Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4423.488ON30430416360.0
YPR147C3.488ON30430414550.0
Smik_16.4003.488ON30430414400.0
Suva_16.4763.488ON30430413930.0
TDEL0D055603.488ON3113107521e-98
TBLA0C044503.488ON3093107476e-98
NCAS0F035303.488ON3133167191e-93
KLTH0F14740g3.488ON3022937023e-91
CAGL0L08514g3.488ON3123126931e-89
Kwal_55.212193.488ON3022946791e-87
Kpol_480.173.488ON3133126782e-87
TPHA0D042203.488ON3163186749e-87
NDAI0B058303.488ON3293336375e-81
SAKL0F02860g3.488ON3053066312e-80
ZYRO0D10076g3.488ON3053086131e-77
Ecym_12413.488ON3053115279e-65
AFR306C3.488ON3192825174e-63
KAFR0E03110singletonON35684760.45
CAGL0H10406g2.325ON142065741.1
CAGL0L04686g3.454ON451130731.2
ADL215W2.286ON48463721.4
YLR099C (ICT1)8.284ON39449711.8
Suva_10.1838.284ON39449712.0
Smik_12.1588.284ON39457702.2
NCAS0B060902.325ON142965712.6
Skud_12.1678.284ON39457693.4
Kpol_543.498.284ON42961693.5
KLLA0E09197g2.325ON139765693.6
KLLA0F19624g8.284ON40952684.8
CAGL0K05489g5.679ON340124675.0
NCAS0B022608.524ON363115676.2
Kwal_27.119758.524ON336102666.8
Skud_4.3868.284ON44681667.8
Ecym_33592.325ON140965668.3
SAKL0G12078g5.231ON31685658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.442
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   634   0.0  
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   565   0.0  
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   559   0.0  
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   541   0.0  
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   294   1e-98
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   292   6e-98
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   281   1e-93
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   275   3e-91
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   271   1e-89
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   266   1e-87
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   265   2e-87
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   264   9e-87
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   249   5e-81
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   247   2e-80
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   240   1e-77
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   207   9e-65
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   203   4e-63
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               34   0.45 
CAGL0H10406g Chr8 complement(1011563..1015825) [4263 bp, 1420 aa...    33   1.1  
CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} simil...    33   1.2  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...    32   1.4  
YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON} ...    32   1.8  
Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {...    32   2.0  
Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {...    32   2.2  
NCAS0B06090 Chr2 (1151534..1155823) [4290 bp, 1429 aa] {ON} Anc_...    32   2.6  
Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {...    31   3.4  
Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {O...    31   3.5  
KLLA0E09197g Chr5 (820095..824288) [4194 bp, 1397 aa] {ON} simil...    31   3.6  
KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]...    31   4.8  
CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} simil...    30   5.0  
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    30   6.2  
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    30   6.8  
Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON...    30   7.8  
Ecym_3359 Chr3 complement(682021..686250) [4230 bp, 1409 aa] {ON...    30   8.3  
SAKL0G12078g Chr7 complement(1027844..1028794) [951 bp, 316 aa] ...    30   8.7  

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/304 (100%), Positives = 304/304 (100%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL
Sbjct: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180
           SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL
Sbjct: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180

Query: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240
           SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC
Sbjct: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240

Query: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300
           QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV
Sbjct: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300

Query: 301 NTFF 304
           NTFF
Sbjct: 301 NTFF 304

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/304 (86%), Positives = 283/304 (93%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           M V+EYTKS LPCSILNIKP+V    EDAPLLVWIPGNPGLLYYYQEML HLH KHPDWE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILG+SHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFS +NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180
           S+KLVGSV+K+GL+TPTVMDIHTSEMG+KMTA L YIPPLAHVVSL SY+FFYWILSEG 
Sbjct: 121 SNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240
           SRF+IDKFMGCGSTGYQAVLSTRI LTH+QFVRQSLGLA+QEM+EITTNWEFQD FINYC
Sbjct: 181 SRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYC 240

Query: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300
           +EN I IWFLFS+ DHWV+ KTR+HLS YYKDK+KQERLKIDVTDKIPHSFVVKHAEYA+
Sbjct: 241 EENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI 300

Query: 301 NTFF 304
           N FF
Sbjct: 301 NAFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/304 (84%), Positives = 282/304 (92%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           MP+QEYTKS  PCSILNIKP++   +EDA LLVWIPGNPGLLYYYQEMLQ+LHSKHPDWE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILG+SHAGMTLNAHSNTP++SLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL
Sbjct: 61  ILGISHAGMTLNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120

Query: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180
           S  LVG+V+K+GL+TPTVMDIHTSEMGVK+T  LHYIPPLAHVVSL SY+FFYWILSEG 
Sbjct: 121 SHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILSEGF 180

Query: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240
           SRF+IDKFMGCGST  QAVLSTRI LTHKQFVRQSLGLASQEM+EITTNWEFQD+FINYC
Sbjct: 181 SRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYC 240

Query: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300
           ++N   IWFLFS+ DHWV+ KTR+HLSHYYKDK+ Q RL+IDVTDKIPHSFVVKHA+YA+
Sbjct: 241 EQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAKYAI 300

Query: 301 NTFF 304
           NTFF
Sbjct: 301 NTFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/304 (80%), Positives = 278/304 (91%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           M +QEYTKS LPCSILNIKP+V T+NEDAPLLVWIPGNPGLL+YYQEM+ HLH KHPDWE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  ILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCL 120
           ILG+SHAGM+ NA SNTPIFSLQDQVDHQV+VINNFSH+NRKIIIMGHSVGAYI+QKVCL
Sbjct: 61  ILGISHAGMSSNARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQKVCL 120

Query: 121 SDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGL 180
           S++LVGSV K+GLITPTVMDIH SEMGVKMT   HY+P LAHV+S +SYVFFYW+LSEGL
Sbjct: 121 SNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLSEGL 180

Query: 181 SRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYC 240
           S+ +IDKFMGCG+ G +AVLSTR+ LTH+QFVRQSLGLASQE+KEITTNWEFQD+FIN+C
Sbjct: 181 SKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHC 240

Query: 241 QENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAV 300
           +E  IF WFLFSTKDHWV D+TR HLSHYY DK+KQE L+IDVTDK+PHSFVVKHAEYA+
Sbjct: 241 EEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAEYAI 300

Query: 301 NTFF 304
           N FF
Sbjct: 301 NAFF 304

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  294 bits (752), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 205/310 (66%), Gaps = 8/310 (2%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           M  +EY K   P SI++ K        + PL VWIPGNPGL+ YY+E L  +H +HP+WE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 61  ILGVSHAGMTLNAHSNTP------IFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYI 114
           +LG+SHAGM+  + S +       ++SL+ Q+DH++E+I +FS  NR +IIMGHSVGAY+
Sbjct: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120

Query: 115 LQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYW 174
           +Q + LSDKLVG V K+GL+TPT++DIHTS+ GV +T VL+++  L  +    S + F +
Sbjct: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGF 180

Query: 175 ILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQD 234
            L   + R ++  FMGC       VL+T +LL + +FV+Q+LGL+  EM+EI ++W FQ 
Sbjct: 181 FLPSFILRILLSFFMGCHRNS-SGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQR 239

Query: 235 EFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVK 294
             I +C E  I  W LFS  DHWVAD TR  L  +Y+D  + +++KI  T KIPHSFV+ 
Sbjct: 240 RLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIH-TCKIPHSFVLN 298

Query: 295 HAEYAVNTFF 304
           H++Y ++ +F
Sbjct: 299 HSKYLISEYF 308

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  292 bits (747), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 142/310 (45%), Positives = 201/310 (64%), Gaps = 7/310 (2%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATE-NEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDW 59
           M +Q Y  S  P SI++  P+   +  ED PL +WIPGNPGLL YY +ML+ LH K+P W
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 60  EILGVSHAGMTLNAHS-----NTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYI 114
           EILGVSHAGM+ N +      +T +++L +QV H+VEVINNFS   R IIIMGHSVGAY+
Sbjct: 61  EILGVSHAGMS-NGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYM 119

Query: 115 LQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYW 174
            Q+V +   L+G+V K+GL+TPTV+DIH S  G+KMT   +    L   + LLS + F  
Sbjct: 120 AQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSK 179

Query: 175 ILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQD 234
           +     +R+++   MGC +    A  ++ + LT+  FV+Q LGLAS EMK I  +W FQ 
Sbjct: 180 LFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQK 239

Query: 235 EFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVK 294
             I+YC +  +  WFLFS+ DHWV+D TR  L ++Y+   K + L + V++ IPHSFV+ 
Sbjct: 240 RLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVIN 299

Query: 295 HAEYAVNTFF 304
            +++ VN++F
Sbjct: 300 FSDFTVNSYF 309

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  281 bits (719), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 199/316 (62%), Gaps = 15/316 (4%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           M V+ Y     P  +++I P    E    P+ VWIPGNPG+L YYQEML +LH KHP WE
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTAEIN--PVFVWIPGNPGILEYYQEMLINLHEKHPTWE 58

Query: 61  ILGVSHAGMTLNAHS--------NTPIFSLQDQVDHQVEVINNFSHE-NRKIIIMGHSVG 111
           IL +SH GM     S        N+ +F+L++Q+ H++++INNF  + N  I I GHSVG
Sbjct: 59  ILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSVG 118

Query: 112 AYILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHY-IPPLAHVVSLLSYV 170
           AY++QK+  SD+L+G V K+GLITPT++DIH SE G  MT    +    L H++S L Y+
Sbjct: 119 AYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYI 178

Query: 171 FFYWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNW 230
            F W++   L  ++I   MGC     QA +ST + LT   FVRQSLGLA +EM  I  +W
Sbjct: 179 VFGWLVPGILRSYIIGYVMGCHHDS-QAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237

Query: 231 EFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQER--LKIDVTDKIP 288
           +FQ E I YC +N I I FLFS  DHWV + TR  +  +Y+++ K  +  LKIDV+D+ P
Sbjct: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297

Query: 289 HSFVVKHAEYAVNTFF 304
           HSFVV+ ++Y V  +F
Sbjct: 298 HSFVVRRSKYVVEHYF 313

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  275 bits (702), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 133/293 (45%), Positives = 197/293 (67%), Gaps = 2/293 (0%)

Query: 12  PCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTL 71
           P SIL++K  V++   DA L V+IPGNPGL+ YY   LQ +H K+PDWEILG+SHAGM  
Sbjct: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71

Query: 72  NAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSDKLVGSVRKI 131
                 P+++LQ+Q++H+V+VIN+++  N+KI IMGHSVGA+I QKV  S  L   V ++
Sbjct: 72  CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDEVARV 131

Query: 132 GLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGLSRFVIDKFMGC 191
           GL+TPTV+DIH SE G+K+TA+    P    +VS L ++ F  +  + L+ ++I  F   
Sbjct: 132 GLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIISHFADD 191

Query: 192 GSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFLF 251
             T   A  +TR+LLT+ +FV+Q+LGLA++EM+ I ++WE+Q +F++YC+     IW+LF
Sbjct: 192 PKTCLGA--ATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWLF 249

Query: 252 STKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAVNTFF 304
           S  DHWV+ +TR  L  +Y+     E + IDV+  I H+FV +HA+  V  +F
Sbjct: 250 SDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  271 bits (693), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 191/312 (61%), Gaps = 8/312 (2%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           M VQ Y  S LP  I++IKP+V   +E +PL VWIPGNPGLL YYQE L  +H K+P WE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  ILGVSHAGMTLNA-------HSNTPIFSLQDQVDHQVEVINNFSHE-NRKIIIMGHSVGA 112
           ILG+SHAG  + +        +  PI+ L+ Q  H++++IN  +++ NR+++IMGHSVGA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 113 YILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFF 172
           YI Q V  S  LVG V K+GLITPT+ DIH S  G+  T V +YI  +   +S +S   F
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 173 YWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEF 232
             ++    ++ +I   MGC    Y  +L T +LLT ++ +RQ LGLA+ EM EI  +W F
Sbjct: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240

Query: 233 QDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFV 292
           Q+  +  C++N   +W LFS  DHWV+  T+  L  + KD+  +  L++DV   I HSFV
Sbjct: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300

Query: 293 VKHAEYAVNTFF 304
           VK  +     +F
Sbjct: 301 VKDVDLVTRRYF 312

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  266 bits (679), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 196/294 (66%), Gaps = 2/294 (0%)

Query: 11  LPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMT 70
           LPCS+ +    + +   +APL V+IPGNPGL+ +Y+  L  +H K+P WEILG+SHAGM 
Sbjct: 11  LPCSLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMN 70

Query: 71  LNAHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSDKLVGSVRK 130
             +   +P++SL+ Q+DH++E+IN +  + + IIIMGHSVGA+++QK+  S +L   V +
Sbjct: 71  SCSEEVSPVYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130

Query: 131 IGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGLSRFVIDKFMG 190
           +GL+TPTV+DIH SE GVK+T++  + P   +VVS L++  F  +L   +++ +I   + 
Sbjct: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190

Query: 191 CGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFL 250
              +   A  +T +L+T+ +FV+Q+LGLA++E++ I ++W +Q EF+  CQEN+  IW+L
Sbjct: 191 DPQSCLGA--TTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL 248

Query: 251 FSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAEYAVNTFF 304
           FS KDHWV+  TR  +  +Y+        +IDV+  I H+FV +HA+  +  +F
Sbjct: 249 FSEKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  265 bits (678), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 198/312 (63%), Gaps = 12/312 (3%)

Query: 3   VQEYTKSTLPCSILNIKP-SVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEI 61
           V+ +  S  P SI+++ P +     ED+PL VWIPGNPGLL YY + L  +H K+P WE+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 62  LGVSHAGMTLNAHSNTP---------IFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGA 112
           LG+SHAGM+ + +             +F L++QV H+V++IN FS +NR +IIMGHSVGA
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123

Query: 113 YILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFF 172
           Y+ Q+V +++KL G + K+G +TPTV+DIH S+ G+KMT V ++   L H V  +S   F
Sbjct: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183

Query: 173 YWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEF 232
           + +L     +F I K + C S    AVL++  LL +   + Q+LGLA+ EM+ I  +W F
Sbjct: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242

Query: 233 QDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFV 292
             + I+YC E  +  WFLF+  DHWVA  TR  +  +Y+   K E ++ID+ D IPH+FV
Sbjct: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301

Query: 293 VKHAEYAVNTFF 304
           +K ++Y V+ +F
Sbjct: 302 IKKSKYIVDQYF 313

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  264 bits (674), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 133/318 (41%), Positives = 205/318 (64%), Gaps = 16/318 (5%)

Query: 1   MPVQEYTKSTLPCSILNIKPS-VATE--------NEDAPLLVWIPGNPGLLYYYQEMLQH 51
           M +  +  S  P SIL+IK + VA E        ++ +PL VWIPGNPGLL YY+E L+ 
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 52  LHSKHPDWEILGVSHAGMTLNAHSN-----TPIFSLQDQVDHQVEVINNFSHENRKIIIM 106
           LH K+P+W+ILG+SHAGM+ + +SN       +++L +Q+ H++E+IN F+   R++I+M
Sbjct: 61  LHVKNPEWDILGISHAGMS-SGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVM 119

Query: 107 GHSVGAYILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSL 166
           GHSVGA++ QKV +S+KL G V+KIGL+ PTV+DIH SE G +++ +L++IP L  +   
Sbjct: 120 GHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGW 179

Query: 167 LSYVFFYWILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEI 226
           +S   F   L   L +F+I  FM   +   +A  +T   L    FV QSLGLA  EM+ I
Sbjct: 180 VSEKIFGGFLPITLVKFIISFFMELNNEN-KAAHATYTFLKDSNFVEQSLGLAKYEMQII 238

Query: 227 TTNWEFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDK 286
             +WEFQ E +  C  N+I +W LF+  DHWV+++TR+ L   Y++ +  +     +TD+
Sbjct: 239 RHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQ 298

Query: 287 IPHSFVVKHAEYAVNTFF 304
           +PH+FV+K++ + V+ +F
Sbjct: 299 VPHAFVIKNSCHVVDNYF 316

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  249 bits (637), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 201/333 (60%), Gaps = 33/333 (9%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDA--PLLVWIPGNPGLLYYYQEMLQHLHSKHPD 58
           M V+ Y++S  P SI++I+     EN+ +  PL +WIPGNPG+L YYQ+ L  LH KHP 
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 59  WEILGVSHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFS---------HENRKIII 105
           WEIL + HAGM  +     H N  I+ L +Q++H++EVI  F           + R ++I
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120

Query: 106 MGHSVGAYILQKVCLSDKLVGSV-------RKIGLITPTVMDIHTSEMGVKMTAVLH--- 155
           MGHSVG Y++Q++ L+ +   ++       +KIG ITPT++DI+ S  G+ ++  L    
Sbjct: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180

Query: 156 -YIPPLAHVVSLLSYVFFYWILS--EGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFV 212
            Y+P   +++S LSY  F  IL   + + R +I   MGC  T + A+  T ILLT+   V
Sbjct: 181 GYLP---YILSYLSYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAI-GTEILLTNSVLV 236

Query: 213 RQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKD 272
           +QSLGLAS EM+EI  NW+ Q +F+  C  N+I +W LF   DHWV + TRT L  +Y+ 
Sbjct: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296

Query: 273 KIKQ-ERLKIDVTDKIPHSFVVKHAEYAVNTFF 304
             K   RL+I+V+ + PHSFVV H+++ V  FF
Sbjct: 297 NYKDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  247 bits (631), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 192/306 (62%), Gaps = 5/306 (1%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           M +Q Y+K+    S+ ++KP     N   PL V+IPGNPGL+ +Y+  L  +  KH +WE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  ILGVSHAGMTLNAHS---NTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQK 117
           ILG+SHAGM          T ++SL+DQV H++ VIN+F   NR +II GHS+GAYI+QK
Sbjct: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120

Query: 118 VCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILS 177
           + L   L+G+V+KI L+TPTV+DIH SE G K+  +  + P     V+  S++ F  +L 
Sbjct: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180

Query: 178 EGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFI 237
           + ++  ++  F+G   T  +   + ++L+T+ +FV+QSLGLA +EM+++  +W FQ  F+
Sbjct: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238

Query: 238 NYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAE 297
            +C+  E+ + FLF+ KDHWV  +TR  L+ +Y     ++ L ID  +KI HSFV+   +
Sbjct: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298

Query: 298 YAVNTF 303
             V+ +
Sbjct: 299 SVVDRY 304

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  240 bits (613), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 195/308 (63%), Gaps = 7/308 (2%)

Query: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60
           M ++    + LP S+L+IKP   + +  +PL VWIPGNPG++ YY+E L  LH K+  +E
Sbjct: 1   MSIRYLAGARLPTSVLHIKPKSPSPS--SPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58

Query: 61  ILGVSHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQ 116
           IL +SHAGM             I++L DQ+ H+VE+IN FS ++R +I+MGHSVGAY+ Q
Sbjct: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118

Query: 117 KVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWIL 176
            V L++KL+G V K+GLITPTV+DIH S+ G ++T   +++  L  + + +S + F  + 
Sbjct: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178

Query: 177 SEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEF 236
           S   +  VI  FMG        V +++ L+ + + +RQ+LGLA+ EM++I   W FQ + 
Sbjct: 179 SIMFTDQVISLFMGVDKESV-PVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237

Query: 237 INYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHA 296
           I++C  NEI   F+FS  D WV++ TR  L  +Y++  +   L+I V+  + HSF+VKH+
Sbjct: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297

Query: 297 EYAVNTFF 304
           +Y V+ +F
Sbjct: 298 KYIVDEYF 305

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  207 bits (527), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 185/311 (59%), Gaps = 15/311 (4%)

Query: 3   VQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEIL 62
           ++ Y +  +   IL+I    +      PLL++IPGNPGL+ +Y+E L+ +H ++P WE++
Sbjct: 1   METYLREDIFADILHI---YSQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57

Query: 63  GVSHAGMTLNAHSNT---PIFSLQDQVDHQVEVINNF--SHENRKIIIMGHSVGAYILQK 117
           G+ H GM+    +N+    + +L +Q++ +V+VIN F  +  +R I ++GHS+GAY++QK
Sbjct: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117

Query: 118 VCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILS 177
           + L   L G +  + L+TPT++DIH S  GV++T +  + P       ++  V F WIL 
Sbjct: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177

Query: 178 EGLSRFVIDKFMGCGSTGYQAVL-STRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEF 236
                ++  K +G GS   + VL S + L++  +FV+Q+LGLA  EM ++   W+FQDEF
Sbjct: 178 TSWIEWIARKLIG-GSD--ECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEF 234

Query: 237 INYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKI---KQERLKIDVTDKIPHSFVV 293
           I++CQ N+I + FLFS  DHWV   T   +   Y+ K    +++ L I +   I HSFVV
Sbjct: 235 ISFCQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVV 294

Query: 294 KHAEYAVNTFF 304
           K     VN +F
Sbjct: 295 KDTTKVVNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  203 bits (517), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 168/282 (59%), Gaps = 11/282 (3%)

Query: 31  LLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNAHSN--TPIFSLQDQVDH 88
           +L+++PGNPGL+ +Y+E L+ +H K+P WEI+G+SH GM+          +++L +QV+H
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEH 100

Query: 89  QVEVINNF--SHENRKIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEM 146
           +V+ IN+F  +  N  + ++GHS+GAY+ QKV +   L  +V  +GL+TPT++DIH S  
Sbjct: 101 KVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK 160

Query: 147 GVKMTAVLHYIPPLAHVVSLLSYVFFYWILSEGLSRFVIDKFMGCGSTGYQAVL-STRIL 205
           GV++T +  + P     VS++  V   W+L      ++  K +G GS   + VL S   L
Sbjct: 161 GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG-GSD--ECVLQSAEKL 217

Query: 206 LTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFLFSTKDHWVADKTRTH 265
           + +  +VRQ+LG+A  EM ++   W+FQ+EFI  CQE    +W LFS  DHWV   T   
Sbjct: 218 VKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKD 277

Query: 266 LSHYYKDKI---KQERLKIDVTDKIPHSFVVKHAEYAVNTFF 304
           +  +Y+ K        L+I + + I HSFVVK     VN +F
Sbjct: 278 IVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 31  LLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNAHSNTPIFSLQDQVDHQV 90
           L + IPG  G L  ++ +++ + + + ++  + +   G + + +SN  +  +   +D  +
Sbjct: 82  LFLCIPGLGGNLEQFEPLVRLIDASNKNFLAIDLPGFGKSED-YSNYSMTHIATLIDQML 140

Query: 91  EVINNFSHENRKIIIMGHSVGAYI 114
           E +   + +N KI +MGHS+G ++
Sbjct: 141 ETVIGTAPDNYKINVMGHSMGTHL 164

>CAGL0H10406g Chr8 complement(1011563..1015825) [4263 bp, 1420 aa]
            {ON} similar to uniprot|Q07527 Saccharomyces cerevisiae
            YDL112w TRM3
          Length = 1420

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 84   DQVDHQVEVINNFSHENRKIIIMG---HSVGAYILQK--VCLSDKLVGSVRKIGLITPTV 138
            +Q D  +++ NNF   ++ +I++G   H +  ++L +  +CL  K  G +R + + T T 
Sbjct: 1350 EQTDKSIKLDNNFKFPSKSLILLGTEAHGIPGHLLNELDLCLEIKQHGVIRSMNIQTATA 1409

Query: 139  MDIHT 143
            + +H+
Sbjct: 1410 VIVHS 1414

>CAGL0L04686g Chr12 (539203..540558) [1356 bp, 451 aa] {ON} similar
           to uniprot|P53264 Saccharomyces cerevisiae YGR110w
          Length = 451

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 53/130 (40%), Gaps = 10/130 (7%)

Query: 16  LNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNAHS 75
           L I+P+    N+    L+++ G    L +Y +  +HL      W I  +   G   ++  
Sbjct: 119 LVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDDSWSIHAIDLPGYGFSSRM 178

Query: 76  NTPIFSLQDQ--------VDHQVEVINNFSHENRKIIIMGHSVGAYILQKVCLSDKLVGS 127
           + P    +D         +     +      +    I+M HS+GAY++      +K   S
Sbjct: 179 DFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMAHSMGAYLM--AFYLNKYPDS 236

Query: 128 VRKIGLITPT 137
           V+K+ + +P 
Sbjct: 237 VKKMVMCSPA 246

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 5   EYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNP-GLLYYYQEMLQHLHSKHP----DW 59
           EY K  +   + ++   V  E EDA  + WI  NP  +    +E+LQ L  K P    DW
Sbjct: 125 EYAKQLVKLGVADLSVLVQDEREDATPVRWIRLNPFRIRGQREEVLQELQKKFPRRVADW 184

Query: 60  EIL 62
             L
Sbjct: 185 REL 187

>YLR099C Chr12 complement(339744..340928) [1185 bp, 394 aa] {ON}
           ICT1Lysophosphatidic acid acyltransferase, responsible
           for enhanced phospholipid synthesis during organic
           solvent stress; null displays increased sensitivity to
           Calcofluor white; highly expressed during organic
           solvent stress
          Length = 394

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 90  VEVINNFSHEN--RKIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITP 136
           V+ I  +  +N  RKI ++GHS G YI  K  L  K   S+ K+ LI+P
Sbjct: 162 VDRIEQWRKDNKLRKINVVGHSFGGYISFKYAL--KYPDSIEKLCLISP 208

>Suva_10.183 Chr10 complement(344549..345733) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 90  VEVINNFSHEN--RKIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITP 136
           V+ I  +  +N  RKI ++GHS G YI  K  L  K   S+ K+ LI+P
Sbjct: 162 VDRIEQWRKDNNLRKINVVGHSFGGYISFKYAL--KYPNSIDKLCLISP 208

>Smik_12.158 Chr12 complement(319660..320844) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 82  LQDQVDHQVEVINNFSHEN--RKIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITP 136
           L+   ++ V+ I  +  +N  RKI ++GHS G YI  K  L  K   S+ K+ LI+P
Sbjct: 154 LEQYENYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYAL--KYPNSIDKLCLISP 208

>NCAS0B06090 Chr2 (1151534..1155823) [4290 bp, 1429 aa] {ON} Anc_2.325
            YDL112W
          Length = 1429

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 84   DQVDHQVEVINNFSHENRKIIIMG---HSVGAYILQK--VCLSDKLVGSVRKIGLITPTV 138
            +Q D  V++ NN+    + +I++G   H +   +L +  +CL  K  G +R + + T T 
Sbjct: 1359 EQTDKSVQLDNNYKFPRKSLILLGTEAHGIPGPLLNELDLCLEIKQHGVIRSMNIQTATA 1418

Query: 139  MDIHT 143
            + +H+
Sbjct: 1419 VIVHS 1423

>Skud_12.167 Chr12 complement(322870..324054) [1185 bp, 394 aa] {ON}
           YLR099C (REAL)
          Length = 394

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 82  LQDQVDHQVEVINNFSHEN--RKIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITP 136
           L+   ++ V+ I  +  +N  R+I ++GHS G YI  K  L  K   S+ K+ LI+P
Sbjct: 154 LEQYENYFVDRIEQWRKDNKLRRINVVGHSFGGYISFKYAL--KYPNSIDKLCLISP 208

>Kpol_543.49 s543 complement(108945..110234) [1290 bp, 429 aa] {ON}
           complement(108945..110234) [1290 nt, 430 aa]
          Length = 429

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 6/61 (9%)

Query: 87  DHQVEVINNFSHENR--KIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITPTVM--DIH 142
           D+ VE I ++   N+  KI ++GHS G YI  K  +  K   ++ ++ L++P  M  +IH
Sbjct: 187 DYYVEKIEDWRKANKLEKINLVGHSFGGYISFKYAI--KYPDAINRLCLVSPLGMESNIH 244

Query: 143 T 143
           +
Sbjct: 245 S 245

>KLLA0E09197g Chr5 (820095..824288) [4194 bp, 1397 aa] {ON} similar to
            uniprot|Q7LGS3 Saccharomyces cerevisiae YDL112W TRM3
            2'-O-ribose methyltransferase catalyzes the ribose
            methylation of the guanosine nucleotide at position 18 of
            tRNAs
          Length = 1397

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 84   DQVDHQVEVINNFSHENRKIIIMG---HSVGAYILQKV--CLSDKLVGSVRKIGLITPTV 138
            +Q D  +++ + F   ++ +I++G   H +  ++L+++  CL  K  G +R + + T T 
Sbjct: 1327 EQTDSSIQLNSEFKFPSKSVILLGTEAHGIPGHLLKELDLCLEIKQSGVIRSMNIQTATA 1386

Query: 139  MDIHT 143
            + +H+
Sbjct: 1387 VIVHS 1391

>KLLA0F19624g Chr6 complement(1817206..1818435) [1230 bp, 409 aa]
           {ON} similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125C ECM18 Protein of unknown function, similar to
           Rlp24p
          Length = 409

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 87  DHQVEVINNFSHENR--KIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITP 136
           D+ V+ +  +  EN+  KI ++GHS G Y+  K  L  K   +V K+ L++P
Sbjct: 174 DYYVDALEKWRKENKLSKINLVGHSYGGYLTFKYSL--KYPDNVHKLCLVSP 223

>CAGL0K05489g Chr11 (538801..539823) [1023 bp, 340 aa] {ON} similar
           to uniprot|P41834 Saccharomyces cerevisiae YOR075w
           syntaxin of the ER
          Length = 340

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 53/124 (42%), Gaps = 19/124 (15%)

Query: 50  QHLHSKHPDWEILGVSHA------GMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENRKI 103
           Q L    P  E+   +H+       ++L    + P+  +QD++    E I+  + E  ++
Sbjct: 181 QSLSFSQPSQEVDLNNHSEVDLTESISLTVSQSQPVEHIQDEIKQYEETISQLTQEQLQV 240

Query: 104 IIMGHSVGAYILQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHV 163
           +   H     I QK          ++K+GLI  T+M+I    +GV+     H      ++
Sbjct: 241 LETEHE--ELINQKN-------EQLKKVGLINKTIMEI----VGVQSELAAHLQVQSQNI 287

Query: 164 VSLL 167
            S+L
Sbjct: 288 NSML 291

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 55/115 (47%), Gaps = 4/115 (3%)

Query: 26  NEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMT--LNAHS-NTPIFSL 82
           N+  PL ++I G  G L  ++ +L+  H K   +  L +   G +  L ++S  + I ++
Sbjct: 78  NDGHPLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSVIETI 137

Query: 83  QDQVDHQVEVINNFSHENR-KIIIMGHSVGAYILQKVCLSDKLVGSVRKIGLITP 136
           +  VD       +     + K+I+ GHS+G Y+      +      +RKI L++P
Sbjct: 138 RSVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 55/102 (53%), Gaps = 11/102 (10%)

Query: 16  LNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDW---EILGVSHAGMTLN 72
           L I  +VA ++   P+ V+I G  G L  ++ +L+ L   +  +   ++ G  H+   L+
Sbjct: 65  LRICHNVAHQHGTGPVYVFIHGLGGTLTQFEPLLRVLDVLNEGFLTIDLPGFGHSD-ELD 123

Query: 73  AHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYI 114
           ++S   I  +  +V   VE     + +N+K+I++GHS+G +I
Sbjct: 124 SYSMLDIAKIIREV--LVE-----TTKNKKVIVVGHSMGCHI 158

>Skud_4.386 Chr4 complement(673125..674465) [1341 bp, 446 aa] {ON}
           YDR125C (REAL)
          Length = 446

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 4/81 (4%)

Query: 58  DWEILGVSHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSHENR--KIIIMGHSVGAYIL 115
           D + +G +   +    ++N   F +Q   D  ++ I  +  +N+  K+ I+GHS GAY+ 
Sbjct: 176 DIKFIGKNKFKIPYTINANHHKFVIQMFEDFYLDRIEQWRIDNKLGKMNIVGHSFGAYLS 235

Query: 116 QKVCLSDKLVGSVRKIGLITP 136
            K  +  K   SV K+ L++P
Sbjct: 236 FKYAV--KYPNSVEKLCLVSP 254

>Ecym_3359 Chr3 complement(682021..686250) [4230 bp, 1409 aa] {ON}
            similar to Ashbya gossypii ADL294C
          Length = 1409

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 84   DQVDHQVEVINNFSHENRKIIIMG---HSVGAYILQK--VCLSDKLVGSVRKIGLITPTV 138
            +Q D  V++ +N+S   + +I++G     +  ++L +  +CL  K  G +R + + T T 
Sbjct: 1339 EQTDQSVQLDHNYSFPTKSLILLGTEAEGIPGHLLSELDLCLEIKQSGIIRSMNIQTATA 1398

Query: 139  MDIHT 143
            + +H+
Sbjct: 1399 VVVHS 1403

>SAKL0G12078g Chr7 complement(1027844..1028794) [951 bp, 316 aa]
           {ON} similar to uniprot|Q07913 Saccharomyces cerevisiae
           YLR007W NSE1 Essential nuclear protein required for DNA
           repair forms a complex with Smc5p and Rhc18p
          Length = 316

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 35  IPGNPGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNA-HSNTPIFSLQDQV-DHQVEV 92
           IP +    Y  Q +LQ     H +  ILG+ H  M     HS+      + ++ DH  ++
Sbjct: 9   IPDSDKRRYLLQYILQSRGVCHENSLILGLMHLEMDSGTYHSDWAASDWEKRLGDHIADI 68

Query: 93  INNFSHENRKIIIMGHSVGAYILQK 117
               S  N K++  GH +G  ++ K
Sbjct: 69  NVKLSGLNYKVVRCGHGIGRSVVMK 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,446,165
Number of extensions: 1446098
Number of successful extensions: 3914
Number of sequences better than 10.0: 57
Number of HSP's gapped: 4001
Number of HSP's successfully gapped: 57
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)