Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4393.483ON57257230180.0
Smik_16.3963.483ON57257229280.0
Suva_16.4743.483ON57257229180.0
YPR145W (ASN1)3.483ON57257229050.0
Kpol_480.193.483ON57457126380.0
Smik_6.2203.483ON57257226360.0
Suva_7.4103.483ON57257326140.0
TDEL0D055203.483ON57357226120.0
YGR124W (ASN2)3.483ON57257226070.0
CAGL0I10648g3.483ON57457226030.0
Skud_7.4353.483ON57257325900.0
SAKL0F02970g3.483ON57357225870.0
KAFR0G036703.483ON57257225850.0
NDAI0B058103.483ON57757525730.0
NCAS0F035103.483ON57557325720.0
KNAG0A079203.483ON57857625690.0
KLLA0B10868g3.483ON57457225560.0
KLTH0F14630g3.483ON57357225490.0
Kwal_55.211873.483ON57357125480.0
TPHA0D042003.483ON57457125360.0
AFR303W3.483ON57157124680.0
TBLA0C044303.483ON58057924680.0
ZYRO0B04136g3.483ON57257224600.0
Ecym_12443.483ON57357124000.0
KNAG0J002008.875ON5154701431e-08
ZYRO0A00528g8.875ON5121031384e-08
Kpol_455.78.875ON518941261e-06
TPHA0C049508.875ON525991224e-06
KAFR0L021108.875ON514951171e-05
Skud_13.468.875ON519991162e-05
ADL350C8.875ON508891152e-05
SAKL0D00352g8.875ON515891143e-05
TDEL0B004408.875ON5162201143e-05
Suva_13.528.875ON519731126e-05
NCAS0C001908.875ON5171051117e-05
YML096W8.875ON525951101e-04
NDAI0K001808.875ON522941091e-04
KLLA0D10285g8.875ON5151061082e-04
TBLA0C063008.875ON5181261082e-04
Smik_13.398.875ON521961063e-04
Skud_7.311singletonON8189945e-04
Kwal_27.97058.875ON515911038e-04
Ecym_81558.875ON513831028e-04
CAGL0H06963g8.875ON51793980.003
KLTH0E16412g8.875ON51595950.007
YDL148C (NOP14)7.327ON81037715.0
Smik_4.2393.198ON46162705.9
YDR004W (RAD57)3.198ON46032697.5
TPHA0H016305.406ON103679707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.439
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...  1167   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1132   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1128   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1123   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1020   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1019   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1011   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1010   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1008   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1007   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1002   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1001   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1000   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   995   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   995   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   994   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   989   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   986   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   986   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   981   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   955   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   955   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   952   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   929   0.0  
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    60   1e-08
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    58   4e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    53   1e-06
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    52   4e-06
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    50   1e-05
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    49   2e-05
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    49   2e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    49   3e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    49   3e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    48   6e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    47   7e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    47   1e-04
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    47   1e-04
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    46   2e-04
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    46   2e-04
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    45   3e-04
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    41   5e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    44   8e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    44   8e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    42   0.003
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    41   0.007
YDL148C Chr4 complement(188154..190586) [2433 bp, 810 aa] {ON}  ...    32   5.0  
Smik_4.239 Chr4 (434533..435918) [1386 bp, 461 aa] {ON} YDR004W ...    32   5.9  
YDR004W Chr4 (455201..456583) [1383 bp, 460 aa] {ON}  RAD57Prote...    31   7.5  
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    32   7.9  

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1167 bits (3018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/572 (97%), Positives = 560/572 (97%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPF          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/572 (94%), Positives = 551/572 (96%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHEDVH YK KALQLSKRIRHRGPDWSGNA KNSTIFVHERLAIVGLESGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECP+YQFKTLSDCEPIIPMYLKHDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDY+AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARETANATNDV+PSTYDSKARHLAGVDDDG LHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLD+EFLQLCMNIDP EKMI+ KEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE VISDEMFASPKAEWGSDIP+TKEAFWYRLKFDALFPQKTV
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/572 (94%), Positives = 551/572 (96%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHEDVHRYK KALQLSKRIRHRGPDWSGNA KNSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRI+AARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDY+AIRHSLEKAVRKRLMAEVPF          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARETA ATNDVEPSTYD+KARHLAGVDD+GNLHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP EKMIR KEGRIEKYILRKAFDTT EP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWIDSLKD AEAVISDEMFA+PKAEWG+DIPTTKEA+WYRLKFD LFPQKTV
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/572 (93%), Positives = 547/572 (95%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA++HEDVHRYK KALQLSKRIRHRGPDWSGNA KNSTIFVHERLAIVG+ESGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D +YMLCVNGEIYNHIQLREEC DY+F TLSDCEPIIPMYLKHDI+APKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARETA ATNDVEPSTYDSKARHLAG+DDDG LHTAGWTSLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP EKMI+ KEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           ADTVMRW+PKADWGCAEDPSGRYAQIHEKHIE
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1020 bits (2638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/571 (83%), Positives = 519/571 (90%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAYKHE+   +K +ALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSP  DY+LCVNGEIYNHIQLRE CPDY++KTLSDCEPIIP+YLKHDI+APKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR+S SPKTV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYF+PDW+DE+RIP+ P+ Y AIR SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  +++ + YDS+ +HL G+DD GNLHTAGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP EKMI A EGRIEKYILRKAFDT+ EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE VISDE+F++PK  WG+DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A+TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1019 bits (2636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/572 (84%), Positives = 522/572 (91%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KH+D+H +K KALQLSKRIRHRGPDWSGNA  NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLREEC DY+F+T SDCEPIIP+YL+HDI+APKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ +YDAK+DRIVAARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY+AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDV-EPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPD 299
             IA+IAARET  A  DV E S+ D K   LAG+DD G+LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 420 RVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479
           RVPFLD++FLQLCMNIDPK+KMI+ KEG+IEKYILRKAFDTT EPD KPYLPEEILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQK 478

Query: 480 EQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWID L+D AE VISD MFA+PKA+WG DIPTTKEA+WYRLKFDA FPQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
            A+TVMRWVPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 539 AANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/573 (83%), Positives = 518/573 (90%), Gaps = 5/573 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHED+  +K KALQLSKRIRHRGPDWSGNA  NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D DYML VNGEIYNHIQLRE+C DY+F+T SDCEPIIP+YL+HDI+APKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+K+DR++AARDPIG+ TLYMGR S SPKTVYFASELKCLTD CD+I AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKR+P+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARET--ANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAP 298
             IA+IAARET  AN   + E S   SK   LAG+DD G+LHT+GW+ LHSFA+GLPNAP
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSK---LAGIDDQGHLHTSGWSRLHSFAVGLPNAP 297

Query: 299 DLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 358
           DLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA
Sbjct: 298 DLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 357

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLE
Sbjct: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLE 417

Query: 419 ARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQ 478
           ARVPFLD++FLQLCMNIDPK+KMI +KEGRIEKYILRKAFDTT EPD KPYLPEEILWRQ
Sbjct: 418 ARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQ 477

Query: 479 KEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQK 538
           KEQFSDGVGYSWIDSL+D AE VISD MFA+PKA WG DIPTTKEA+WYRLKFDA FPQK
Sbjct: 478 KEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQK 537

Query: 539 TVADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           T ADTVMRWVPKADWGCAEDPSGRYAQIHEKH+
Sbjct: 538 TAADTVMRWVPKADWGCAEDPSGRYAQIHEKHV 570

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1010 bits (2612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/572 (82%), Positives = 516/572 (90%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHEDV  YKQKALQLSKRIRHRGPDWSGN  +N+T+ VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHI+LREE  DY+F TLSDCEPIIP+Y K+DI+ PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRI+AARDP+GITTLYMGR+S SPKTV+FASELKCLTDDCD I AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTDKITRYFTPDWLDE RIPS P+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  +++   YDS+ +HLAG+DD GNLH+AGW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDPK+KMI  +EGR+EKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE VISD++FA+PK+ WG D+PTTKEAFWYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           ADTVMRWVPKADWGCAEDPSGR+AQIH++H++
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVK 572

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/572 (83%), Positives = 516/572 (90%), Gaps = 3/572 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHED+H +K KALQLSK+IRHRGPDWSGNA  NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLRE C DY+F+T SDCEPIIP+YL+HDI+APKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+K+DRIVAARDPIG+ TLYMGRSS SP+TVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDV-EPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPD 299
             IA+IAARET  A  D  E +  D K   LAG+DD G+LHT+GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDEK--QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418

Query: 420 RVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479
           RVPFLD++FLQLCMNIDP EKMI+ KEGRIEKYILRKAFDTT EPD KPYLPEEILWRQK
Sbjct: 419 RVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478

Query: 480 EQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWID L+D AE  ISD MFA+PKA+WG DIPTTKEA+WYRLKFDA FPQKT
Sbjct: 479 EQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
            ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 539 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/572 (83%), Positives = 513/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAYKH+DVH +K KALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D DY LCVNGEIYNHIQLRE+ PDY+FKTLSDCEPIIP YL+HDI+APKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRIVAARDP+GITTLYMGR S+SPKTV+FASELKCLTDDCD ITAFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDW+DE RIP+TP+++  IR SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKA-RHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPD 299
             IASIAARET  A  + + +  D+ A + LAG+D+ G+LHTAGW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDPK+KMI    GRIEKYILRKAFDT+ EPD KPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWID LKD AE VISD MF++PK EWG DIPTTKEA+WYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
            A TVMRW+PKADWGCAEDPSGRYA+IHE+H+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/573 (83%), Positives = 518/573 (90%), Gaps = 5/573 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHED++ +K KALQLSKRIRHRGPDWSGNA  NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PI S D +YML VNGEIYNHIQLRE+C  Y+F+T SDCEPIIP+YL+HDI+APK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYDAK+DR+VAARDPIG+ TLYMGRSS SPKTVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTP+WLDEKRIPS P+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARET--ANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAP 298
             IA+IAARET  ANA  D + S  +   + LAG+DD G+LHT+GW+ LHSFA+GLPNAP
Sbjct: 241 SLIAAIAARETEKANADADGDASVNN---KQLAGIDDQGHLHTSGWSRLHSFAVGLPNAP 297

Query: 299 DLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 358
           DLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA
Sbjct: 298 DLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKA 357

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE
Sbjct: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417

Query: 419 ARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQ 478
           ARVPFLDR+FLQLCMNIDPK+KMI  KEGRIEKYILRKAFDTT EP+ KPYLPEEILWRQ
Sbjct: 418 ARVPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQ 477

Query: 479 KEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQK 538
           KEQFSDGVGYSWID L+D AE VISD MFA+PKA+WG+DIPTTKEA+WYRLKFDA FPQK
Sbjct: 478 KEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQK 537

Query: 539 TVADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           T ADTVMRWVPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 538 TAADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/572 (82%), Positives = 503/572 (87%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA YKHE V  +K KALQLSKRIRHRGPDWSGN  KN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D DY LCVNGEIYNHI+LREE   Y FKTLSDCEPIIP+Y K+DI+ PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGRSS+SP TV+FASELKCL DDCD ITAFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVP+          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  D++P  YD + +HLAGVDD GNLH AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI S HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDP EKMI   EGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AEA ISDE FA PK EWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/572 (81%), Positives = 514/572 (89%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA++HEDV  +K KALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQLRE+ PDY+FKTLSDCEPIIP+YL+ DI+APK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYD+K+DRI+AARDPIG+TTLYMGRSS SPKTV+FASELKCL DDCD+I AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRYFTP+W+DE +IP+TP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  +++ S Y  +  HLAG+DD+G+L T+GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDP +K+I  KEGRIEKYILRKAFDT  +P AKPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE VISDEMFA+PK+ WG DIPTTKEA+WYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           A+TVMRW+PKADWGCAEDPSGRYAQIHEKHI+
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/575 (81%), Positives = 510/575 (88%), Gaps = 4/575 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA+KHEDVH +K +ALQLSKRIRHRGPDWSGN  KN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+RE+ PDY FKTLSDCEPIIP+YLKHDI+ PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+KQDRI+AARDPIGITTLYMGR+S +P+TV+FASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSKTD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVPF          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIASIAARET----ANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPN 296
             IASIAARET    A AT D E +  ++   HL GVDD+G+LH  GW+ LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDLQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476
           LEARVPFLDR+FLQLCMNIDPKEKMI   EGRIEKYILRKAFDT+ +P+AKPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFP 536
           RQKEQFSDGVGYSWID LKD AE VISD MF +PK  WG+DIPTTKEA+WYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           QKT ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 575

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/573 (81%), Positives = 511/573 (89%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA++HEDV  YK KALQL+KRIRHRGPDWSGN  KN+TI  HERL+IVGL+SGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSP  +Y LCVNGEIYNHIQ+REEC DYQFKTLSDCEPIIP+YLK+D++APK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAKQDRIVAARDPIGITTLYMGR S +P+TVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTP+D  AIR +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKA-RHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPD 299
             IASIAARET  A  DV+    + +  +HL GVDD+G+LHT GW+ LHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQK 479
           RVPFLD+EFLQLCMNIDPK+KMI    G+IEKYILRKAFDTT +P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 480 EQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKT 539
           EQFSDGVGYSWID LKD AE VISD MF +PK  WG+D+PTTKEA+WYRLKFDAL+PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 540 VADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
            ADTVMRW+PKADWGCAEDPSGRYA+IHEKH++
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/576 (81%), Positives = 513/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA ++HEDV  +K +ALQLSKRIRHRGPDWSGN  KNSTI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSP  DY+L VNGEIYNHIQLREECP+YQ+K+LSDCEPIIPMYLK+D++APK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTP+D   IRH+LEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYD----SKARHLAGVDDDGNLHTAGWTSLHSFAIGLPN 296
             IA+IAARET  A  +++P  YD    ++  HLAG+DD+GNL +A W+ LHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476
           LEARVPFLD+EFL LCMNIDPK+K+I  KEGRIEKYILRKAFDT  EPD KPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFP 536
           RQKEQFSDGVGYSWID LKD AE VISDEMFA+PKA WG D+PTTKEAFWYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           Q T A+TVMRW+PKADWGCAEDPSGR+A+IHE+H+E
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/572 (81%), Positives = 507/572 (88%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA++++ DV  YK KALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D  Y L VNGEIYNHI LREEC  Y FKTLSDCEPIIP+Y K+DI+APK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+K+DRI+AARDPIGITTLYMGRSSASPK+V+F+SELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDK+TRYFTPDWLDE RIP+TP+D+ A+R SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET     +++P  YDS    LAG+D+ G+LH AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDR+FLQLCMNIDP +KMI+  EG+IEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE+ ISDE FA PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H++
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  986 bits (2549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/572 (81%), Positives = 503/572 (87%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIF  ++H+ V  +K  AL+L KRIRHRGPDWSGN  KNST+  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           P  S D +Y+L VNGE+YNHIQLREE   Y FKTLSDCEPIIP+Y K+ I+APKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRYF PDW+DE RIPS P+D + IRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A + ++P  YDS+ +HLAGVDD GNL +AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMN+DPKEKMI A EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AEA ISDE F  PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  986 bits (2548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/571 (80%), Positives = 506/571 (88%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIF  ++HEDV ++K  ALQL+KRIRHRGPDWSGN  +NST+  HERLAIVGL++GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           P+ S ++DY+L VNGEIYNHIQLREE  DY FKTLSDCEPIIP+Y K+ I+APKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD K+DR++AARDPIGITTLYMGR S SPKTVYFASELKCLTD+CD+I AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE RIPS P+D + IR+SLEKAVRKRLMAEVP+          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  ++ P  YDS+ +HLAGVDD G LH+AGW+ LHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFL LCMN+DPKEKMI   EGRIEKYILRKAFDT+ EP AKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AEA ISDE F  PKAEWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IH++HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  981 bits (2536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/571 (80%), Positives = 500/571 (87%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIF  YKHE+   +K +ALQLSKRIRHRGPDWSGN  KNSTI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITS D D++LCVNGEIYNHIQ+RE+ PDYQFKTLSDCEPIIP+Y+K+  EAPK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AWTLYDAKQDRI+AARDPIGITTLYMGRSS SPKTVYFASELKCLTDDCD+I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD+ITRY+TPDW+DE RI + P+D M IRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A       +  S    L G+DD+GNL ++GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFL LCMNIDP EKMI  KEGRIEKYILRKAFDTT EP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE VISDE+F +P+  WGSDIPTTKEA+WYRLKFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/571 (78%), Positives = 493/571 (86%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA Y+ +D+  +K  AL+LSKR+RHRGPDWSGN  KN TI VHERLAIVGL+SGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PI SPD +Y+LCVNGEIYNHI LREEC DY+F +LSDCEPIIP+YLK+D+E P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD ++DRIVAARDPIG+TTLYMG+SS+SP+T YFASELKCL D+CD ITAFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TDK+TRYF PDW+DE RIPS P+DY A+R +LEKAVRKRLMAEVP+          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  +      D K  HLAG+DD G LHT GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVYADGK--HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDREFLQLCMNIDP EKMI  ++GRIEKYILRKAFDT+ EP   PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE  ISDE FA+P   WG DIPTTKEAFWYRLKFDALFPQ T 
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWVPKADWGCAEDPSGRYA+IH++HI
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/579 (76%), Positives = 502/579 (86%), Gaps = 7/579 (1%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAAYKH +V+ +K +ALQL+KRIRHRGPDWSGN  KN+T+F HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PITSP  +YML VNGEIYNHIQLREE  DY++KTL DCEPIIPMYLK+D++AP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           A+ LYD+++DR++AARDP+GITTLYMGR+S +PKTVYFASELKCL DDCD+I AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS+TDKI RYF P+W+DE  IP+TP+D   +R +LE+AVRKRLMAEVP+          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKA-------RHLAGVDDDGNLHTAGWTSLHSFAIG 293
             IASIAARET    ++     Y+ ++       + L G+DD GNL T  W+ LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL+AARKVA FIGS HHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEE 473
           AWGLEARVPFLDR+FL LCMNIDP +KMI+ KEG+IEKY+LRKAFDT+ EPD KPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDA 533
           ILWRQKEQFSDGVGYSWIDSLKD AE VISDEMFA+PK  WGSDIPTTKEA+WYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           LFPQKT ADTVMRW+PKADWGCAEDPSGRYA+IHE+HI+
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHID 579

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/572 (78%), Positives = 492/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFAA++H DV  Y+  ALQLSKRIRHRGPDWSGN  KNSTI VHERLAIVGLESG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PI SP  +Y LCVNGEIYNHIQLREEC DY F++LSDCEPIIP+YLK+ ++APK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYD+K+DRIVAARDPIGITTLYMG+SS SPKT +FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDSK+D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVP+          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IASIAARET  A  +++P  YDS+ +HLAG+D  GNLHT GW+ LHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDR+FL LCM +DP EKMI+ +EGRIEKYILRKAFDTT EP+ KPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID LKD AE  ISDEM A+P+ EWG D PTTKEA+WYRLKFD  FP K+ 
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572
           A+TVMRW+PKADWGC  DPSGR+A+IHE+HI+
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHID 571

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/571 (75%), Positives = 488/571 (85%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60
           MCGIFA Y+ + +  +K  ALQLSKRIRHRGPDWSGN  KN TIFVHERLAIVGL++GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120
           PI S D +Y+LCVNGEIYNHI LR+ C DY F TLSDCEPIIP++ K+ +E P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180
           AW LYDAK DRIVAARDPIG+TTLYMG+ S SP+T YFASELKCL ++CD I +FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFXXXXXXXXXX 240
           YDS TD+ITRYF P WL +   P+ P+DY  +R  LEKAVRKRLM EVP+          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300
             IA+IAARET  A  +++   YDS+ R+L GVDD+ +LH +GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFIGS HHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480
           VPFLDR+FL+LCMNIDP+EKMI+ KEG+IEKYILRKAFDT+ EPD +PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540
           QFSDGVGYSWID+LKD AE  ISDE FA PK EWG DIP+TKEA+WYR+KFDALFPQ T 
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571
           A TVMRWVPKA+WGC+EDPSGR+A+IHEKHI
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 117/470 (24%), Positives = 181/470 (38%), Gaps = 84/470 (17%)

Query: 27  IRHRGPD---WSGNATKNSTIFVHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYN 79
           I  RGP+   W G+A  ++  F     +++ L    QP T      D  Y+L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSAEYSTAWFS----SVLSLR---QPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  HIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPI 139
             ++      Y    L+  E  IP     DI A   LDG FA+T+YD +  +    RD I
Sbjct: 100 D-EIEFNDTQYIADMLARGEASIP-----DIIA--RLDGEFAYTIYDTEDQKYYFGRDAI 151

Query: 140 GITTL--YMGRSSASPKTVYFASELKCLTDDC---DTITAFPPGHVYDSK------TDKI 188
           G  +L  Y+  S    K   + S +    +D    D I      ++YD+K      ++ I
Sbjct: 152 GKRSLSYYVNTS----KDQLYVSSVTGRVEDIEFRDCIAGII--YIYDAKNQHLDDSNHI 205

Query: 189 TRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRL-------MAEVPFXXXXXXXXXXX 241
           +  +T   L ++           +   L  AV KR+       +   P            
Sbjct: 206 SDPYTVSPLVDENFTERGEHIEKLHFQLNLAVEKRINSIHPNHIENSPISVLFSGGLDCS 265

Query: 242 XIASI-------AARETANATN--------DVEPSTYDSKARHLAGVDDDGNLHTAGWTS 286
            I ++        AR+T    N         + PS  DS  R LA        H      
Sbjct: 266 VIVALICNQLSGKARKTVELLNVGFENPRTGLVPS--DSPDRKLAIESYKTLQHLYPDID 323

Query: 287 LHSFAIGLPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRAS 346
           +    I +P    L+A  KV   +        F  Q  +D    + ++  +    +I   
Sbjct: 324 IRLIEIDVPYEEYLRAKPKVIDLM--------FPKQTEMDLSIAIAFYFASKGEGSITDK 375

Query: 347 TPMFLLSRKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADC 405
           +       KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  + 
Sbjct: 376 ST----KGKIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNL 430

Query: 406 LRANKSTMAWGLEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILR 455
            R +K   + G+E R PFLD   ++      P          +I K ILR
Sbjct: 431 NRDDKVIASNGVEIRYPFLDSSVVKFSTEDLPINY-------KINKLILR 473

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRK 456
           A G+E R PFLDR  ++  M   P          +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIP-------INWKINKLILRK 471

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 74/170 (43%), Gaps = 29/170 (17%)

Query: 69  YMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHD----IEAPKYLDGMFAWTL 124
           Y+L  NGE+YN             + L +    +   L++D     E   +L+G FA+T+
Sbjct: 88  YILQFNGELYNE------------EILDNDTSFVASLLENDKMSVFEVISFLEGEFAYTI 135

Query: 125 YDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPG--HVYD 182
           YD  + ++   RD IG  +L   R   +   +Y AS    +T   +  T    G  ++YD
Sbjct: 136 YDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVAS----VTGQQEGFTDCLAGIVYIYD 190

Query: 183 SKTDKITRYFTPDWLDEKRIPSTPI----DYMAIRHSLEKAVRKRLMAEV 228
            +   + +   P  +  + + S  I    ++  I H+L + ++  ++  V
Sbjct: 191 VEDKSLNQQMLP--ILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRK 456
           FLD E +Q  ++  P          ++ K ILRK
Sbjct: 450 FLDEEVIQYSVSQIPISY-------KVNKGILRK 476

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 94/218 (43%), Gaps = 36/218 (16%)

Query: 27  IRHRGPDWSGNATKNSTIFVHERLAIV---GLESGAQPITSP----DEDYMLCVNGEIYN 79
           I  RGP++S       ++ V+    I     + S  QP T      DE Y+L  NGE+YN
Sbjct: 50  IVSRGPNYS-------SLRVNREHGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYN 102

Query: 80  HIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPI 139
             ++      Y    L  C+  +       +   + LDG FA+T+YD K+  I   RD I
Sbjct: 103 S-EISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLKEGNIYFGRDTI 154

Query: 140 GITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHVYDSKT-----DKITR--YF 192
           G  +L       S + ++ +S         D +      + YD+KT      K+ R  Y 
Sbjct: 155 GKRSLCYSIDENSGE-LFISSVTGTRGTFVDCLGGVI--YTYDTKTHTLDDTKVIRDKYV 211

Query: 193 TPDWLDEKRIPSTPIDYMAIRH-SLEKAVRKRLMAEVP 229
             D  DE    S    YM + + +L ++V+KR+++  P
Sbjct: 212 VTDMTDELENES---QYMELLYGTLYESVKKRVLSIHP 246

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILR 455
           +E R PFLD    +  +N   KE  I  K   I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINYK---INKKILR 477

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 25/128 (19%)

Query: 27  IRHRGPDWSGNATKNSTIFVHERLA-IVGLESGAQPITSP----DEDYMLCVNGEIYNHI 81
           I  RGP++     +   +F  E+++    + S  +P T      ++ Y+L  NGE+YN+ 
Sbjct: 47  IARRGPNY-----QMFRVFKSEQISWYSSILSLRKPFTKQSIEVNDRYILQFNGELYNN- 100

Query: 82  QLREECPDYQFKTLSDCEPII-----PMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAAR 136
                    +   +SD    +      +  K  I   + L+G FA+T++D+K+  +   R
Sbjct: 101 ---------EIHGISDTTYFVNCLKTALDEKDIINILRTLEGEFAYTIFDSKKKLVYFGR 151

Query: 137 DPIGITTL 144
           D IG  +L
Sbjct: 152 DTIGKRSL 159

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKA 457
           FLD   +Q      P          ++ K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINY-------KVNKLILRKV 474

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 74/169 (43%), Gaps = 38/169 (22%)

Query: 1   MCGIFAAYKHEDVHRYKQKALQLSK---------------------RIRHRGPDWSGN-- 37
           MCGI   Y    VH  + + L+ ++                      I +RGP++S    
Sbjct: 1   MCGILLHYNPNIVH--EDRFLEFNEDECISVDESNGTSEIFNAIIPHIANRGPNYSSLRL 58

Query: 38  ATKNSTIFVHERLAIVGLESGAQPITSPDEDYMLCVNGEIYNHIQLREECPDYQF--KTL 95
           + K  T +    LA+  L    Q +   D  Y+L  NGE+YN  +++++  D QF    L
Sbjct: 59  SEKYHTAWFSSVLAL-RLPFTKQSLCVEDR-YVLQFNGELYNK-EIKQDQNDTQFIASLL 115

Query: 96  SDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPIGITTL 144
           S    +I    +        LDG FA+T+YD ++ +I   RD IG  +L
Sbjct: 116 SSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIGKRSL 156

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKA 457
            R PFLD    +  +N+   E  I  K   + K ILRK 
Sbjct: 448 VRYPFLD----EYVINLSTLEIPINYK---VNKLILRKV 479

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQPIT----SPDEDYMLCVNGEIYNHIQ 82
           I  RGP++S        I  H+      + S  +P T    + D+ Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSL----RVIKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREECPDYQFKTLSDCEPIIPMY-LKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPIGI 141
             +E  D+   +L     +  +   ++ ++  + L+G +A+T+YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDREFLQLCMNID---PKEKMIRAKEGR 448
           FLD + ++  + +      +KMI  K  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 6/89 (6%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLDREFLQ----LCMNIDPKEKMIR 443
            R PFLD + +Q    L +N    +K++R
Sbjct: 445 VRYPFLDEKVVQFSTELPINYKVNKKILR 473

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 77/171 (45%), Gaps = 29/171 (16%)

Query: 27  IRHRGPDWSG--NATKNSTIFVHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYNH 80
           I +RGP+++   N++K    +    L++        P+T      ++ ++L  NGE+YN 
Sbjct: 49  IINRGPNYASIRNSSKYGISWFSSILSL------RDPLTRQSVKINDRFVLQYNGELYN- 101

Query: 81  IQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPIG 140
                     Q         +I  Y     +A + ++G FA+T++D + +++   RD IG
Sbjct: 102 -------SSIQHNDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGRDTIG 154

Query: 141 ITTLYMGRSSASPKTVYFASELKCLT---DDCDTITAFPPGHVYDSKTDKI 188
             +L     S + K   F S +   +   +DC+  T +    +YDSKT  +
Sbjct: 155 KRSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNL 199

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 101/220 (45%), Gaps = 35/220 (15%)

Query: 27  IRHRGPDWSG--NATKNSTIFVHERLAIVGLESGAQPITSPD----EDYMLCVNGEIYNH 80
           I+ RGPD+S    ++++ST +    L++       +P TS        ++L  NGE+YN 
Sbjct: 47  IKSRGPDYSSLRVSSEHSTAWYSSVLSL------REPFTSQSVKVGNRFILQFNGELYNQ 100

Query: 81  IQLREECPDYQFKTLSDCEPIIPMYLKHDI-EAPKYLDGMFAWTLYDAKQDRIVAARDPI 139
            ++     D QF      E        HD+ +  + L G FA+TLYD +Q +    RD +
Sbjct: 101 -EITAHDNDTQFIVSKLQEGY------HDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNV 153

Query: 140 GITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHVYDSKTDKI-------TRYF 192
           G  +L    S+ + + +Y +S    +    D I      +VYD+++  +       ++YF
Sbjct: 154 GKRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYF 210

Query: 193 TPDWLDEKRIPSTPIDYMA--IRHSLEKAVRKRLMAEVPF 230
               LDE+    T +D     +   L  AVRKR+++  P 
Sbjct: 211 ITKKLDEEL---TCLDSTVEQLYGMLSLAVRKRVLSIHPL 247

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRK 456
           FLD + ++      P          ++ K ILR+
Sbjct: 449 FLDHDVIKFSTEEIPINY-------KVNKMILRR 475

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDREFLQL 431
            R PFLD   ++ 
Sbjct: 448 VRYPFLDEHVIKF 460

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 26/167 (15%)

Query: 27  IRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQPIT----SPDEDYMLCVNGEIYNHIQ 82
           I  RGP++S      +    ++      + S  QP T    S D+ Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYNK-E 101

Query: 83  LREECPDYQFKTLSDCEPIIPMYLKHD---IEAPKYLDGMFAWTLYDAKQDRIVAARDPI 139
           + ++  D Q+         +   L  D   I+  + L+G +A+T+YD K  +    RDPI
Sbjct: 102 ISDDDNDSQYIAS------LLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRDPI 155

Query: 140 GITTLYMGRSSASPKT-VYFASELKCLTDDCDTITAFPPGHVYDSKT 185
           G  +L     S +P   +Y AS    +    D I     G VY+  T
Sbjct: 156 GRRSL---SYSVTPNNELYVASATGAIEGFQDCIG----GIVYEYDT 195

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 9/105 (8%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMAWGLEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRK 456
               G+E R PFLD E ++      P          ++ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIPINY-------KVNKMILRK 475

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 73/171 (42%), Gaps = 41/171 (23%)

Query: 1   MCGIFAAYK-HEDVHRYKQKALQL------SKR--------------IRHRGPDWSG--N 37
           MCGI   +   +D++  K++ L+       SKR              I  RGP++S    
Sbjct: 1   MCGILLHHAGDDDLYHLKEQFLEFPEGSLSSKRCSDGSPIFNSIIPYISARGPNYSSLRV 60

Query: 38  ATKNSTIFVHERLAIVGLESGAQPITSP----DEDYMLCVNGEIYNHIQLREECPDYQFK 93
           + K  T +    L++       QP T      +E Y+L  NGE+YNH ++      Y   
Sbjct: 61  SKKYKTAWYSSVLSL------RQPFTCQSIEIEERYVLQFNGELYNH-EIVHNDTQYIVG 113

Query: 94  TLSDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPIGITTL 144
            L +  P IP  +K        L+G FA+++YD +       RD +G  +L
Sbjct: 114 LLKESAPSIPAIIKK-------LNGEFAYSIYDIQNGTFYFGRDTVGKRSL 157

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKA 457
           FLD   ++L     P          ++ K ILRK 
Sbjct: 452 FLDEYVIKLSTAEIP-------INFKVNKLILRKV 479

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 10/90 (11%)

Query: 60  QPIT----SPDEDYMLCVNGEIYN-HIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPK 114
           QP T    + D+ Y L  NGE+YN  I   +    Y    L + +  + +     I+  K
Sbjct: 76  QPFTKQSINVDDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIK 130

Query: 115 YLDGMFAWTLYDAKQDRIVAARDPIGITTL 144
            L+G +A+T+YD    ++   RDPIG  +L
Sbjct: 131 SLEGEYAYTIYDVNSSKLYFGRDPIGRRSL 160

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  +++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRK 456
           FLD + ++      P          +I K ILRK
Sbjct: 455 FLDIDVIKFSTEELPINY-------KINKLILRK 481

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 78/166 (46%), Gaps = 15/166 (9%)

Query: 69  YMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAK 128
           Y++  NGE+YN  +++     Y  + L + + II +  K        LDG FA+T+YD +
Sbjct: 91  YVVQFNGELYND-EIQYNDTQYTIQLLKEGKEIIDVIRK--------LDGEFAYTIYDIQ 141

Query: 129 QDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLT--DDCDTITAFP-PGHVYDSKT 185
                  RDPIG   L     + + + +Y +S   C T   DC   T +     + +  T
Sbjct: 142 NRMFYFGRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCIAGTIYKYDCQLKELNT 200

Query: 186 D-KITR-YFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVP 229
           D KI++ ++  + LD++ +     +   +   L  +V KR+++  P
Sbjct: 201 DSKISKPFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 353 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 412
           S+     G+ M  SG G+DE++GGY  F+   S  E   E  +++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 413 MAWGLEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAF 458
              G+E R PFLD   +Q  +++    K+ +     + K ILR  F
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDLPLNYKVNKHILRVMAKDILRLDF 484

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 18/124 (14%)

Query: 27  IRHRGPDWSGNATK---NSTIFVHERLAIVGLES--GAQPITSPDEDYMLCVNGEIYNHI 81
           I  RGP+++   +    N+ +F     +++ L +    Q +   D  Y+L  NGE+YN  
Sbjct: 48  IVRRGPNYASLRSLSEINAMLFS----SVLSLRTPFTKQSVMVQDR-YLLQYNGELYNDD 102

Query: 82  QLREECPDYQFKTLSDCEPIIPMYLKHDIE-APKYLDGMFAWTLYDAKQDRIVAARDPIG 140
            + E C        SD E I  +  KH +E   +   G FA+ + D ++ ++   RD IG
Sbjct: 103 TV-ENCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRDSIG 155

Query: 141 ITTL 144
             +L
Sbjct: 156 KRSL 159

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 22  QLSKRIRHRGPDWSGNAT-KNSTIFVHERLAIVGLESGAQPITSPDEDYMLCVNGEIYNH 80
            L K I  RGP+++   T K+  I +   +  +      Q +   D  Y+L  NGE+YN 
Sbjct: 43  NLMKLISARGPNFASLRTLKDHRISLFSSVLSLREPFCKQSVLVEDR-YVLQFNGELYND 101

Query: 81  IQLREECPDYQF--KTLSDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDP 138
             +     D QF  K L + E       K  I   K LDG FA+++YD K  R+   RDP
Sbjct: 102 EIIHN---DTQFIVKLLLNTE----QNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDP 154

Query: 139 IGITTL 144
           IG  +L
Sbjct: 155 IGKRSL 160

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 423 FLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRK 456
           FLD   ++   +  P          +I K ILRK
Sbjct: 451 FLDEHVIKYSTHDIPINY-------KINKLILRK 477

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  +++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKA 457
           PFLD   ++      P          ++ K ILRK 
Sbjct: 451 PFLDEYVIKFSTVEIPINY-------KVNKLILRKV 479

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 75/171 (43%), Gaps = 26/171 (15%)

Query: 27  IRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQPIT----SPDEDYMLCVNGEIYNHIQ 82
           I  RGP++S       T+  +       + S  +P T    + D+ Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNK-E 101

Query: 83  LREECPD--YQFKTLSDCEPIIPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPIG 140
           +     D  Y    L D E    +     I+  K L+G +A+T+YD K  +    RDPIG
Sbjct: 102 VSHWGNDSLYIASLLKDLEDDGSV-----IDVIKSLEGEYAYTVYDVKSAKFYFGRDPIG 156

Query: 141 ITTLYMGRSSASPKTVYFAS---ELKCLTDDCDTITAFPPGHVYDSKTDKI 188
             +L    S  +   +Y AS    ++C   DC   T +     YD++T  +
Sbjct: 157 RRSL--SYSVTANNELYVASVTGAVECF-HDCIGGTVYE----YDTQTKSL 200

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 14/89 (15%)

Query: 102 IPMYLKHDIEAPKYLDGMFAWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASE 161
           +P YL+ DI+APK+L+ MFA++    ++              ++ G S    +T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCC--------CKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDTITAFPPGHVYDSK 184
             L C    LT  CD   +F PG V+DS+
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 6/91 (6%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLDREFL----QLCMNIDPKEKMIR 443
           +E R PFLD   +    QL +N    + ++R
Sbjct: 442 VEVRYPFLDDRVIEFSTQLPINYKVNKMILR 472

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  +++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MAWGLEARVPFLDREFLQLCMNI 435
              G+E R PFLD E + L  ++
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL 457

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFLDREFLQLCMNIDP----KEKMI 442
           + G+E R PFL  E ++      P    ++KMI
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 72/169 (42%), Gaps = 38/169 (22%)

Query: 1   MCGIFAAYK--------------HEDVHR--YKQKALQLSKRIRHRGPDW-SGNATKN-S 42
           MCGI   Y                ++V R  Y      + K +R RGP++ S    K+ +
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 43  TIFVHERLAIVGLESGAQPITSPD----EDYMLCVNGEIYNHIQLREECPDYQFKT--LS 96
           +I++   L++       QP T         Y+L  NGE+YN  ++ E   D QF +  L 
Sbjct: 61  SIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGELYND-EIIESGNDTQFLSGLLK 113

Query: 97  DCEPIIPMYLKHDI-EAPKYLDGMFAWTLYDAKQDRIVAARDPIGITTL 144
            C        + DI      LDG FA+T+ D + + I   RD IG  +L
Sbjct: 114 KCIS------EDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKA 457
           FLD + +     +    K        + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLPINYK--------VNKMILRKV 474

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 55/124 (44%), Gaps = 21/124 (16%)

Query: 27  IRHRGPDWSGNATK---NSTIFVHERLAIVGL-ESGAQPITSPDEDYMLCVNGEIYNHIQ 82
           I  RGP+++   T    N T F     +++ L E   +     ++ ++L  NGEIYN   
Sbjct: 49  IVDRGPNYASLKTSKDDNMTWFT----SVLSLREPFTKQCIEVEDRFVLQYNGEIYN--- 101

Query: 83  LREECPDYQFKTLSDCEPIIPMYLK-HDI-EAPKYLDGMFAWTLYDAKQDRIVAARDPIG 140
                      + +D + I  M L   DI    + L G FA+T+YD     +   RDPIG
Sbjct: 102 --------SSISHNDTQYIAEMLLNAKDIPSVIRTLSGEFAYTIYDKLTGEVFFGRDPIG 153

Query: 141 ITTL 144
             +L
Sbjct: 154 RRSL 157

>YDL148C Chr4 complement(188154..190586) [2433 bp, 810 aa] {ON}
           NOP14Nucleolar protein, forms a complex with Noc4p that
           mediates maturation and nuclear export of 40S ribosomal
           subunits; also present in the small subunit processome
           complex, which is required for processing of pre-18S
           rRNA
          Length = 810

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 475 LWRQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPK 511
            ++Q+ Q + G+    ID+L DN E V+S+ M   PK
Sbjct: 220 FYKQERQKAQGIMEDQIDNLDDNFEDVMSELMMTQPK 256

>Smik_4.239 Chr4 (434533..435918) [1386 bp, 461 aa] {ON} YDR004W
           (REAL)
          Length = 461

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 40  KNSTIFVHERLAIVGLESGAQPITSPDEDYMLC------VNGEIYNHIQLREECPDYQFK 93
           KNSTI   +  ++ G  +    I S DEDYML       VN   Y +   ++  P  + K
Sbjct: 304 KNSTILYRQMNSLFGANANNDEILSDDEDYMLIERVVNGVNDRSYEYSLRKKNSPISKNK 363

Query: 94  TL 95
           TL
Sbjct: 364 TL 365

>YDR004W Chr4 (455201..456583) [1383 bp, 460 aa] {ON}  RAD57Protein
           that stimulates strand exchange by stabilizing the
           binding of Rad51p to single-stranded DNA; involved in
           the recombinational repair of double-strand breaks in
           DNA during vegetative growth and meiosis; forms
           heterodimer with Rad55p
          Length = 460

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 40  KNSTIFVHERLAIVGLESGAQPITSPDEDYML 71
           KNSTI   +  +++G  S    I S DEDYML
Sbjct: 304 KNSTILYRQMNSLLGASSNNDEILSDDEDYML 335

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 426 REFLQLCMNIDPKEKMIRAKEGRIEKYI-LRKAFDTTGEPDAKPYLPEEILWRQKEQFSD 484
           +EF+ LC++ DPKE++  A+E +  K+I  ++A  TT     K  +   +L+R K    +
Sbjct: 273 KEFIALCLDEDPKERL-SAEELQKTKFIKSQRAVPTT---ILKELISRYLLFRDKHTPRE 328

Query: 485 GVGYSWIDSLKDNAEAVIS 503
              +S+ D L +N E+ ++
Sbjct: 329 ---HSYADDLGNNKESEVN 344

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,827,957
Number of extensions: 2580196
Number of successful extensions: 5487
Number of sequences better than 10.0: 52
Number of HSP's gapped: 5552
Number of HSP's successfully gapped: 69
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)