Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.441singletonON36361739e-19
YPR146CsingletonOFF109361066e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.441
         (36 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.441 Chr16 complement(779166..779273) [108 bp, 36 aa] {ON...    71   9e-19
YPR146C Chr16 complement(825347..825676) [330 bp, 109 aa] {OFF} ...    45   6e-08

>Skud_16.441 Chr16 complement(779166..779273) [108 bp, 36 aa] {ON}
          YPR146C (REAL)
          Length = 36

 Score = 71.2 bits (173), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%)

Query: 1  RDLVILQVALAYICVRILVNTYIYKKRSEASIASRM 36
          RDLVILQVALAYICVRILVNTYIYKKRSEASIASRM
Sbjct: 1  RDLVILQVALAYICVRILVNTYIYKKRSEASIASRM 36

>YPR146C Chr16 complement(825347..825676) [330 bp, 109 aa] {OFF}
          Dubious open reading frame unlikely to encode a
          functional protein, based on available experimental and
          comparative sequence data
          Length = 109

 Score = 45.4 bits (106), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%)

Query: 1  RDLVILQVALAYICVRILVNTYIYKKRSEASIASRM 36
          RDL+I Q+ LAY C+ + VN YI    SEASIASRM
Sbjct: 44 RDLMISQIVLAYNCISVHVNMYISTNGSEASIASRM 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.139    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 2,456,160
Number of extensions: 33691
Number of successful extensions: 132
Number of sequences better than 10.0: 2
Number of HSP's gapped: 133
Number of HSP's successfully gapped: 2
Length of query: 36
Length of database: 53,481,399
Length adjustment: 11
Effective length of query: 25
Effective length of database: 52,220,073
Effective search space: 1305501825
Effective search space used: 1305501825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 59 (27.3 bits)