRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDE--------KAGLK 175
            S+K    + +     ++  LPRSFAQA+SKAA D     + LK +E        + G  
Sbjct: 120 FSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGAD 179

Query: 176 KKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFN 235
           +K                        + NLIK F+SW+ C  +ID+ KAEMDS M+KEFN
Sbjct: 180 QKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFN 239

Query: 236 KKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSA 295
            KL KLI  DFKK HELR KV+D+RL FDT+R+E+K    KL+ ++   S E  +K V+ 
Sbjct: 240 AKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIK---LKLQEKEVVASSEEAEKKVAT 296

Query: 296 NAPISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXXXXX 355
             P +P++     +E P+                  D A  +ED  +   +         
Sbjct: 297 ETPETPEKKT---NEEPV------------------DMAKTEEDPDSKLFE--------- 326

Query: 356 XXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVL 415
                     FVS T+  VE + E+TDSS+I+ LVKLF NFQL++++QCV+ +E +L+VL
Sbjct: 327 -----RLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVL 381

Query: 416 NSLEN 420
           NSL++
Sbjct: 382 NSLDS 386

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  309 bits (791), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/422 (43%), Positives = 237/422 (56%), Gaps = 53/422 (12%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXX----XDPETRLSIKSRTRFVQESLG 60
           FSGFS++K+TDSI+  A KTQ+                  DP T+LSIKS+ RF+QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNK 119
           T++D  SKLPP Y  LE K+D++EK  +R+L V+KT+E EGYDYPPNLTES+SDWW+ + 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTNDD 121

Query: 120 DGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSE 179
           +        EN    K      +FLPRSFAQAIS A+ D      S+    K   K   E
Sbjct: 122 NVTNTDENDENIQSNK------SFLPRSFAQAISNASFDAASNVNSVTNTIKLNHKDDEE 175

Query: 180 SNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLE 239
                                  S+L K+F+S   CY+NID GK EMD  ++ EFN KL+
Sbjct: 176 E---------------EEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLK 220

Query: 240 KLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAPI 299
            LIN +FK VH+LRK VE+SRLKFDTMRYE+K KE K      E                
Sbjct: 221 DLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKEWKRTXXXME---------------- 264

Query: 300 SPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKE--DSKANQGDEPTIXXXXXXX 357
                   ED+S +SK  +G SKKET    A      K+  + K +  +E          
Sbjct: 265 -------AEDKSDVSK--KGTSKKETPKKEASKKETPKKEINKKEDITNEGNTENDNDNK 315

Query: 358 XXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNS 417
                   FVSNT  AVE MEE+TD+S I+ LVKL+QNFQLVY++QC+QE+E+NLK+LN 
Sbjct: 316 LLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNG 375

Query: 418 LE 419
           LE
Sbjct: 376 LE 377

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  297 bits (761), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 183/436 (41%), Positives = 249/436 (57%), Gaps = 69/436 (15%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXX-----DPETRLSIKSRTRFV 55
           MS YFS FSL+KI  +I TAAHKTQ                    DP+T LS+++R   +
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWW 115
           QE+LGT+ DISKLPP+YQFLE+K D+ EKVC RIL+VSKTFEV+GYDYPPNL ESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 116 --SVNKDG--W-FGSRKSENANK-------KKVSNHDDAFLPRSFAQAISKAAVDCECEF 163
             S  KDG  W FG +   + NK       +K SN  + ++P SFAQAISKAA D     
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSN--EGYIPPSFAQAISKAADDSITIL 178

Query: 164 QSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGK 223
           + L +++       +E+ +                   + +L+ + ++W+    NIDE K
Sbjct: 179 KELNEEQLVNPSNGAETED-----------------EDVDSLMPILEAWAEAQSNIDEAK 221

Query: 224 AEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAE 283
            +MD  MI EFNKKL+ L+N DF KV  LRKKVE+SRLKFDT+RYE++ +++   +Q  E
Sbjct: 222 QQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSG-ASQTKE 280

Query: 284 TSKEVDDKAVSANAPISPDE-NPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKA 342
           T   ++ + V+     + D   PT  + + I             GS++D+     ED K 
Sbjct: 281 TFTTIESQQVNDKDKENEDNLKPTIHNNTGI-------------GSSSDE-----EDQK- 321

Query: 343 NQGDEPTIXXXXXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFR 402
                                  FVSNTT AV  M +ITDS ++  LVKLF NFQL+Y +
Sbjct: 322 ------------FRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHK 369

Query: 403 QCVQEVEANLKVLNSL 418
           +CVQE++A+L V+N+L
Sbjct: 370 KCVQELQASLNVINTL 385

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  298 bits (764), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 180/432 (41%), Positives = 247/432 (57%), Gaps = 31/432 (7%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLG 60
           MSGYFS FSL+K+ DS+ +AA KTQDT             DP+TRL++ S+  ++QES+G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120
            +++ISKLP QY  LE+K+D+LEK+ +RIL+V+ TFE+EGYDYPPNL+ESIS+WW    D
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWL--ND 143

Query: 121 GWFGSRKSENANKKKVSNHD-------------DAFLPRSFAQAISKAAVDCECEFQSLK 167
                R ++N N K  SN +              +FLPRSF  AISKA+ D      +L 
Sbjct: 144 PLAFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLN 203

Query: 168 QDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMD 227
            +EK    K                         +  LIKVFDSWS C KNID+ K + D
Sbjct: 204 NNEKLEFAK------------TKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRD 251

Query: 228 STMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEV-KSKEAKLKAQKAETSK 286
             +IK+FNKKL  L++ +FK V  LR KV+D+RLKFDTMRYE+ K+ EAK++A+  E  K
Sbjct: 252 QLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAE--ENDK 309

Query: 287 EVDDKAVSANAPISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGD 346
            V+ +          +     + +   +      +   T+  AA      K+DS  N   
Sbjct: 310 PVEMEKGEGEDEGEGEGKGKGKGKGETASTSTETASTSTTKDAAATIESQKKDS-PNPEF 368

Query: 347 EPTIXXXXXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQ 406
           E                  FVS+T+ AVE MEEIT+SS IL L+KLFQNFQL++++QC++
Sbjct: 369 EKNDSQNEDEKLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIK 428

Query: 407 EVEANLKVLNSL 418
           EVE N+K+L  L
Sbjct: 429 EVETNMKLLTDL 440

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  286 bits (733), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 186/427 (43%), Positives = 249/427 (58%), Gaps = 55/427 (12%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXX----XXXXXXXDPETRLSIKSRTRFVQESLG 60
           FS FSL+K+TDSI+  A KTQ+                  DP T+LSI++R+R++QE LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNK 119
           T+ D ISKLP QY  LE K+DS+EK+ +R+LLV+ TF  EGYDYPPNLTESISDWW+ ++
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE 121

Query: 120 DGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSE 179
                   +EN N          FLPRSFAQA++KA  D +      +++ K     K+ 
Sbjct: 122 -------TTENKN----------FLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNT 164

Query: 180 SNETXXXXXXXXXXXXXXXXXXLSNLI---KVFDSWSTCYKNIDEGKAEMDSTMIKEFNK 236
             +                     +L+   K F + S  + NID GK EMD+ ++ EFNK
Sbjct: 165 GTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNK 224

Query: 237 KLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAE---TSKEVDDKAV 293
           KLE L+  +FK+V +LR+ VE+SRLKFDTMRY+VK KEAK + ++A+   T KE++ K  
Sbjct: 225 KLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKEIEKKES 284

Query: 294 SANAPISPDENPTTEDESPISKDL-EGDSKKETSGSAADDAAVVKEDSKANQGDEPTIXX 352
               P    E   TE++ P +KD  E D  KE  G   D+   + E  +    DE     
Sbjct: 285 ETKEP----ETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLE----DE----- 331

Query: 353 XXXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANL 412
                        FVSNT++AVE MEE+TDS+ IL LVKLFQNFQLVY+RQCVQE+E NL
Sbjct: 332 -------------FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNL 378

Query: 413 KVLNSLE 419
           K ++ LE
Sbjct: 379 KTISDLE 385

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  277 bits (708), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 155/299 (51%), Positives = 189/299 (63%), Gaps = 40/299 (13%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLGTVSD 64
           FS FSL+KIT+SI  AA K  +T             DP+T+LSIKS+TR  QE LGT+ D
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT----DPQTKLSIKSQTRLFQEQLGTIHD 57

Query: 65  ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGWFG 124
           ISKLP QY+ LE K+DSLEK  +RILLVSKTFE+EGYDYPPNLTES SDWW++ K     
Sbjct: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITK----- 112

Query: 125 SRKSENANKKKVS-----------NHDDA--------------FLPRSFAQAISKAAVDC 159
             KS +  KK++S           +HD+A              FLPRSFAQAISK+A+DC
Sbjct: 113 --KSSSHRKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDC 170

Query: 160 ECEFQSLKQDEKA----GLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 215
              +Q L   E A     +K ++E+ E                   + NLIK F+SWS C
Sbjct: 171 TDIYQQLSIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNC 230

Query: 216 YKNIDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKE 274
           YKNID+GK+EMDS M KEFN KLE LIN +FKKV+ LRKKV DSRLKFDT+R+E+K KE
Sbjct: 231 YKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKE 289

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/55 (72%), Positives = 50/55 (90%)

Query: 366 FVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLEN 420
           FVS+T +AVE+M EIT+SS I+GL+KLFQNFQLVY+RQCVQE+EANLK LN L++
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDH 472

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  275 bits (702), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 173/441 (39%), Positives = 248/441 (56%), Gaps = 53/441 (12%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLGTVSD 64
           FS F+ +KIT+SI+TAA   Q               D +T+L  K   RF QE +G + D
Sbjct: 2   FSNFNFDKITNSISTAAQSAQ-----QKINDTILTPDVQTKLHFKKTARFWQEKVGQIPD 56

Query: 65  --ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGW 122
             ISKLP  Y  LE K D+LEK+ +R+L+V+KT+E+EGYDYPPNL+ES++DWW      W
Sbjct: 57  KEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW------W 110

Query: 123 FGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSESNE 182
              +KS+   +K       +F+  SF  AISKAA D +     LK+ ++   K+  E  E
Sbjct: 111 SDLKKSKKHQEK------SSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEE 164

Query: 183 TXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEKLI 242
                                NL++VF+S S CYKNID+ KAEMD+ ++KEFN KLE LI
Sbjct: 165 EVEEEDDDE----------FLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLI 214

Query: 243 NKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANAPISPD 302
           N DFKKV +LR KV+DSRL+FDT+R+E+K KE   ++ + E S++ D     +   + P 
Sbjct: 215 NNDFKKVSKLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPK 274

Query: 303 ENPTTEDE-SPISKDLEGDSKKETSGSAADDAA---VVKEDSKANQGDEP---------- 348
           E  T E++ +  S   E + KK T    A+D      V+E ++A + ++P          
Sbjct: 275 EESTKEEQVNEESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEA 334

Query: 349 ----------TIXXXXXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQL 398
                     +                FVSNT  AVE+M E+T++S+++ LVKLFQNFQL
Sbjct: 335 PKEDVKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQL 394

Query: 399 VYFRQCVQEVEANLKVLNSLE 419
           ++++QCVQE+E N+K L+ LE
Sbjct: 395 IHYKQCVQEIENNMKFLDQLE 415

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  270 bits (691), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 163/412 (39%), Positives = 229/412 (55%), Gaps = 84/412 (20%)

Query: 41  DPETRLSIKSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEG 100
           DP+T+LSIK++TRF+QE++G   DISKLPPQY  LEKK DS+EKV +RIL+V+KT+E+EG
Sbjct: 26  DPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEG 85

Query: 101 YDYPPNLTESISDWWSVNKDGWF-------------------GSRKSENANKKKVSNHDD 141
           YDYPPN++ES+S WW   +  WF                   G+  S+    K+VS+   
Sbjct: 86  YDYPPNISESLSSWWQTKE--WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG- 142

Query: 142 AFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXX 201
              P SFA AI++A  D +  F+S++  ++   +                          
Sbjct: 143 ---PPSFASAIARAGKDSQLIFESIETKDEDEKEDI------------------------ 175

Query: 202 LSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRL 261
              L+K+F  WS C+  I + K EMD  MIKEFN KLE  + K+F+K+H LR KVE+SRL
Sbjct: 176 -DELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRL 234

Query: 262 KFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVS---ANAPISPDENPTTEDESPISKD-L 317
            FDTMRYEV           A+TSK+ D K +       P S D N T  +E   + D +
Sbjct: 235 NFDTMRYEV-----------AQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKV 283

Query: 318 EGDSKKETSGSAAD---------DAAVVKEDSKANQGDEPTIXXXXXXXXXXXXXXXFVS 368
           E   K ET+ + AD         D+  +KEDSK +   +                  FVS
Sbjct: 284 ETKEKTETNATIADETKETKDTKDSEDLKEDSKTSTDGQ----------LLEQLEDEFVS 333

Query: 369 NTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLEN 420
           NTT AVE+M E++++S++L L+KLFQ FQL Y + CV+ +E +LK LN+++N
Sbjct: 334 NTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  262 bits (670), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 174/267 (65%), Gaps = 22/267 (8%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLGTVSD 64
           FS FSL+KIT+S+ATAA KT DT             DP T+LS++S+ R  QES+GTV D
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57

Query: 65  ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGWFG 124
           IS LP QY  LE ++D+LEK  RRIL+VSKTFE+EGYDYPPNL+ES SDWWS+       
Sbjct: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSL------- 110

Query: 125 SRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSESNETX 184
              S    K++       FLPRSFAQAIS +A DC   +Q +   +        + ++  
Sbjct: 111 ---SSKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGD--------DEDKEE 159

Query: 185 XXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKKLEKLINK 244
                            + NLIK FDSW+ CYKNID+GKAEMDS M+KEFN KLEKL+N+
Sbjct: 160 NANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNE 219

Query: 245 DFKKVHELRKKVEDSRLKFDTMRYEVK 271
           +FKKVH LRK+V+DSRLKFDT+RYE+K
Sbjct: 220 EFKKVHTLRKRVKDSRLKFDTVRYELK 246

 Score = 98.6 bits (244), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 51/54 (94%)

Query: 366 FVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLE 419
           FVS+T +AVE+MEEITDSS+I+GLVKLFQNFQLVY+RQCVQE+EANLK LN LE
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  257 bits (657), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 165/432 (38%), Positives = 228/432 (52%), Gaps = 84/432 (19%)

Query: 1   MSGYFSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXX-----DPETRLSIKSRTRFV 55
           MS YF   SL+K+ +++  AA KTQ                    DP+T LS+K+R R +
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 56  QESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWW 115
           QE+LG+  DIS+LPPQY FLE+K D++E+VC++IL+VSKTFEVEGYDYPPN TESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 116 SVN-------KDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQ 168
           + +       K G  G+ K +   +K+ +   D   P SFA A+ +AA   +        
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSD---PPSFAHALHRAAKGSQ-------- 169

Query: 169 DEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDS 228
               G+ ++ +                      + +LIK+F +W+    N+D  K EMD 
Sbjct: 170 ----GIIQELKEQAEEEQEQEVEIDED------VESLIKMFGTWADAQYNMDIAKREMDQ 219

Query: 229 TMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEV 288
            M+KEFN+KL+ L+  +FKK H LR+KVE+SRL FDT++YE   ++A L  ++       
Sbjct: 220 FMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQ------- 272

Query: 289 DDKAVSANAPISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVK-EDSKANQGDE 347
                        DE    E  +P        S   T  S AD A   + ED++    DE
Sbjct: 273 -------------DEAKQAEGATP--------STGVTQSSTADLAFYAQLEDAE----DE 307

Query: 348 PTIXXXXXXXXXXXXXXXFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQE 407
                             FVSNT  AVE M  I D++ ++ LVKLFQNFQLVY R+CVQE
Sbjct: 308 ------------------FVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQE 349

Query: 408 VEANLKVLNSLE 419
           +E +L  L SLE
Sbjct: 350 LEVSLNSLTSLE 361

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  202 bits (515), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 179/309 (57%), Gaps = 29/309 (9%)

Query: 5   FSGFSLNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSIKSRTRFVQESLGTVSD 64
           FS FSL+K+T +I  AA   QDT             D +T+L     TR+ QE +GT+S+
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISE 56

Query: 65  --ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGW 122
             I+KLP  YQ L++KS+++EKV +R+L+V+KTFE+EGYDYPPN+TES++ WW  N+D  
Sbjct: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED-- 112

Query: 123 FGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKA---------- 172
                 EN  KK     D + L RSFA AI KA +D +     LK+ +K           
Sbjct: 113 ------ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR 166

Query: 173 --GLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTM 230
               +   E +E                   ++N+I  F  WS CYKNID+ KAEMDS +
Sbjct: 167 EEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMI 226

Query: 231 IKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDD 290
           +KEFN+KL  ++  DFK VH+L  +V+DSRL+FDT+R+++K KE + +A++    +  + 
Sbjct: 227 VKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRHKLKLKELEKEARRQVMEEVAEQ 286

Query: 291 KAVSANAPI 299
           +A ++  P+
Sbjct: 287 QAEASGEPV 295

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 109/238 (45%), Gaps = 37/238 (15%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ +    L V+  +E E YDYP  +T
Sbjct: 38  QSTQRLVQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVT 97

Query: 109 ESISDWWSV--NKDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSL 166
           ES++D+  +  +K        S +  +  +     A  PR+   A+SK ++        +
Sbjct: 98  ESVNDFSKIVAHKVQELSHASSASEAQNILITPTPAKEPRTLNYALSKVSLISSEYLNHI 157

Query: 167 KQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEM 226
              ++A +                            S L+K    +S     + + + + 
Sbjct: 158 GDHDEAQVA---------------------------SVLLK----YSDLQAKVAQARLQQ 186

Query: 227 DSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKLKAQ 280
           D+ +   FNK+L+  +  +FKK  + RK VE  RL++D  R  +      KEA L+ Q
Sbjct: 187 DTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVARSNLAQAKPEKEASLRVQ 244

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 112/242 (46%), Gaps = 45/242 (18%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D +  V    L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVR 116

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKV-----SNHDDAFLPRSFAQAISKAAVDCECEF 163
           +S++++ SV         ++ + N+ +        H D   P++   A+SK A+    E+
Sbjct: 117 DSVNEFSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKD---PKTLNYALSKVAL-TSSEY 172

Query: 164 QSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSN-LIKVFDSWSTCYKNIDEG 222
                     L K    +++                  +SN L+K    +S     + + 
Sbjct: 173 ----------LNKSVGGDDS-----------------EVSNALLK----YSDVQAKVAQA 201

Query: 223 KAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKLK 278
           + + D+ +   FNKKL  ++  D  +  + RK VE  RL++D  R  + +    KEA L+
Sbjct: 202 RLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIARSNLANAKPEKEASLR 261

Query: 279 AQ 280
            Q
Sbjct: 262 VQ 263

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 109/241 (45%), Gaps = 43/241 (17%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R +QE LG V+DIS+LP  Y  LE K D ++ V    L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVR 116

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKV-----SNHDDAFLPRSFAQAISKAAVDCECEF 163
           +S++++ S+         ++ + N+ +        H D   P++   A+SK A       
Sbjct: 117 DSVNEFSSIVGTKLHELSRATSTNEAQSVLISPGPHKD---PKTLNYALSKVA------- 166

Query: 164 QSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGK 223
             L   E       +E +E                    S+L+K    +S     I + +
Sbjct: 167 --LTSSEYLNKSPGAEDSEVS------------------SSLLK----YSDVQAKIAQAR 202

Query: 224 AEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKLKA 279
              D+ +  +FNKKL   +  D  +  + RK VE+ RL++D  R  + +    KEA L+ 
Sbjct: 203 LHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIARANLANARPEKEASLRV 262

Query: 280 Q 280
           Q
Sbjct: 263 Q 263

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 111/238 (46%), Gaps = 38/238 (15%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE + D +  V    L V++ +E E YDYP N+ 
Sbjct: 57  QSTQRLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVR 116

Query: 109 ESISDWWSV--NKDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSL 166
           +S++++     +K        S +  +  + +   A  P++   A+SK A+    E+   
Sbjct: 117 DSVNEFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLNYALSKVAL-TSSEY--- 172

Query: 167 KQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEM 226
                  L K    +ET                   + L+K    +S     I + + + 
Sbjct: 173 -------LSKSGHEDETIA-----------------TALLK----YSDVQAKIAQARLQQ 204

Query: 227 DSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKLKAQ 280
           D+ +  +FNKKL + +  D  K  + RK+VE+ RL++D  R  + +    KEA L+ Q
Sbjct: 205 DTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLANAKPEKEASLRVQ 262

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 119/246 (48%), Gaps = 30/246 (12%)

Query: 42  PETRLSIKSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGY 101
           P+     +S  R VQE LG V+DIS+LP +Y  LE+K D+++ V    L V+ TFE + Y
Sbjct: 34  PDINSLAQSTQRMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSY 93

Query: 102 DYPPNLTESISDW--WSVNKDGWFGSRKSENANKKKVSNHDDAFL-PRSFAQAISKAAVD 158
           DYP    ES+ ++   +V+K        S +  ++ ++N+ +    P++   A+SKA++ 
Sbjct: 94  DYPNVARESVIEFSKSAVSKVEELSHATSASEAQQILTNNSNQIKEPKTLNYALSKASL- 152

Query: 159 CECEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKN 218
                 S + +++      + SN                     S L+K    +S     
Sbjct: 153 ----ISSEQLNKQFSTDDDNNSNSDFKLVS--------------SILLK----FSDIQAK 190

Query: 219 IDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KE 274
           I + + + D  + ++FN  L   +N  F++  ++RK V++ RL++D  R  + +    KE
Sbjct: 191 IAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVARTNLLNAKPEKE 250

Query: 275 AKLKAQ 280
           A L+ Q
Sbjct: 251 ASLRVQ 256

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 108/238 (45%), Gaps = 37/238 (15%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE++ D+++ V    L ++  +E E YDYP  ++
Sbjct: 37  ESTQRLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVS 96

Query: 109 ESISDWWSV--NKDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSL 166
           +S++D+  V  NK        S    +  +     A  PR+   A+SK A++        
Sbjct: 97  DSVNDFSKVFANKVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNS------- 149

Query: 167 KQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEM 226
                  L + ++ NE                      L+K    +S     I + +   
Sbjct: 150 ----SESLAQLADPNEGPVADA----------------LLK----FSDVQAKIAQTRLHQ 185

Query: 227 DSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKLKAQ 280
           D+ +  +FNK+L + +  D  K  + RK V+  RL++D  R ++      KEA L+ +
Sbjct: 186 DTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVARSKLTQAKPEKEASLRVE 243

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 115/249 (46%), Gaps = 54/249 (21%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESIS 112
           R++QE LG  +DIS++P +Y  L  K D+++ +    L V++ ++ E YDYP  + ESI+
Sbjct: 37  RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESIN 96

Query: 113 DWWSVNKDGWFGSRKSENANKKKVSNHDDAFL---------PRSFAQAISKAA-VDCECE 162
           ++         GS+  E ++    S H+   +         P++   A+S+ + V  EC 
Sbjct: 97  EFSRT-----VGSKIQELSHAS--SAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSEC- 148

Query: 163 FQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEG 222
            + L   + A L                            S L+K    +S     + + 
Sbjct: 149 MEHLSTHDDALLA---------------------------SYLMK----YSDIQSRVAQA 177

Query: 223 KAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVK----SKEAKLK 278
           +   DS +   FN KL + I+ + K+ H +R+ VE+ RL +D  R  ++     KEA+L+
Sbjct: 178 RLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASRTHLEKAKPEKEAQLR 237

Query: 279 AQKAETSKE 287
            Q  ET++E
Sbjct: 238 VQ-METAEE 245

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 111/245 (45%), Gaps = 50/245 (20%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL-------PRSFAQAISKAAVD-CE 160
           ES++++ S        S+ +E  +    S   +  +       P++   A+SK A++  E
Sbjct: 93  ESVNEFSS-----SLASKLTELTHATSASQAQNILVAPGPIKEPKTLNYALSKVALNSSE 147

Query: 161 CEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNID 220
           C  +    +E+                               S+L++    +S     I 
Sbjct: 148 CLNKMFPTEEQP----------------------------LASSLLQ----FSDVQAKIA 175

Query: 221 EGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS-----KEA 275
           + + + D+ +  +FNKKL + ++ +  K  + RK+V   RL++D  R  + +     KEA
Sbjct: 176 QARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVARTNLANNKKPEKEA 235

Query: 276 KLKAQ 280
            L+ Q
Sbjct: 236 SLRVQ 240

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 110/243 (45%), Gaps = 46/243 (18%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ V    L V+  +E E YDYP  ++
Sbjct: 38  QSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVS 97

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL-------PRSFAQAISKAAVDCEC 161
           ES++++          ++  E +     +   +  +       P++   A+SK A++   
Sbjct: 98  ESVNEF-----SKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNA-S 151

Query: 162 EFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDE 221
           E+ +   D+    K                             L KV  ++S     + +
Sbjct: 152 EYLNHSFDDPMDAK-----------------------------LSKVLLNYSDVQTKVAQ 182

Query: 222 GKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKL 277
            + + D+ +  +FNK + + + +   + ++ RK V+  RL++D  R  +++    KEA L
Sbjct: 183 ARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPEKEAGL 242

Query: 278 KAQ 280
           + Q
Sbjct: 243 RVQ 245

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 106/245 (43%), Gaps = 50/245 (20%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE+K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL-------PRSFAQAISKAAVD-CE 160
           ES++++          S+ +E  +    S   +  +       P++   A+SK A++  E
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSE 147

Query: 161 CEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNID 220
           C  + L  +E+                                 L      +S     I 
Sbjct: 148 CLNKMLPTEEQP--------------------------------LASALLQFSDVQAKIA 175

Query: 221 EGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS-----KEA 275
           + + + D+ +  +FNK L + ++ +  K  + RK V   RL++D  R  + +     KEA
Sbjct: 176 QARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVARTNLANNKKPEKEA 235

Query: 276 KLKAQ 280
            L+ Q
Sbjct: 236 SLRVQ 240

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 109/241 (45%), Gaps = 46/241 (19%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LEKK DS++ +    L V+  +E E YDYP  + 
Sbjct: 38  QSTQRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIK 97

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL-------PRSFAQAISKAAVDCEC 161
           +S++D+          ++ ++ ++    S   +  +       P++   A+SK ++    
Sbjct: 98  DSVNDF-----SKTMAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTASE 152

Query: 162 EFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDE 221
               +           S  NE+                   S L++    +S     I +
Sbjct: 153 VINQV----------GSTPNESALS----------------SKLLE----FSNVQSKIAQ 182

Query: 222 GKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKL 277
            + + D+ +  +FNK L   ++    K ++ RK+V++ RL++D  R  + +    KEA L
Sbjct: 183 ARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVARTNLMNAKPEKEASL 242

Query: 278 K 278
           +
Sbjct: 243 R 243

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 101/218 (46%), Gaps = 36/218 (16%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTES-- 110
           R VQE LG ++DIS++P +Y  +EK+ D +  +    L V++ +E E YDYP +++ES  
Sbjct: 61  RMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVN 120

Query: 111 -ISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQD 169
            IS   +        +  +E A    +S    A  P++   A+SK ++    E+ S    
Sbjct: 121 EISKTVTGKIQELTKATSTEEAQNILISP-GPAKDPKTLNYALSKVSL-TSSEYLS---- 174

Query: 170 EKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDST 229
            K+G    S+SN T                        +   +S     I + + + D  
Sbjct: 175 -KSG----SDSNVTAD----------------------ILLKYSDIQAQIAQARLQQDML 207

Query: 230 MIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMR 267
           +   FNK+L++ +N +F      RK+V++ RL++D  R
Sbjct: 208 IRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 123/281 (43%), Gaps = 68/281 (24%)

Query: 1   MSGYFSGFS--LNKITDSIATAAHKTQDTXXXXXXXXXXXXXDPETRLSI--KSRTRFVQ 56
           MS YF  FS  + +++ S++  A + Q               D +T L +   S  R +Q
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ---------LDQKFKDLKTNLPLLANSTQRMLQ 51

Query: 57  ESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWS 116
           E LG V+DIS+LP +Y  LE + ++++ +    L V+K +E E YDYP N+ ES+ ++  
Sbjct: 52  EKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEF-- 109

Query: 117 VNKDGWFGSRKSENANKKKVSNHDDA---FL-------PRSFAQAISKAAVDCECEFQSL 166
                  G +  + +   KV+N + A    L       P++   A+SK A+         
Sbjct: 110 ---SKLVGGKLHDLS---KVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTS------- 156

Query: 167 KQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEM 226
                      SE  E                   L+N +     +S     I + + + 
Sbjct: 157 -----------SEHVE----------------DESLANFLA---KYSDSQTKIAQLRLQQ 186

Query: 227 DSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMR 267
           D+ +  +FNK +++ + +D +   + RK VE  RL++D +R
Sbjct: 187 DTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 109/240 (45%), Gaps = 50/240 (20%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG V+DIS++P +Y  LE++ D  + +    L VS+ +E E YDYP ++++S++
Sbjct: 61  RRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVN 120

Query: 113 DWWSVNKDGWFGSRKSENANKKKVSNHDDAFL--------PRSFAQAISKAAVDCECEFQ 164
           D +S    G     K +   K   +    + L        P++   A+SK A+    E+ 
Sbjct: 121 D-FSKTVTG-----KVQELTKATTTEEAQSILISPGPARNPKTLNYALSKVAL-TSSEYL 173

Query: 165 SLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKA 224
           S           KS S++                      L+K    +S     I + + 
Sbjct: 174 S-----------KSGSDDVVTADI----------------LLK----YSDVQAKIAQARL 202

Query: 225 EMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKLKAQ 280
           + D+ +   FN++L + +N  F +  + RK+V+  RL++D  R    +    K+A L+ Q
Sbjct: 203 QQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIARANFTAARPEKQASLRVQ 262

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 102/239 (42%), Gaps = 44/239 (18%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESIS 112
           R VQE LG V+DIS+LP +Y  LEK+ D+L+ V    L V+  +E E YDYP  + +S++
Sbjct: 42  RLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVN 101

Query: 113 DWWSVNKDGWFGSRKSENANKKKVSNHDDAFL-------PRSFAQAISKAAVDCECEFQS 165
           +W          +R SE  +    +              P++   A+SK A++      +
Sbjct: 102 EWSRT-----VATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVALNGSQLVDN 156

Query: 166 LKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAE 225
           L               ET                   S L++    +S     + + + E
Sbjct: 157 LDAPRT--------PRETQLS----------------SGLLE----FSGVEAELAQARLE 188

Query: 226 MDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEV----KSKEAKLKAQ 280
            D+ +  +FN+KL   ++ +  +    RK+V   RL++D  R  +      KEA L+ Q
Sbjct: 189 QDAAVKAQFNEKLRGQLSGEIARAAAARKEVFQKRLQYDVARTNLLNAKPEKEASLRVQ 247

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 105/240 (43%), Gaps = 47/240 (19%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESIS 112
           R  QE LG ++DIS++P +Y  LE + D+L+   + +L V++ +E   YD+P +  ES+ 
Sbjct: 41  RLAQEKLGQITDISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQ 100

Query: 113 DWWSVNKDGWFGSRKSENANKKKVSNHDDAF--------LPRSFAQAISKAAVDCECEFQ 164
           DW         GSR  E +     S   +           PR+   A+S+A++       
Sbjct: 101 DWSRA-----IGSRVQELSRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAVS---- 151

Query: 165 SLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKA 224
           +L      G   +  S                      S LI    ++S     + + + 
Sbjct: 152 TLTSSNMPGPNGEGLS----------------------SGLI----AYSDTQAKLAQIRI 185

Query: 225 EMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEAKLKAQ 280
             D+ +  +FNK+L +++N    K ++ RK V+  R+ +D  R  +++    KEA L+ +
Sbjct: 186 AQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIARTNLQNARPEKEASLRVE 245

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 97/222 (43%), Gaps = 43/222 (19%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R V+E LG V DIS LP +Y  LE K D+ + V    L ++  +E E YDYP   +
Sbjct: 33  QSTHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFS 92

Query: 109 ESISDWWSV--NKDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSL 166
           ES++++     NK   F +  S   +  K         PR+   A+SK ++    +FQ L
Sbjct: 93  ESVNEFTDSIGNKMYEFSNGVSTEGSSGKT--------PRTLNYAVSKVSMGASEQFQKL 144

Query: 167 K-QDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAE 225
              D+K                              ++NL+    +      +I E +  
Sbjct: 145 HDTDDK-----------------------------RIANLL---TNVGNAEASIAEARLL 172

Query: 226 MDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMR 267
            D ++  +FN +L + I +  ++  + RK+V   RLK+D  R
Sbjct: 173 QDHSIQAKFNFQLREEIAQSIERASKYRKEVYHKRLKYDIAR 214

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 104/245 (42%), Gaps = 50/245 (20%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL-------PRSFAQAISKAAVD-CE 160
           ES++++          S+ +E  +    S   +  +       P++   A+SK A++  E
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSE 147

Query: 161 CEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNID 220
           C  +    +E+                                 L      +S     I 
Sbjct: 148 CLNKMFPTEEQP--------------------------------LASALLQFSDVQAKIA 175

Query: 221 EGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS-----KEA 275
           + + + D+ +  +FNK L + ++ +  K  + RK V   RL++D  R  + +     KEA
Sbjct: 176 QARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEA 235

Query: 276 KLKAQ 280
            L+ Q
Sbjct: 236 SLRVQ 240

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 105/245 (42%), Gaps = 50/245 (20%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K D+++ +    L V+  +E   YDYP  + 
Sbjct: 33  QSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL-------PRSFAQAISKAAVD-CE 160
           ES++++          S+ +E  +    S   +  +       P++   A+SK +++  E
Sbjct: 93  ESVNEF-----SRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNSSE 147

Query: 161 CEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNID 220
           C  +    +E+                                 L      +S     I 
Sbjct: 148 CLNKMFPAEEQP--------------------------------LASALLQFSDVQAKIA 175

Query: 221 EGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS-----KEA 275
           + + + D+ +  +FNKKL + ++ +  K  + RK V   RL++D  R  + +     KEA
Sbjct: 176 QTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEA 235

Query: 276 KLKAQ 280
            L+ Q
Sbjct: 236 SLRVQ 240

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 103/245 (42%), Gaps = 49/245 (20%)

Query: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLT 108
           +S  R VQE LG V+DIS+LP +Y  LE K DS++++    L VS  +E + YDYP    
Sbjct: 38  QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAK 97

Query: 109 ESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL---------PRSFAQAISKAAVDC 159
           ES+ ++          + K E  +    ++     L         P++   A+SK A+  
Sbjct: 98  ESLIEFSKT------AASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKS 151

Query: 160 ECEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNI 219
                    +E    K  +                        S L+    ++S     I
Sbjct: 152 SEHLNQFNDNE--AFKSSA------------------------SALL----NFSNIQAKI 181

Query: 220 DEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----KEA 275
            + + + D  + ++FN  L   +  +  K  ++RK+V+  RL++D  R  + +    KEA
Sbjct: 182 AQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEA 241

Query: 276 KLKAQ 280
            L+ Q
Sbjct: 242 SLRVQ 246

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 111/247 (44%), Gaps = 50/247 (20%)

Query: 47  SIKSRT-RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPP 105
           SI S T R VQE LG V+DIS+LP +Y  LEK+ D+++ V    L ++  ++ E YDYP 
Sbjct: 34  SIASSTQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPK 93

Query: 106 NLTESISDWWSVNKDGWFGSRKSENANKKKVSNHDDAFL--------PRSFAQAISKAAV 157
            +++S++D+        F S K E+ ++   +      L        PR+   A+SK A+
Sbjct: 94  YVSDSVNDY-----SKLFQS-KIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVAL 147

Query: 158 DCECEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYK 217
                   L+    + +                            S L+K    +S    
Sbjct: 148 TSSESLNQLQDPNVSAVA---------------------------STLLK----FSDMQT 176

Query: 218 NIDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKS----K 273
            I + + + D+ +  + NK +++ ++   +K  + R+ V+  RL++D  R ++      K
Sbjct: 177 KIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKSRRDVQYKRLQYDVARSKLAQAKPEK 236

Query: 274 EAKLKAQ 280
           EA L+ +
Sbjct: 237 EAALRVE 243

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 114/273 (41%), Gaps = 52/273 (19%)

Query: 53  RFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESIS 112
           R ++E LG   DIS LP +Y  LE K D+++++    L V+  +E E YDYP    ES  
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFW 96

Query: 113 DWWSVNKDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKA 172
           ++     + +     SE+ NK K+        P++   A+             L  +EK 
Sbjct: 97  EFTDSVGEKFSALNISEHNNKVKI--------PKTLNYALHNVF---------LTANEKV 139

Query: 173 GLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIK 232
            L  +   N                      +L +   S S    +I E +   DS +  
Sbjct: 140 KLLHEPLDN----------------------SLSETLASLSETEADIAEARLHQDSLVKS 177

Query: 233 EFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKA 292
             N +L++ ++++F++  + RK V   R  +D          AK   + A+  K+     
Sbjct: 178 RINYQLKEELSQNFERAAKYRKAVHHKRFNYDV---------AKTNFEHAKPEKQA---T 225

Query: 293 VSANAPISPDE-NPTTEDESPISKDLEGDSKKE 324
           +SA A I  DE    T+D + + +++  +S+ E
Sbjct: 226 LSAQADILKDEFEQATKDATIVMQEIISNSRLE 258

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 115/273 (42%), Gaps = 64/273 (23%)

Query: 55  VQESLGTVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDW 114
           +QE  G V+DIS LP +Y  LE++ DS++ V    L ++  +E E YDYP ++ +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 115 WSV-------------------NKDGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKA 155
                                 +  G     ++  ++   ++N++    PR+   A+SKA
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNS-PRTLNNALSKA 119

Query: 156 AVDCECEFQSLKQDEKAGLKKKSESNETXXXXXXXXXXXXXXXXXXLSNLIKVFDSWSTC 215
           A+      + LK D+ +                                   VF S+S  
Sbjct: 120 AL---FAAEQLKMDKDSS---------------------------------TVFHSFSEA 143

Query: 216 YKNIDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMR----YEVK 271
              I + + + D  + K FN +L+ ++       ++ RK V++ RL++D  R    +  +
Sbjct: 144 ESIISDERIKQDKIIQKSFNTELKNVLTNRIDVANKHRKDVQNKRLQYDISRTKLDHASE 203

Query: 272 SKEAKLKA----QKAETSKEVDDKAVSANAPIS 300
            KE+ L+      K    + +DD  +  +  IS
Sbjct: 204 DKESSLRVAMEQHKQAFEQSIDDAIIMMHEVIS 236

>Kwal_56.24080 s56 (839584..840816) [1233 bp, 410 aa] {ON} [contig
           166] FULL
          Length = 410

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 17/96 (17%)

Query: 203 SNLIK-VFDSWSTCYKNIDEGKAEMDSTMIKEFN-------KKLEKLINKDFKKVHE--- 251
           +NL++  F+ W   YK   E + E  ++ ++ +N       +KL  LI+K+F++V E   
Sbjct: 309 TNLVRSTFEKWKATYKPFAEHRIESLNSSLRSYNLQAPLSTQKLYLLIDKEFQRVLEKTD 368

Query: 252 LRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKE 287
           L++ ++D  L   T R +      +L +++  TS++
Sbjct: 369 LKQLIKDESLCRQTTRTQ------RLASEQPGTSRQ 398

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,518,356
Number of extensions: 1730231
Number of successful extensions: 10606
Number of sequences better than 10.0: 483
Number of HSP's gapped: 10974
Number of HSP's successfully gapped: 559
Length of query: 420
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 308
Effective length of database: 40,638,807
Effective search space: 12516752556
Effective search space used: 12516752556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)