Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.4123.455ON1208120862460.0
Smik_16.3713.455ON1208120551080.0
YPR122W (AXL1)3.455ON1208120850080.0
Suva_16.4513.455ON1218121848570.0
NCAS0A116303.455ON1201119630730.0
NDAI0A046503.455ON1199120829980.0
KAFR0A053703.455ON1201121529210.0
Kpol_1050.883.455ON1213122028140.0
ZYRO0C06336g3.455ON1189120526370.0
TDEL0F034003.455ON1170121026270.0
KNAG0A077403.455ON1197118425630.0
SAKL0F06886g3.455ON1183121125300.0
TBLA0C054503.455ON1202118025190.0
Ecym_44043.455ON1196115624430.0
AGR251C3.455ON1193120423460.0
Kwal_55.204643.455ON1189120722960.0
KLTH0E05104g3.455ON1185120622640.0
TPHA0D040603.455ON1201116322290.0
KLLA0D15631g3.455ON1170117220060.0
CAGL0D04686g3.455ON1181120715240.0
KLLA0E05105g4.246ON10045113992e-38
TDEL0E012504.246ON9953973892e-37
KAFR0A059704.246ON10114693884e-37
TBLA0I029404.246ON9653913884e-37
NCAS0J014704.246ON9954593875e-37
ZYRO0B12320g4.246ON9943913785e-36
Skud_12.4744.246ON10223883786e-36
YLR389C (STE23)4.246ON10273913777e-36
Kpol_1055.834.246ON10204913705e-35
Kwal_23.42374.246ON100110223697e-35
SAKL0H03124g4.246ON10064023681e-34
NDAI0J022404.246ON9994573634e-34
KNAG0B060804.246ON9963883634e-34
TPHA0B022604.246ON10413883609e-34
Suva_10.5064.246ON10233873581e-33
Smik_12.4764.246ON10253913553e-33
AER053C4.246ON10134403511e-32
KLTH0D14278g4.246ON10014093492e-32
CAGL0H06457g4.246ON10082263482e-32
Ecym_32734.246ON10234653313e-30
TBLA0A080504.246ON9959692688e-23
KNAG0A027608.376ON4671881112e-04
SAKL0H14168g8.376ON4611831084e-04
CAGL0I07535g3.93ON1021971077e-04
NCAS0C029708.376ON4611871050.001
NDAI0G023208.376ON4631921040.001
Kwal_56.226883.93ON1040971050.001
AFR334W3.93ON10292311040.001
TDEL0F050008.376ON4561911020.002
Kwal_23.33458.376ON4581931010.003
TPHA0C024508.376ON4692031000.003
KLTH0F08954g8.376ON4581911000.004
SAKL0C09504g3.93ON1069971000.006
TBLA0H010108.376ON499193960.011
KAFR0H020308.376ON462187950.013
NCAS0C049503.93ON103297960.014
KLTH0C09570g3.93ON104297960.017
Ecym_35853.93ON1032169950.019
TDEL0D053103.93ON1035199930.029
TPHA0P010403.93ON103892920.039
Ecym_41918.376ON462188910.048
ZYRO0B06490g3.93ON102898910.051
Smik_12.2258.376ON462187900.064
YOL098C3.93ON103796890.091
NDAI0G042803.93ON103497890.10
TBLA0A069405.541ON99194880.11
Suva_10.2608.376ON462186870.15
YLR163C (MAS1)8.376ON462191860.19
TBLA0B082403.93ON103297870.19
Skud_15.553.93ON1038109860.21
KLLA0B00957g5.541ON98284860.21
NCAS0F011405.541ON988117860.21
Smik_15.583.93ON1038109850.27
KLLA0F27071g3.93ON1037119840.42
ZYRO0C03806g8.376ON465185830.42
Kpol_1024.23singletonOFF454185820.49
Kpol_YGOB_1024.238.376ON464185820.49
KNAG0K006903.93ON1030179830.49
Suva_15.673.93ON1038104830.51
KNAG0C031705.541ON99482820.66
KAFR0C014303.93ON103597810.81
Kpol_1004.325.541ON98884801.1
Kwal_47.185775.541ON98787801.2
Skud_12.2308.376ON462186791.4
Smik_4.7045.541ON989178772.8
CAGL0K04147g4.182ON21586743.4
CAGL0F03157g5.541ON99093754.4
TDEL0A040405.541ON98785745.2
ADR184W5.541ON990105736.7
Skud_4.7055.541ON989178737.1
YDR430C (CYM1)5.541ON989133737.3
Suva_2.6065.541ON989178737.4
SAKL0H14718g8.359ON908107729.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.412
         (1208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...  2410   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...  1972   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...  1933   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...  1875   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...  1188   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...  1159   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...  1129   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...  1088   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...  1020   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....  1016   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   991   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...   979   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   974   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...   945   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   908   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...   889   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...   876   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   863   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   777   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   591   0.0  
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   158   2e-38
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   154   2e-37
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   154   4e-37
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   154   4e-37
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   153   5e-37
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   150   5e-36
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   150   6e-36
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   149   7e-36
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   147   5e-35
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   146   7e-35
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   146   1e-34
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   144   4e-34
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   144   4e-34
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   143   9e-34
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   142   1e-33
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   141   3e-33
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   139   1e-32
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   139   2e-32
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   138   2e-32
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   132   3e-30
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   107   8e-23
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    47   2e-04
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    46   4e-04
CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa] ...    46   7e-04
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     45   0.001
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    45   0.001
Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL09...    45   0.001
AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic...    45   0.001
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    44   0.002
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    44   0.003
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    43   0.003
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    43   0.004
SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa] ...    43   0.006
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    42   0.011
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    41   0.013
NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]...    42   0.014
KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa] ...    42   0.017
Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} simila...    41   0.019
TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3....    40   0.029
TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3...    40   0.039
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    40   0.048
ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} simil...    40   0.051
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    39   0.064
YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}...    39   0.091
NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON} Anc_...    39   0.10 
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    39   0.11 
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    38   0.15 
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    38   0.19 
TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON} Anc_...    38   0.19 
Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON...    38   0.21 
KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON...    38   0.21 
NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {O...    38   0.21 
Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON...    37   0.27 
KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa...    37   0.42 
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    37   0.42 
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    36   0.49 
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    36   0.49 
KNAG0K00690 Chr11 complement(124385..127477) [3093 bp, 1030 aa] ...    37   0.49 
Suva_15.67 Chr15 complement(105988..109104) [3117 bp, 1038 aa] {...    37   0.51 
KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.5...    36   0.66 
KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3....    36   0.81 
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    35   1.1  
Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430...    35   1.2  
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    35   1.4  
Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {...    34   2.8  
CAGL0K04147g Chr11 (383129..383776) [648 bp, 215 aa] {ON} highly...    33   3.4  
CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {...    33   4.4  
TDEL0A04040 Chr1 complement(719669..722632) [2964 bp, 987 aa] {O...    33   5.2  
ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic ...    33   6.7  
Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {...    33   7.1  
YDR430C Chr4 complement(1325501..1328470) [2970 bp, 989 aa] {ON}...    33   7.3  
Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {...    33   7.4  
SAKL0H14718g Chr8 complement(1277222..1279948) [2727 bp, 908 aa]...    32   9.6  

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 2410 bits (6246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1182/1208 (97%), Positives = 1182/1208 (97%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLI                  HNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
            KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS
Sbjct: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300

Query: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360
            KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG
Sbjct: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360

Query: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420
            SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI
Sbjct: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420

Query: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480
            DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI
Sbjct: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480

Query: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540
            DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE
Sbjct: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540

Query: 541  MYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600
            MYTD        TGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL
Sbjct: 541  MYTDFFYEFEYYTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600

Query: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660
            KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS
Sbjct: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660

Query: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720
            PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK
Sbjct: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720

Query: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780
            TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ
Sbjct: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780

Query: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840
            DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED
Sbjct: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840

Query: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900
            NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY
Sbjct: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960
            LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ
Sbjct: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960

Query: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020
            VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM
Sbjct: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020

Query: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080
            KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT
Sbjct: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080

Query: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140
            SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE
Sbjct: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140

Query: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200
            AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP
Sbjct: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200

Query: 1201 NVFRRDAL 1208
            NVFRRDAL
Sbjct: 1201 NVFRRDAL 1208

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1972 bits (5108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 948/1205 (78%), Positives = 1071/1205 (88%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREV NYEV  +IPLSYSNR HKICKLPNGILALLI                  HNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
             D  GLAHLCEHMIL+AGSK+YPD GLFH LIAKNNGSQNAYTTGEQTTFYFELPN+Q+N
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GEFAFE ILDVFASFFK+PLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAAR+LANSDH
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFSRFSTGNIHSLSSIPQLKKINLK+SLN YF++N+FGENIT+CIRG QSVNIL KLAIS
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
            KFGD+KPK+ V+  +FSI  G FR+S S++ + +  KND+R LE FKIL+TVWE+KY+N+
Sbjct: 241  KFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYRNLEDFKILDTVWEKKYQNT 300

Query: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360
             CF+H P  N+IFINSNK PV+RFLFPVSD+NTRFTK+DIKIYSHLWCELFGDESPGSL 
Sbjct: 301  MCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDESPGSLS 360

Query: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420
             YLVSRGWITKCFAFTSEFAIG+IGL+LELELTNSGW+SIK+ITTTIFS+LLPSFYVKNI
Sbjct: 361  HYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSELLPSFYVKNI 420

Query: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480
            D+L+TFLKEQNLID+ARFLYQSSE++PMEECSNLS+ LQENLE LTPSNVFKGFKSLIEI
Sbjct: 421  DHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKGFKSLIEI 480

Query: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540
            DDPNI+KYE ++AN++WW GQAIKFQNFLKSHM H+NTRLL+LG++KS+++F  IE +SE
Sbjct: 481  DDPNIEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKIFHIIENKSE 540

Query: 541  MYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600
            + TD        TG V L  +++ Y KS YEFNFP SN+FLPDYI+DPLKL+QLFLECSL
Sbjct: 541  IRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQLFLECSL 600

Query: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660
            KSKFATLRPQI SEPT+R PQLVS+NLNYEMW+LKEDPNF S+NKS+VSFE+LGLGIKPS
Sbjct: 601  KSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSFEVLGLGIKPS 660

Query: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720
            PEATIHLEVLAQVLFIITSS+LYPALR+GYTYEIASSSKG+VTLRFTISGF EGV+ I K
Sbjct: 661  PEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGFPEGVFKIVK 720

Query: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780
            TFVDTLK IATD TFLSKDT+RKARI VR KYE ASSDNCVKLASIGLLIVLEE++WTLQ
Sbjct: 721  TFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLIVLEEFIWTLQ 780

Query: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840
            DRI+ALELTE  SFKEFC LFW NPK+LVLL+QG+L+YADEINHYLN NFTQHLKV NE 
Sbjct: 781  DRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNFTQHLKVCNEG 840

Query: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900
            ++ TI LYPSPSTKNLD GTN F+SYNGHQDDPNNSIVYFIQTA+R+DIE++ LTFLTEY
Sbjct: 841  SKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIENLALTFLTEY 900

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960
            LFSLTLVPDLRN+KQIGYIVLGGLRVLT+TVGIH+TVMSG  AHNLE KINEYLSYL+LQ
Sbjct: 901  LFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKINEYLSYLELQ 960

Query: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020
            VL+  TE DFR++LLEPFL LLKQNS  K E S+GPV+LLNEIVANVQNGDNYTLNNRQM
Sbjct: 961  VLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNGDNYTLNNRQM 1020

Query: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080
            KQHRK+RNKI E+R +FQ+EYEM +IPFLQ LTLK+YL FF++KISIYS QRSK+SIMI 
Sbjct: 1021 KQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYSTQRSKISIMIA 1080

Query: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140
            SPMAEE I SR++FLQLEAFLKIKGFAIK+EDLK IV++S+GSP+LL+KNLFT FR+RNE
Sbjct: 1081 SPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVKNLFTHFRKRNE 1140

Query: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200
            AFKLG VVLQEI KII ++FKQ Y S+LGF  H +E QD++ FWK DI+P+IPLQ LPDP
Sbjct: 1141 AFKLGTVVLQEILKIIGMNFKQGYGSVLGFSSHNSEGQDVKNFWKNDIEPVIPLQELPDP 1200

Query: 1201 NVFRR 1205
            N FR+
Sbjct: 1201 NFFRK 1205

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score = 1933 bits (5008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/1208 (77%), Positives = 1052/1208 (87%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREV NYEV  YIPLSYSNRTHK+CKLPNGILAL+I                  HNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            KD  GLAHLCEHMIL+AGSK+YPD GLFHTLIAKNNGSQNA+TTGEQTTFYFELPN+Q+N
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GEF FE ILDVFASFFK PLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAAR+LAN DH
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFSRFSTGNIHSLSSIPQLKKI LK+SLN YF+NN+FGENIT+CIRGPQSVNIL KLA+S
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
            KFGDIKPK++V+  + SIR  SFRRS+S+K   D SKND+  L++FKIL T WE+KYKN+
Sbjct: 241  KFGDIKPKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILNTTWEKKYKNT 300

Query: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360
             CF+  P  N+IFINSNK P++R LFPVSDKNTRFTK+DIKIYSHLWCELFGDESPGSL 
Sbjct: 301  MCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLS 360

Query: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420
             YL S+GW+T CFAFTSEFAIG+IGL+LELELTNSGWE+IK ITT + ++LLPSFYV NI
Sbjct: 361  YYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNRLLPSFYVMNI 420

Query: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480
            DYLITFLKEQNLID+  FLYQSSED+PMEECS LS ILQ++LE LTP N+FKGFKSLIEI
Sbjct: 421  DYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEI 480

Query: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540
            DDPNI+KYEN++AN+QWW GQAIKFQNFLKS MNH+N RLL+LGN+KS  +FDK++ +S+
Sbjct: 481  DDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSD 540

Query: 541  MYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600
            + TD        T  V L  D++ ++ S YEFNFPT N+FLPD ++DPLKLQQLFLECSL
Sbjct: 541  ICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSL 600

Query: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660
            KSKFATLRPQI SEPT+  PQLVS+N NYEMW+LKEDPNF SDNKS+VSFE+LGLGIKPS
Sbjct: 601  KSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPS 660

Query: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720
            PEATIHLEVLAQ LFIITSS+LYPALR+GYTYEIASSSKGNVTLRFTISGF EGV+TI K
Sbjct: 661  PEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVK 720

Query: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780
            TFVDTLK IATD TFLSKDT+RKARILVR KY+ ASSDNCVKLAS+GLLIVLE+Y+WTL+
Sbjct: 721  TFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLE 780

Query: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840
            DRI+ALELTE  SF++FC+LFW NPK LVL +QG+LEYAD IN YLNNNFTQHLK+SNE 
Sbjct: 781  DRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKISNEG 840

Query: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900
            ++PTI LYP PSTK+LD+GTN F+SYNGHQDDPNNSIVYFIQTA+R+DI+++TLTFLTEY
Sbjct: 841  SKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEY 900

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960
            LFSLTLVPDLRNKKQIGYIVLGGLRVLT+TVGIHITVMSG   HNLE +INEYLSYLQLQ
Sbjct: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQ 960

Query: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020
            VLN FTE DFRRILLEPFL LLKQNS  + E S+GPV+LLNEIVANVQNGDNYTLNN+QM
Sbjct: 961  VLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQM 1020

Query: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080
            +QHRK+RNKI E R +FQ+++EM DI FLQ LTLK+YL FFESKISIYS QRSKLSIMIT
Sbjct: 1021 RQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMIT 1080

Query: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140
            SPMAE++I SRKMFLQLEAFLKI GFAIK+EDLK IV++SKG+P+LL+KNLFT FRRRNE
Sbjct: 1081 SPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNE 1140

Query: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200
             FKLG VVLQEI KII ++ KQRY SILGF     E Q+IEKFW  D  PI+PLQ LP+P
Sbjct: 1141 VFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEP 1200

Query: 1201 NVFRRDAL 1208
            N FR+ A 
Sbjct: 1201 NFFRKAAF 1208

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score = 1875 bits (4857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 915/1218 (75%), Positives = 1041/1218 (85%), Gaps = 10/1218 (0%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MSLREV NYE+P YIPLSY NRTHKICKLPNGILAL+I                  HNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            +D  GLAHLCEHMILAAGSK+YPD GLFHTLIAKNNGSQNA+TTGEQTTFYFELPN+QSN
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GE AFE  LDVFASFFK PLFNPLLI KEIYAIQSEHEGN+SSTTKIFYHAAR+LAN+DH
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFS FSTGNIHSLSS+P L+KIN+KNSLN YFKNN++GEN+T+C+RG QSVNIL KLAIS
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRR----------SRSVKSTGDFSKNDHRKLESFKILE 290
            KFGDI  KN ++G+NFSI+AGSFRR          S++   T + S      LE+ KI +
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 291  TVWEEKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCEL 350
            TVWEEKY +  CFE+P   N+IFINS+K+P++RFLFPVSDKNTRFTKEDIK+YSHLW EL
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 351  FGDESPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSK 410
            FGDESPGSL  YLVS+GW T  FAF SEFAIGNIGL+LELELT +GW S++ I TTIFSK
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 411  LLPSFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNV 470
            LLPSF  KNID+LI FL+EQNLIDIARFLYQ+SED+PMEECS+LS ILQENLE LTP N+
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 471  FKGFKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYE 530
            FKGFKSLIEI+DPNI+KYEN++ N+QWW GQAIKFQNFLKS MNHENTR+L+LG++KS+ 
Sbjct: 481  FKGFKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKSHN 540

Query: 531  VFDKIEKRSEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLK 590
            +FDKIE  SE++T+         G+V L+ D + +++S YEFNFPT N FLPD++NDPLK
Sbjct: 541  LFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDPLK 600

Query: 591  LQQLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSF 650
            LQQL+LECSLKSKFATLRPQIQSEP + LPQLVSKNLNYEMWVLKEDPNF SDN S+VSF
Sbjct: 601  LQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVVSF 660

Query: 651  EILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISG 710
            E++GLGIKPSPEATIHLEVLAQ+LFI TSS LYPALR GYTYEIASSSKGNVTLRFTISG
Sbjct: 661  EVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTISG 720

Query: 711  FSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLI 770
            FSEGV+ I K FVDTLK I TD TF SKD +RKARILVR KYE ASSDN VKLASIGLLI
Sbjct: 721  FSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGLLI 780

Query: 771  VLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNF 830
            VLEEYMWTLQDRIDALELT+  S K FC LFW NPK+L LLIQGNL+YADEINHYLNNNF
Sbjct: 781  VLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNNNF 840

Query: 831  TQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIE 890
            TQHLKV +E NRPTI LYPSP+TKN+D GTN F+S NGHQDDPNNS+ YFIQTA+R++IE
Sbjct: 841  TQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDNIE 900

Query: 891  SMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKI 950
            ++TLTFLTEY+FS TLVPDLRNKKQIGYIVL GLR+LT+T+GIHITVMSG  AH+LE KI
Sbjct: 901  NLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLETKI 960

Query: 951  NEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNG 1010
            NEYLSYL+ QVLN FTES FR +LLEPFLALLK+N+FNKL++ SGP NLLNEIVANVQNG
Sbjct: 961  NEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIVANVQNG 1020

Query: 1011 DNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSR 1070
            D+Y LNNRQMK HR+IRN I E+R  FQ+E EM DI FLQ LTLK+YLEFF S+ISIYSR
Sbjct: 1021 DDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISIYSR 1080

Query: 1071 QRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKN 1130
            QRSKLSIMITSPMAEE+I SRKMFLQLEAFLKIKGFAIKS DL+ IV++SKGSPVLL+KN
Sbjct: 1081 QRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLLLKN 1140

Query: 1131 LFTSFRRRNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKP 1190
            LFT FR+R+EAFKLG VVL+EISKII ++FKQ Y S+LGF    +E Q I+K+WK+D++P
Sbjct: 1141 LFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSDVEP 1200

Query: 1191 IIPLQGLPDPNVFRRDAL 1208
            I+PL+ LP P+VFR+ A 
Sbjct: 1201 IVPLRELPGPDVFRKYAF 1218

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1188 bits (3073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/1196 (52%), Positives = 821/1196 (68%), Gaps = 14/1196 (1%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS +E+ +++VP+Y+PL+YSNR HK+C LPNG+L LLI                  HNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            KD  GLAHLCEHMILAAGSK YPD GL+H  ++KNNG  NA+TTGEQTTFYFE+PN    
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GE  F+ ILD+FASFFK PLFNPLL +KEIYAIQSEH+GN+SS TKI YHA R+L++  H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFS+FSTGN+++L+SIP+L+ +NL+ +L  YFK NY+   +T+C+RGPQSVNIL K A+S
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  KFGDIKPKNSVEGNNF-SIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKN 299
            KFGDIK   ++  + F S+ + S +RS    +    +KND   LESF ILE  W +KY +
Sbjct: 241  KFGDIKENTALTRSRFGSMSSISTKRSSKSSTENHSTKND---LESFNILEESWRQKYCD 297

Query: 300  SKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSL 359
              CF     +N IFI S+K P +R LFPV+D  TRFTK +IKI+  LWCELFGDE+ GSL
Sbjct: 298  IPCFPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKGSL 357

Query: 360  GSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKN 419
              YLV + WIT C+A+TS FA+GNIGL++EL LT++GWE+   I   +  KL+ +F  + 
Sbjct: 358  CYYLVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSEQY 417

Query: 420  IDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIE 479
            +  L  F+++QN ID+ RFLYQ  +  PMEECSNLS +LQ +L+    + +FKG   + +
Sbjct: 418  VHELANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGSPPITD 477

Query: 480  IDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRS 539
            + + N+    NSE N +WWI QAIKFQ+F+K  MN  N R+++LG+++      K E ++
Sbjct: 478  MHEGNVGGI-NSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELFKKEIQN 536

Query: 540  EMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECS 599
             + T+           ++L     S + + YEF  P  N F+P        L+QLFLE S
Sbjct: 537  TLTTEPFYEFEYKISTINL---KASQSVNTYEFCIPHKNKFIPSACKGDGVLEQLFLESS 593

Query: 600  LKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKP 659
            LKS+++ L  QI S   +  PQLV +N  YEMW LKED N I D KSIVSFE+L   +K 
Sbjct: 594  LKSQYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLSTDMKG 653

Query: 660  SPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIA 719
            SPE TIHLE+L Q++F + S  LYPA+++GY YEI++SSKG+V LRFTI GFSEG+  + 
Sbjct: 654  SPENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEGILMLI 713

Query: 720  KTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTL 779
            +  + T+  I T   F SK+ +R+AR+LVR  YE A++DNCVKLAS+GLLIVLEE MW+L
Sbjct: 714  EIIIKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLEENMWSL 773

Query: 780  QDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNE 839
            +DRIDALE    +SFKEFC  F N  K L L IQGNL YAD+IN +LN NFT+HL ++ +
Sbjct: 774  EDRIDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNFTKHLDINKD 833

Query: 840  DNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTE 899
             + P   L    ST  L  GTN F  Y G  DDPNNSIVYFIQT  R+D +  TLT  TE
Sbjct: 834  TSLP---LNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLCTLTSFTE 890

Query: 900  YLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQL 959
            Y+ SLTLVP+LRNKKQIGY+V+GGLRVLT+T+G++ITVMSG    +LE+KI+EY+++++ 
Sbjct: 891  YIMSLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDEYIAFIEN 950

Query: 960  QVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQ 1019
             VLN  TE+ F R   + +L LL  N+ NK    SGP NLLNEIV NVQ G +  LN+  
Sbjct: 951  GVLNRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSSDQLNSTS 1010

Query: 1020 MKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMI 1079
            MK HR+ RN+I +++++F DE    DIP ++ LTL  YL FF+ KISI+S  RSKLSIMI
Sbjct: 1011 MKLHRRFRNQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSPTRSKLSIMI 1070

Query: 1080 TSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRN 1139
            TS MA +DI++RK +LQLEAFLKIKGF IK E L+ IVD++ G+  LLIKNLF  FR RN
Sbjct: 1071 TSSMAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKNLFNYFRSRN 1130

Query: 1140 EAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQ 1195
            E +KL  VVL+E+ K+ I S KQ Y+  L     K E +D    W   +   + L+
Sbjct: 1131 EGWKLCTVVLKEVVKMSITSLKQHYNWSLS---TKKEDKDKSVDWNGPVSSTVELK 1183

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score = 1159 bits (2998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1208 (49%), Positives = 796/1208 (65%), Gaps = 19/1208 (1%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS ++V NY+ P YIP  YS+R HK+C+LPNGIL LLI                  HNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
             D  GLAHLCEHM+LAAGSK YP+AGL+H+++ KNNG+QNA+TTGEQTTFYFE+P +Q++
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GE  F+ ++DVF+SFFK PLFNPLL +KEIYAIQSEHEGNISS  KI YHA RL+AN DH
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFS+FSTGNI++LSSIPQLKKINLK +L  YF  N++G  +T+C+RGPQSVN L KL +S
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHR--KLESFKILETVWEEKYK 298
            KFGDI+  N        ++   F    S  S   F   + +   LE + IL++ W+ KY+
Sbjct: 241  KFGDIRANNG-------LKRSKFGSISSRLSISSFQSKERQPTDLEQYNILKSTWKPKYR 293

Query: 299  NSKCFEHPP-GKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPG 357
             + CF H     N IFI SNK   +RFLFPV DK ++F+ + + ++ + WCELFGDE+ G
Sbjct: 294  EAPCFTHDSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKG 353

Query: 358  SLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYV 417
            SL   LV + WIT CFA+TSEF+ G+ GL+L+  LTN+GW+++  I   +    + +F  
Sbjct: 354  SLCYLLVGKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAAFID 413

Query: 418  KNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSL 477
            K  D L  FLKEQN ID+ RFLYQ +E  PMEECSN+S +LQE+LE L  S +FKG  ++
Sbjct: 414  KPTDQLSCFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTI 473

Query: 478  IEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVK-SYEVFDKIE 536
             +    + +  +  E   + W+ QA +FQ FLK  MN  N  L +LGN K ++ +   I 
Sbjct: 474  SDCYSNDNNTVDMIEYEQECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHSLRSIIR 533

Query: 537  KRSEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFL 596
             R  +              +   +       + Y F  P  N F+P    D   LQQLFL
Sbjct: 534  IRYFLLMQCMSLNILNVIYLRFPK----LLSTQYTFQVPPPNAFIPPSCQDVTILQQLFL 589

Query: 597  ECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLG 656
            E SLKS+F+T R Q+ +     +P L+S+N +YEMW L    +   D KSI+SFEI    
Sbjct: 590  ESSLKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIMSFEIFNRS 649

Query: 657  IKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVY 716
            + PSPE +I+LE+L+Q+L  + S  LYP++R+GY+YEI+SS KG++ L+ TI GFSEG+ 
Sbjct: 650  MIPSPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGGFSEGII 709

Query: 717  TIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYM 776
            +I  T V TL  I     F SK+ +R++R+LVR  YE A+SDNCV LAS+GLLI+LE  M
Sbjct: 710  SILDTIVKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGLLIILERNM 769

Query: 777  WTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKV 836
            WTLQDR++ALE  +  SFKEFC  F   P  + LLIQGNL+Y +EIN+YLN N T HL+ 
Sbjct: 770  WTLQDRLEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYLNTNLTHHLEC 829

Query: 837  SNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTF 896
            SN  N        + ST  L+ G+N +  YNGH DDPNNSIVYFIQT  R +  ++TLT+
Sbjct: 830  SNVKNEKQ---SSTLSTILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRTNRRTVTLTY 886

Query: 897  LTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSY 956
             TEY+ SLTLVPDLRNK+QIGY V GGLR LT T+GIHITVMSG    +LE KI+EY++Y
Sbjct: 887  FTEYIMSLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLEIKIDEYIAY 946

Query: 957  LQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLN 1016
            L+  +LN+ TE+ F     + +L LL  + F +LE S GP +LLNE+VANVQ+G+   LN
Sbjct: 947  LEETLLNSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANVQSGNADELN 1006

Query: 1017 NRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLS 1076
            +  MK H+   N+I  +R+ F+ + E+ DI  ++ LT K +L+FF  K+SI S+ RSK+S
Sbjct: 1007 SHFMKSHKHFFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSIKSKVRSKIS 1066

Query: 1077 IMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFR 1136
            +MI SPMAE +IV+RK FLQL+AFLK++GF I SE L+ IV+ + G P  LIK+LF  FR
Sbjct: 1067 VMIESPMAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSALIKDLFKYFR 1126

Query: 1137 RRNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQG 1196
             RNEA +L  V+L+E+ K+   S K RY   +     K + Q     W  D +P IPL+ 
Sbjct: 1127 ERNEALRLCTVILKEVVKVSASSLKHRYTPKVSSSKMKPKRQSSSN-WDQDTEPAIPLKE 1185

Query: 1197 LPDPNVFR 1204
            + D N F+
Sbjct: 1186 IKDLNEFK 1193

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1215 (48%), Positives = 806/1215 (66%), Gaps = 24/1215 (1%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS  EV +++V +  PLSYSNRTHK+C LPNGI  LLI                  HNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
             +  GLAHL EHMILAAGSKQYPD GL+H LI+KNNGSQNA+TTGEQTTFYFELP++   
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GE  F+ +LDVFASFFKNPLFN  +I+KEIYAI++EH  N+S  TKI YH+ RLLAN  H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFS+F+TGNI SL +  QL+ I++K+ L  YF  ++    +T+C+RGP SVN+L KLAI+
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
            KF DIK +N ++ N F    GS    R  +      +  + K+ES  ILE +W ++Y N 
Sbjct: 241  KFSDIKSQNDLQRNKF----GSISSKRDSRQ----PRQGYSKIESSNILENIWSKRYANL 292

Query: 301  KCFEHPPGK-NTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSL 359
             CF +   K N+IFI S K P++RFLFP+S ++T FT+ +I ++S+ WC LFGDES GSL
Sbjct: 293  PCFVNESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDESEGSL 352

Query: 360  GSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKN 419
              +LV +GW T   ++ S FA+G+IGL++EL LTNSG   I DI   +F K++     K+
Sbjct: 353  MHFLVEKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVKILTTKH 412

Query: 420  IDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIE 479
               +  FL EQN+I+  RFLY+  E  PMEECS+LS +LQEN++ L    +FKG  S+ +
Sbjct: 413  TTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSPSITQ 472

Query: 480  IDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILG-NVKSYEVFDKIEKR 538
            +        E+       W   AIKFQNFL + MN+EN RLL LG N K   +  K +KR
Sbjct: 473  LYSGKNQYSESMTDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRLITKEKKR 532

Query: 539  SEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLEC 598
             E  TD            D  +         Y F  P+SN+F+P        LQQ F E 
Sbjct: 533  IEFETDFFYEFDFYRTFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSYTYLQQAFQES 592

Query: 599  SLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVL----KEDPNFISDNKSIVSFEILG 654
            SLKSK A+LRPQ+Q E     P LVS + NYEMW L       P+  S  K+IV+FE++ 
Sbjct: 593  SLKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRS--KTIVTFELIS 650

Query: 655  LGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEG 714
              + PS E+TIHLE+LAQ+LF + SS LYP+L++GY+Y+IASSSKG+V L+FTISGFSEG
Sbjct: 651  TNMIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTISGFSEG 710

Query: 715  VYTIAKTFVDTLKKIATDA--TFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVL 772
            +  + +  + ++  IA D    +++ + +RKAR+LVRRKY+ A  +NC KL S+GLLI+L
Sbjct: 711  LLLVLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSVGLLILL 770

Query: 773  EEYMWTLQDRIDALELTETSSFKEFCYLF-WNNPKRLVLLIQGNLEYADEINHYLNNNFT 831
            E ++WTL+DRIDALE T+ +SFK F   F + +     L IQGNL+ A EI+HYLN+N T
Sbjct: 771  ESFLWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHEIHHYLNDNLT 830

Query: 832  QHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIES 891
             HL     D  P   +   P TK L  G+N FV+Y+GH++DPNN+IVYFIQ+  R+D  +
Sbjct: 831  HHL-----DILPEKVILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRSDSIA 885

Query: 892  MTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKIN 951
             TLT  TEYL S+TL+PDLR+KKQIGYIV+GG+RVL +++G+HITV+SG P  +LE+KI+
Sbjct: 886  YTLTAFTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLEDKID 945

Query: 952  EYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGD 1011
            EY+++L+  +L   TE +FR   ++ +L +L   +   L  ++G  NLLN+IV+NV NG+
Sbjct: 946  EYMNFLERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVSNVANGE 1005

Query: 1012 NYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQ 1071
               LN+ +M++H+++ N+I +   SF D+ E+ +   ++ LTLK Y++FF+ KISI+S +
Sbjct: 1006 YEILNSSEMREHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKISIHSNK 1065

Query: 1072 RSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNL 1131
            RSKLS+M+TSPM E +I++RK+FLQLEAFLKIKGFAIKS  LK IVD + G P +++K L
Sbjct: 1066 RSKLSVMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVVLKLL 1125

Query: 1132 FTSFRRRNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPI 1191
             + FR RNEA+KL   VL+E+ K    + K RY  +L  P   +    +EK     +KP+
Sbjct: 1126 LSEFRERNEAWKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSNYSVKPV 1185

Query: 1192 IPLQGLPDPNVFRRD 1206
            IPL+ + D N+F+ +
Sbjct: 1186 IPLKRIEDLNIFKSE 1200

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score = 1088 bits (2814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1220 (46%), Positives = 787/1220 (64%), Gaps = 24/1220 (1%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS  EV NY++P Y P+SY  RT+K+C+LPNG+L LLI                  HNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            K+  GLAHLCEHMILAAGSK+YP+ GL+H LIAKN G QNAYTTGEQTTFYFELPN    
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
                FE I+DVFASFFK+PLFN  L SKEIYAI+SEH GN S+ TKIFYHA RLLANS+H
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFS FSTGNI++LSS PQL+KINLK+ L++YFK N+  EN+T+CI+GPQSVNIL K+AI 
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRS---------------RSVKSTGDFSKNDHRKLES 285
             F DIK  NS++      R G+ R+S                S KS        +  L S
Sbjct: 241  YFSDIKGLNSIKKPK---RFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLS 297

Query: 286  FKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSH 345
             KILE VW  KY N  CF+  P  NTI + SNK PV+R +FPV     +F+KE++  + +
Sbjct: 298  TKILENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCN 357

Query: 346  LWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITT 405
            LWCE  GDES  S+ + L++  +IT   AFTS+FA+ NIGL+LE  LT+ G  ++  I  
Sbjct: 358  LWCETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIIN 417

Query: 406  TIFSKLLPSFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYL 465
            +I    +P    +  + L  FL E + ID+  FL++ SE  PMEECS+LS ++Q +L+ L
Sbjct: 418  SIMESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDIL 477

Query: 466  TPSNVFKGFKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGN 525
             P  +FK    ++    P I  +  S  + QWW+ +A  +Q FL+ +MN +  R+ +L +
Sbjct: 478  KPECLFKQSPMIVGNKYPTIGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCD 537

Query: 526  VKSYEVFDKIEKRSEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYI 585
                + F K     ++ TD           V   +  E     +    FP  N ++P+  
Sbjct: 538  FSEKQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEKVPEDQVDIFSNLKFPAKNEYIPELG 597

Query: 586  NDPLKLQQLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNK 645
               L L+++  + S +S+   L     S+ T+ +P+L  K   YEMWV+++     ++ K
Sbjct: 598  RSLLYLREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPSTEKK 657

Query: 646  SIVSFEILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLR 705
            +IV+F++L L + P+P+ T+HLE+L Q+L+++ S  LYP+L++GYTYEIASSSKG+V L 
Sbjct: 658  TIVTFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDVRLS 717

Query: 706  FTISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLAS 765
            FT+SG+S+G+  + KT + T   IA D    SK  +R+ARIL RRKYE A+++NC KLAS
Sbjct: 718  FTLSGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCAKLAS 777

Query: 766  IGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHY 825
            +GL+I+LE+Y+W L+DR++ALE ++  SFKEFC  F  + K L L++QGNL+ A+EIN Y
Sbjct: 778  VGLIIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANEINKY 837

Query: 826  LNNNFTQHL-KVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTA 884
            LN++FT HL + S ++ +   C   S +TK L+ GTN    + GH DDPNN IVYFIQT 
Sbjct: 838  LNDSFTNHLGEKSGKNTKSVDC---SKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQTG 894

Query: 885  KRNDIESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAH 944
            KR+D +++ LT  TEYL SLTLVPDLRNKKQIGY+V GG+RVL++TVGIHITVMSG    
Sbjct: 895  KRDDKKALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNPL 954

Query: 945  NLENKINEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIV 1004
            +LE KI+EYL +L+ +VL   +E  F +  ++ +L+ +  +S   + S++GP N+L+ I 
Sbjct: 955  DLEEKIDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGIA 1014

Query: 1005 ANVQNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESK 1064
            ANVQ GD   LN+ QM  HR+I+N+I  +R++F ++    D+ F++ LTLK+YL+FFE  
Sbjct: 1015 ANVQAGDFSVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEEN 1074

Query: 1065 ISIYSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSP 1124
            ISI S  RSKLS+ ITSPMA ++I++RK FLQLE FLK+ GF I ++ LKS+V  S+G P
Sbjct: 1075 ISISSVNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGRP 1134

Query: 1125 VLLIKNLFTSFRRRNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFW 1184
              L K LF  F  R E +K   +V  E+ KII +S K  +  I  FP  K       + W
Sbjct: 1135 GKLFKLLFNYFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGI--FPSSKQSDSSNIQTW 1192

Query: 1185 KTDIKPIIPLQGLPDPNVFR 1204
             + +KP I L  + D ++F+
Sbjct: 1193 SSSVKPAITLTKVNDVHIFK 1212

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score = 1020 bits (2637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1205 (45%), Positives = 787/1205 (65%), Gaps = 19/1205 (1%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            M  +++  Y++P   P S+  RTHK+CKLPNG+L LLI                  HNDP
Sbjct: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
             +  GLAHLCEHM+LAAGS++YPD G +H +I KN GSQNA+TTGEQT+FYFELPN   +
Sbjct: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
             +  F+  LDVFASFF  PLFN  LI+KE YAI+SEH+ N+SS  KIFY A RLLAN +H
Sbjct: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFSRFSTGNI +L+SIP LK +NLKN L+ YFK N+    +T+C+RGPQS++ LAKLA++
Sbjct: 181  PFSRFSTGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
            KF  I  KN+ +    S      +  RS     + +  +        I +  W  KY+  
Sbjct: 241  KFSLI--KNNPQRYRPSPPVSPSKSKRSSNEWVEVNPKE------MNISKNTWLPKYRGQ 292

Query: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360
             CF     +  IFI S+K+P +RF+FP  ++NTRFT +DIKI +HLW ELFGDESPGS  
Sbjct: 293  LCFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFS 352

Query: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420
             +L S+GW+T  +AF SE AIGN  L+LEL+LT +G++++  I   +F + +P+   KN 
Sbjct: 353  HWLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNT 412

Query: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480
              L  F+ +QN ID+ RFLYQ++E  PMEEC NLS+++Q++LE L P+ +FKG   +I+ 
Sbjct: 413  LELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDE 472

Query: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540
               NI  Y  ++ + +WWIGQAIKFQ+FLK  M   N R+++ GN +  ++    E  S+
Sbjct: 473  QHHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQL---EELSSQ 529

Query: 541  MYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600
             +            +  +   D     + Y F  P  +  +PD      +L+++  + S 
Sbjct: 530  EFQVDLFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQ 589

Query: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660
            KS+ A L   I +   K +P LVS+N  +EMWV+ +D +     KSIVSFEI GL ++  
Sbjct: 590  KSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEAC 649

Query: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720
            P  T++LE+L Q++FI+ S  +YP+L++G+T EI +S+KG++ L FTISGFS+ + +  K
Sbjct: 650  PRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTSFVK 708

Query: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780
            + ++T+K+I+ D  FLSK+T+R+ARILVR KYE A+++NC  + SIGL IVLE+YMWTL+
Sbjct: 709  SIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLE 768

Query: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840
            DR++ALE  +  +FK+FC  F  + K L L +QG+L  ADE+N YL+ +FT HL     +
Sbjct: 769  DRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYE 828

Query: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900
             +     +   +TK L+ GTN  V + G +DDPNNSI+YFIQT +RND    TLT  T +
Sbjct: 829  TQGKT--FTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVF 886

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960
            + SL L  +LRNK+Q+GY+V+GGLR+L+ +VG+HIT+MSGG   +LE KI+EYL YL+ Q
Sbjct: 887  IMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ 946

Query: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020
             L    E  F +  +  +L LL          SSGP +LL+E+VANVQ GD+  L+++ M
Sbjct: 947  -LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTM 1005

Query: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080
            K+H+K++ +II+ ++ F  E E  D   +  ++L++YL FF+  ISI+S+ RSK+SIMI+
Sbjct: 1006 KRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSKISIMIS 1065

Query: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140
            S +AE+DI+++K+FLQLE FLKIKGFAI +++LK IV+ S G P +L   L++ FR RN+
Sbjct: 1066 SSIAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRND 1125

Query: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200
            A +L +V+L E+ K++  S + RY ++      K + Q+    W TD+KP + L+ + D 
Sbjct: 1126 ALRLCSVILAELFKMLAKSLRHRYGNLAHDDTSKRDLQE----WSTDVKPALDLKVIEDI 1181

Query: 1201 NVFRR 1205
            N F+R
Sbjct: 1182 NFFKR 1186

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1210 (44%), Positives = 757/1210 (62%), Gaps = 42/1210 (3%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS  +V +  VP + PLSYSNRTHK+C+LPNGIL LLI                  +ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
             D  G+AHLCEHM+LA GSK+YP  G +H +I KNNGS NA+TTGEQTTFYFELP+    
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
             E  FE  +D+FASFF  PLF+  LI+KEIYAIQ+EH+ N+S+ TKI YHA RLL +  H
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFSRF+TGN+ SL +  +LK   L+N L+ +F+ NY    +TIC+RGP SVN LAKLAIS
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
            KFG+++P  + E                 K     + ND      F IL+T W      +
Sbjct: 241  KFGELRPHKANE-----------------KVQAALTPND-----GFNILQTRWGHTKAAN 278

Query: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360
             CF     +NTI ++S K P++RFLFPV  K TRFTK+D  I+   W ELFGDES GS  
Sbjct: 279  NCFPSCLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDESAGSFC 338

Query: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420
             +LV +GWIT C+A+ S F+  N GL+LEL LTNSGW +I+ I  T+   L+P F  ++ 
Sbjct: 339  HFLVEKGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVPKFSREHT 398

Query: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480
              L  FL EQ  ID+ RFLY ++E+ PM ECSNL  +LQE++  L  S +F G   ++  
Sbjct: 399  VQLARFLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMG-SPMVLN 457

Query: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSE 540
            +      +  +E + +WWIGQAIKFQ+FLK  MNH N RL++LG ++   +     +   
Sbjct: 458  EQSTQGLFSENEESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLSTTATQGKI 517

Query: 541  MYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSL 600
              TD        T K+ L R   +   + Y+F+ P  N F P +  +   L +     S 
Sbjct: 518  AGTDPFYDFAYFTCKLSL-RKPHANILNDYKFSIPPKNEFKPSWAENFPSLMRKLYYSST 576

Query: 601  KSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPS 660
            KS+ A+L   I+S+   R PQLVS+N NY+MWVL + P     +K+IVSFEI    I+PS
Sbjct: 577  KSQQASLGFAIKSDEGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIVSFEISCWEIQPS 636

Query: 661  PEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAK 720
            PE T++LE+LAQV+ +  +S LYP+L++G+T+EI  SS+G+V L   ISG+S+ +  + +
Sbjct: 637  PENTMNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISGYSKRLGKVIE 696

Query: 721  TFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQ 780
            +    ++++ ++ +F S++  RKARI VR  Y+ A  ++ + +ASIGLL+V+E+YMW+LQ
Sbjct: 697  SLSSIIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLVVMEKYMWSLQ 756

Query: 781  DRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNED 840
            DRIDA+E  +  +FK F   F +  K L L IQG+L +AD+IN  L+ N T HL  +  D
Sbjct: 757  DRIDAIECIDLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDRNLTNHLHGTQTD 816

Query: 841  --NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLT 898
                P  C     STK LD  TN +V Y G +DDP NS VY+IQT  R+D  + TLT L+
Sbjct: 817  FQREPEYC-----STKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCTAYTLTALS 871

Query: 899  EYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQ 958
             Y+ S TL P+LRNK+QIGY+V+GGLR+L   VG+HI++MS      LE KINEYL YL+
Sbjct: 872  AYMMSFTLKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKINEYLLYLE 931

Query: 959  LQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNR 1018
             +VL   TE  FR   L+ FL L  + + +KL   SGP +L+++IVANVQ+GD+  LN+ 
Sbjct: 932  REVLTPMTEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSGDSDILNSS 991

Query: 1019 QMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIM 1078
             MK+H+++RN+I + R++F D     +   LQ LT+  YL FF  +ISI+S+ R+KLS+M
Sbjct: 992  FMKKHKRLRNQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISIHSKTRAKLSVM 1051

Query: 1079 ITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRR 1138
            + SPM +E+IV+R+++ Q++AFLK+ G  I++  L+ +V  SKG P+LL K L+ SF  R
Sbjct: 1052 VKSPMTDEEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAKELYQSFHSR 1111

Query: 1139 NEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLP 1198
            +E +KL  V+L+E+ K++ V+ K R         H+ +       W +   P   L  + 
Sbjct: 1112 HETWKLCTVMLRELLKMLTVNLKFR---------HQRQTNMAASEWGS--TPATGLTLIK 1160

Query: 1199 DPNVFRRDAL 1208
            D N++R++ L
Sbjct: 1161 DINIYRKEVL 1170

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1184 (44%), Positives = 748/1184 (63%), Gaps = 44/1184 (3%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            M+   V NY++   IPL++S+RTHK+CKLPNG+LALLI                  HNDP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            K   GLAHLCEHM+ AAGSK+YPD   +H  ++K  G+ NAYTTGEQTTF+  +PN    
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GE  F+ ILD+F+SF K PLFN   ++KEIYAIQSEH+ N+SS +KI Y A RL+AN +H
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFS+FSTGNIH+L ++P +  +NL+  L  YF+ N+   NIT+CI+G QSVNIL KLA++
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
             FG I+   + +GN   +   S  +  S++S G   K    K+ESF+ILE  W+ KYK+ 
Sbjct: 241  NFGYIQSSRAAKGN---VIRRSISKRDSIRSNGKKLK----KIESFRILEKAWKAKYKDI 293

Query: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360
            KCF+     N + I SNK   +RFLFPV++    FT +++KI+S +W ELFGDES GSL 
Sbjct: 294  KCFDDR--NNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGDESKGSLH 351

Query: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420
            SY + + WIT+   + S+F  G  GL+L+  LT SGWE++++I + +F   L     +N+
Sbjct: 352  SYFIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLELVRWENL 411

Query: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480
            + L   L E   I+   +LYQ  E +  + CS L+ +LQ +L       +FK   +LIE+
Sbjct: 412  NSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFKESPNLIEL 471

Query: 481  DDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGN-VKSYEVFDKIEKRS 539
            ++   D  EN      WW  QA+KFQNF+   M   N +L +LG+ +K    F+   +  
Sbjct: 472  NN---DHSENLMTVTPWWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHNAFFELGSQNK 528

Query: 540  EMYTDXXXXXXXXTGKVDLTR--DDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLE 597
            +  TD           ++  +  D+     + Y    P+ N+F+P +  +   LQQ+F+E
Sbjct: 529  DWSTDAYYGFDYIKSHLNFKQIIDEPCTTVNDYSLALPSKNLFIPQFFQNLANLQQIFME 588

Query: 598  CSLKSKFATLRPQIQSEPTKRLP----QLVSKNLNYEMWVL---KEDPNFISDNK----S 646
             SL+S+FA L+PQ+   PT  LP    +LV+++ +YEMW+L   KE  +  S ++    S
Sbjct: 589  YSLRSRFAVLQPQV---PTSMLPNQKPRLVNRSSHYEMWILPIDKEPESVASPDRIPKQS 645

Query: 647  IVSFEILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRF 706
             V+F I  L + PS   T+HLE+L +VL  + +S LYP+L++ Y YEIA+S KG+V L  
Sbjct: 646  TVTFSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIATSLKGDVQLCC 705

Query: 707  TISGFSEGVYTIAKTFVDTLKKIATDAT--FLSKDTVRKARILVRRKYEGASSDNCVKLA 764
            TI GFS+GV  I    + TL+ I   AT   ++   +RKARI VR KYE ASS+ CVKLA
Sbjct: 706  TICGFSDGVVKITDYILSTLRLIGDPATANIVTNSLLRKARIQVRSKYEAASSEICVKLA 765

Query: 765  SIGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKR--LVLLIQGNLEYADEI 822
            S+GLLIVLE  MWTL+DR++ALE ++ SSF++FC+ F  N     L L +QG++ YADE+
Sbjct: 766  SMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFVQGDMRYADEV 825

Query: 823  NHYLNNNFTQHLKVSNEDNRPTICLYPSP----STKNLDRGTNTFVSYNGHQDDPNNSIV 878
            N  +++  T HL  S        C  P+     ST  L  G N +V Y G  DDPNNSIV
Sbjct: 826  NCLIHSKLTHHLNSSR-------CSTPTTDYRRSTTVLKPGVNYYVEYPGQGDDPNNSIV 878

Query: 879  YFIQTAKRNDIESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVM 938
            +F+Q   RND  + TL   T YL  LTLVPDLR KKQIGY+VLGGLR++T+TVG+HITVM
Sbjct: 879  HFVQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGLHITVM 938

Query: 939  SGGPAHNLENKINEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVN 998
            S G   +LE+KI+EY+ YL+  VLN  TES F  I L+P++ L+ +++  ++++S GP N
Sbjct: 939  SAGQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTSGGPTN 998

Query: 999  LLNEIVANVQNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYL 1058
            LL+EI  NVQNG +  L    MK+H+++ N I  + + F    ++ D   +QGLTL RY+
Sbjct: 999  LLSEIYPNVQNGHSSVLEGIDMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQGLTLHRYM 1058

Query: 1059 EFFESKISIYSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVD 1118
             FF+ K+S  S  RSK+SIMI SPM  E+I++R+MFLQ+E FLK+KGFAIK  +L+ IV+
Sbjct: 1059 TFFKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTELRDIVN 1118

Query: 1119 NSKGSPVLLIKNLFTSFRRRNEAFKLGAVVLQEISKIIIVSFKQ 1162
             S+GSP  L+++L   F+ R E +KL  V+ +E+ K++ +  ++
Sbjct: 1119 KSQGSPTQLLRHLLAHFKTRGENWKLCRVIAKEVGKLLALGVRR 1162

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1211 (44%), Positives = 738/1211 (60%), Gaps = 37/1211 (3%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS   V N++V  Y P+S S+R+H++ +L NG+L LLI                  HNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            K+ LGLAH CEHMIL+AGSK YPD   +H +I+KN GSQNA+TTGEQTTF FELPN  ++
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
             E  F+ +LD+F+S FK PLFN LL++KEIYAI SEH  N SS  KIFYHA RLLAN DH
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFS+FSTG+I +LS I QL K++L+  +  YFKNN++ EN+ +CI+GPQS+N L KL  S
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  KFGDIK------PKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWE 294
            KF DIK      P  +       +++ +F       S   F       LESFKIL   W 
Sbjct: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNF-------SNDGFGLG----LESFKILSRNWL 289

Query: 295  EKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDE 354
            +KY N   F      NT+ ++S K P +R +FP+  + TR TK++I + S  WCELFGDE
Sbjct: 290  QKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDE 349

Query: 355  SPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPS 414
            S GSL  ++    +IT+  AF S FA+ +  L+LEL LTN+GW++++ I    F+K +P 
Sbjct: 350  SEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPI 409

Query: 415  FYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKG- 473
                    L  FL E N I++ +FLYQ      MEECSNLS++L  ++E L PS + KG 
Sbjct: 410  VIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGN 469

Query: 474  -FKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVF 532
                  EID   +  +  SE +  WWIG AIKFQ+F+K  +N EN RL+++G++K   + 
Sbjct: 470  PMNDCNEIDS-ELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLM 528

Query: 533  DKIEKRSEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQ 592
                   ++  +          + D +    +  +  Y F+ P  N+FLP    +   ++
Sbjct: 529  KTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIK 588

Query: 593  QLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEI 652
               L  S +S+ A L    Q+     LP+L+ KN  YEMWV +ED      +KSIV+FEI
Sbjct: 589  NALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEI 648

Query: 653  LGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFS 712
            +   + P P  T+ LE+L ++L  + SS LYP+ ++GYTYEIA+SSKG+V + FT+SGFS
Sbjct: 649  ISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFS 708

Query: 713  EGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVL 772
            EGVY I +  V TL +I      +++D  RK+RI VR KYE A+S N   L +IGLLIVL
Sbjct: 709  EGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVL 768

Query: 773  EEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQ 832
            E+YMW L+ R++ALE T+  SFK+F   F+ N   + L IQG+  Y D+IN +L+ N T 
Sbjct: 769  EKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTG 828

Query: 833  HLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESM 892
            HL       R  + +   P++  L  G+N F+++ G +DDPNNSIVYFIQT  R D  S 
Sbjct: 829  HL----SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSY 884

Query: 893  TLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINE 952
            TLT  T +L SLTLVPDLR +KQ+GYIVLGGLR L+ TVG+HIT+ S  P H LE KI E
Sbjct: 885  TLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGE 944

Query: 953  YLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDN 1012
            YLSYL+  +L+      FR   ++ +L ++      K E    PVNL++ I ANV++G N
Sbjct: 945  YLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSG-N 1003

Query: 1013 YTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQR 1072
                 R MK HR+IR +I  +R++F+DE E  D+  ++ L    Y++FF+ KISIYS  R
Sbjct: 1004 LDRVGRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLR 1063

Query: 1073 SKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLF 1132
            SK+S+M++SPM+  +I +RK+FLQLE+FLK+KGF I  E L+ IV  S G P +L+K LF
Sbjct: 1064 SKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELF 1123

Query: 1133 TSFRRRNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPII 1192
              F  R E+ K+  V+L+EI++ +  S K      LG     N       F + +  P +
Sbjct: 1124 RYFASRGESLKICTVMLKEITRQLSSSLKN-----LGARKSPN-------FERPNGSPTV 1171

Query: 1193 PLQGLPDPNVF 1203
            PL  + DP+ +
Sbjct: 1172 PLTEIVDPDAY 1182

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1180 (45%), Positives = 764/1180 (64%), Gaps = 36/1180 (3%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS      +++  Y+P SYSNR  K+C+LPNGILALLI                  H+DP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
            +D  G+AHLCEHMILAAGSK+YP  GLFH ++A NNGSQNA+TTGEQTTFYFELP S + 
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
             +  F  ILD+F+SFFK PLFN +L +KEIYAI+SEH+GN+S+T+KI YHA RLL+N  H
Sbjct: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PF  FSTGNIH+LS +  LKK NLK  L  YFKNNYF  N+TICI+GPQS+N L KLA++
Sbjct: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRS-------RSVKSTGDFSKNDHRKLESFKILETVW 293
             FGDIK K+  E   F I +   ++S        S+ S   F  N++  LE+FK+L+  W
Sbjct: 241  NFGDIKDKD--ELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLDLENFKLLDNAW 298

Query: 294  EEKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGD 353
             +KY ++ CF      NTIF++S+K P++R LFP+S+K TRFTK DIKIYS++WC +FGD
Sbjct: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358

Query: 354  ESPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFS---K 410
            E+ GS   YL    WIT+C+AF S FAIGN  L+LEL+LTN+G + +++I   +     K
Sbjct: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418

Query: 411  LLPSFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNV 470
            LL   + +N+ Y   FL E N+I I RF+    E  PM+ECS LS +LQEN +   P  +
Sbjct: 419  LLVDNFTENLAY---FLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYL 475

Query: 471  FKGFKSLIEIDDPNIDKYENSEAN-MQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSY 529
            F G + L+  ++    K    + N   +WIGQAIKFQ FLK  MN EN +++ +G++  +
Sbjct: 476  FYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEF 535

Query: 530  E----VFDKIEKRSEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYI 585
            +    +  ++ K++++Y +        + K  +   D       Y F +P  N +LP + 
Sbjct: 536  KNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPRD-------YPFTYPIKNEYLPKFG 588

Query: 586  NDPLKLQQLFLECSLKSKFATL-RPQIQSEPTKRLPQLVSKNLNYEMWV-LKEDPNFISD 643
             +   L+ + L     S+  +   PQ+  E  +   +LVS+N  +++WV  K   + +S+
Sbjct: 589  YNLGLLRNILLNNLESSRTVSFYMPQVSEEEDQN--KLVSQNDMHKLWVNPKNSKDQLSE 646

Query: 644  NKSIVSFEILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVT 703
            +  IVSF+++   I+ SPE+T+HLE++ Q+L  +  + LYPAL VGYT+EI+ S +G+V+
Sbjct: 647  SPCIVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVS 706

Query: 704  LRFTISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKL 763
            L FT+SGFSEG++ I K  ++   ++ T +  ++K   R+ARILVR KYE A+SD+CVKL
Sbjct: 707  LSFTLSGFSEGIFKIIKECINIFGEL-TSSDLITKKEFRRARILVRDKYEDAASDSCVKL 765

Query: 764  ASIGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEIN 823
            AS+GLLI+LE  MWTL++RIDALEL +   F EF   F+ N   L L I+GNLEYAD IN
Sbjct: 766  ASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLIN 824

Query: 824  HYLNNNFTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQT 883
             Y ++    HL     D      L   PSTK L  GTN +    G  DDPNNSIVYFIQT
Sbjct: 825  SYFSDKLVHHL-TKRLDYPKEDTLQSLPSTK-LISGTNIYYELEGSVDDPNNSIVYFIQT 882

Query: 884  AKRNDIESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPA 943
               ++ + ++LT LT ++ S +LVP+LRNKKQIGY+V GGLR L++TVG+HIT+MS G  
Sbjct: 883  GDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKP 942

Query: 944  HNLENKINEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEI 1003
             ++E +I +Y+SYL+  +L    +  F+   L  ++ L+        E +SGP+N++NEI
Sbjct: 943  LDIEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEI 1002

Query: 1004 VANVQNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFES 1063
            +ANV  GD+  LN+ ++K H+K +N++        +E +  DI FL+ L L +YL+FF+ 
Sbjct: 1003 IANVHGGDSAILNSEKIKNHKKNKNELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFFKG 1061

Query: 1064 KISIYSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGS 1123
             IS  S++RSKLSI I SPM E ++ +RK+FLQL+ FLKIKGF IKS +L+ IV+ + G 
Sbjct: 1062 SISTNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGR 1121

Query: 1124 PVLLIKNLFTSFRRRNEAFKLGAVVLQEISKIIIVSFKQR 1163
            P LL K LF  F+ R+E++K  ++VL+EI K+I +S KQ+
Sbjct: 1122 PTLLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQ 1161

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1156 (43%), Positives = 729/1156 (63%), Gaps = 27/1156 (2%)

Query: 9    YEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAH 68
            ++V +Y P+S S R+H+I +L N +LALLI                  HNDP +  GLAH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 69   LCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFI 128
             CEHM+L++GSK+YP+   FH  + +NNGS+NA+TTGEQT+FYFE+P++ S     FE +
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELHVFEQL 129

Query: 129  LDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTG 188
            +D+ A+ FK P+F+ +L++KEIYAI SEH GN S+ +K+ YHA RLLAN +HPFS FSTG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 189  NIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPK 248
            N+ +L+++P++ K+NLK  L  YFK ++  E + +CIRG QS+N L+KLA  KFGDI P 
Sbjct: 190  NVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDI-PG 248

Query: 249  NSVEGNNFS--IRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHP 306
            ++  G+  S  ++  S+R S S+ S+ D S +    L+  +IL+  W  +Y     F   
Sbjct: 249  SAAAGSPTSSPLKLKSWRSSNSITSSVDTS-STLASLDESRILKDTWLPRYSKEPVFTPR 307

Query: 307  PGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSR 366
            P  N++ I S K PVIRF+FPV+  +TRFT ++I  Y+  WC++ GDE  GS   +L   
Sbjct: 308  PKYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCHFLRQN 367

Query: 367  GWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLITF 426
             +I+   AF+S FA+ + GL+L+L LTN GW ++  I    +   + +    ++  +  +
Sbjct: 368  NYISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLSKIGQY 427

Query: 427  LKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEIDDPNID 486
            L E N ID+ +FLYQ  E  PME C+ L   L ++L  + P  + K    + + +DP I 
Sbjct: 428  LSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCNDPRIQ 487

Query: 487  K---YENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSEMYT 543
            K   Y  S+ +  WW GQAIKFQ F+K     EN ++++LG +     +       ++  
Sbjct: 488  KIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYS---NSMQLTA 544

Query: 544  DXXXXXXXXTGKVDLTR----DDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECS 599
            D           +++T     D+E      YEF+ P+ N FL    +    +++  L  S
Sbjct: 545  DTHYEYDYLKAYIEITELEAIDNE------YEFHIPSPNQFLVPVGHKLSYIKKALLAAS 598

Query: 600  LKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKP 659
             +S+ ++L    QS+  +  P L  KN  YE+W  +ED N    +KSIVS E++   +KP
Sbjct: 599  AQSENSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKP 658

Query: 660  SPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIA 719
            +PE T+ LE+L Q+LF I S  LYPA R GYTYE++ SSKG+V L  T+SGF+EG+  I 
Sbjct: 659  APEYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGIL 718

Query: 720  KTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTL 779
               +D+L ++  D+  +SK   R+AR++VR KYE A+S+NC  LAS+GLLIVLE  MWTL
Sbjct: 719  NIILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTL 778

Query: 780  QDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQG-NLEYADEINHYLNNNFTQHLKVSN 838
            +DR++ALE  +  SF +F  LF N    L LL+QG +L  AD++N  ++   T H+  S 
Sbjct: 779  EDRLNALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMS-SL 837

Query: 839  EDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLT 898
            E  +  +     P+T  + RG+N  V  +G  DDPNNSIVYFIQT  R++  + TLT  T
Sbjct: 838  ETGKNILV---EPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFT 894

Query: 899  EYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQ 958
            E+L S+TLVPDLR KKQIGY+VLGGLRVL++TVG+HIT MS  P   LE KI+EYLSYL+
Sbjct: 895  EFLMSMTLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLE 954

Query: 959  LQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNR 1018
              VL       F+   L  FL L++ NS +K+E +SGP NL+++I ANV++G      + 
Sbjct: 955  SMVLMKLNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQN--GSM 1012

Query: 1019 QMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIM 1078
             MK H++IRN+I  RR++F++E E  +   ++ LTL+ Y+ FF  KIS+YS+ R+K+S+M
Sbjct: 1013 AMKSHKRIRNQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSVM 1072

Query: 1079 ITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRR 1138
            +TSPM+++++ S+ MFLQ+E+FLK+KGF I SEDLKSI+  S G P +L+K+LF+ FR R
Sbjct: 1073 VTSPMSKDEVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRVR 1132

Query: 1139 NEAFKLGAVVLQEISK 1154
             E+ KL   +++EI K
Sbjct: 1133 GESIKLLTAIVKEIVK 1148

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1204 (41%), Positives = 740/1204 (61%), Gaps = 35/1204 (2%)

Query: 9    YEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAH 68
            ++V +Y P+S SNR+H+I +L N +L  LI                  HNDP +  GLAH
Sbjct: 10   FDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69

Query: 69   LCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFI 128
             CEHM+L++GSK++P+   FH  ++KNNGSQNA+T+GEQT+FYFELP+SQS+    F+ +
Sbjct: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129

Query: 129  LDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTG 188
            + + A   K P+F+ +LI+KEIYAI SEH GN SS TK+ YHA RLLA+ +HPF +F TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 189  NIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPK 248
            NI +L+++P+L K++LKN L  YF+ ++F EN+ +C+RGPQS+N L+K+A ++F DI   
Sbjct: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIP-- 247

Query: 249  NSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDH---RKLESFKILETVWEEKYKNSKCFEH 305
                    SI      R    +S+  F KN +   R LESF+IL+  W  +Y     F+ 
Sbjct: 248  --------SIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDK 299

Query: 306  PPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVS 365
             P  N+I + S+KSPVIRF+FP++  +TRFT  ++  Y+ +WCEL GDE  GSL  YL S
Sbjct: 300  TPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRS 359

Query: 366  RGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLIT 425
              +IT+  A++S FA+ + GL+L+L LTN GW +++ I   ++  L+P+     +  L  
Sbjct: 360  HSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQ 419

Query: 426  FLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEIDD--- 482
            ++ E N +D+ +FLYQ  E  PM+ C++L   L ++L  +  S + K   +  E ++   
Sbjct: 420  YISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSV 479

Query: 483  PNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNV-KSYEVFDKIEKRSEM 541
             N+  Y  ++ +  WW G+A+KFQ F+   M+ +  R+++LGN+ K Y   +  +  ++ 
Sbjct: 480  ANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKITTDT 539

Query: 542  YTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSLK 601
            Y +          +V L  DD      +Y F  P  N F+    +    ++   L  S++
Sbjct: 540  YFEYEYVKIFIDLEV-LGCDD-----IHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQ 593

Query: 602  SKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPSP 661
            S+ + L    QS+  +  P+L  KN  YE+W+ +ED +    +KSI S E++   ++P+P
Sbjct: 594  SENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAP 653

Query: 662  EATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAKT 721
            E T+HLE+L Q+L+ I    LYPA R GYTYE++ SSKG+V L  TISGF++G+  + K 
Sbjct: 654  EYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKI 713

Query: 722  FVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQD 781
             VD +  ++ D   + KD  RKARILVR KY+ ASS++CV LAS+GLLI+LE  MW L+D
Sbjct: 714  IVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLED 773

Query: 782  RIDALELTETSSFKEFCYLFWNNPKRLVLLIQG-NLEYADEINHYLNNNFTQHLKVSNED 840
            R++ALE     SF+ F   F N    L +LIQG ++  AD IN YL+   T H+  ++++
Sbjct: 774  RLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDN 833

Query: 841  NRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEY 900
                +C    P+T  +  G+N F    G  DDPNNSIVYFIQT +R++    TLT LTE+
Sbjct: 834  ----VCRLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEF 889

Query: 901  LFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQ 960
            + S TLVPDLR KKQIGYIVLGGLRVL++TVG+HIT M+G P   LE KINEYL+YL+  
Sbjct: 890  IMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDM 949

Query: 961  VLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQM 1020
            VL   T   F+   ++  L+LL  NS  KLE +SGP NL+++I ANV +G   T  +  M
Sbjct: 950  VLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNT--SLAM 1007

Query: 1021 KQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMIT 1080
            K H+++R +I  RR++F ++ E  D   LQ L L  Y+ FF  +ISIYS +R+KLSIM+ 
Sbjct: 1008 KSHKRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVY 1067

Query: 1081 SPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNE 1140
            S M++E++  + ++LQ+E+FLK+KGF I S+DL +IV  SKG P  L+K L + FR + E
Sbjct: 1068 SAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGE 1127

Query: 1141 AFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGLPDP 1200
            + KL + VL+E+ K +      +             H  ++      + P I L+ +P+ 
Sbjct: 1128 SLKLLSTVLREVVKQLF----SKATPDSSSSTPSGTHGSLQAM-SQHVTPAITLEQVPEV 1182

Query: 1201 NVFR 1204
            N +R
Sbjct: 1183 NSYR 1186

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1207 (41%), Positives = 701/1207 (58%), Gaps = 34/1207 (2%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS     N+++  Y P+S S+R  K+C+L NG+L  LI                  HNDP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
             + LGLAHLCEH IL+ GSK+YP A  +H ++A+N GS NAYTTGE TTFYFELP    +
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDS 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
            GE  F+  LDV AS  K PLF+ +LI+KEIYAI+SEH  N +   K  YHA+RLLAN  H
Sbjct: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFSRF TGN  +L ++P L K N+K +L ++ K  Y   N+++C+RG QS+N L KLAI 
Sbjct: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240

Query: 241  KFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNS 300
             FGD+       G N          +R   S+   +K   + +  FKIL+  W  KYK+ 
Sbjct: 241  FFGDLP----ASGQNI---------ARPSSSSLFSNKGTAQSMPYFKILKYEWTPKYKDV 287

Query: 301  KCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLG 360
            + F      N + I S+K PV+R +FPVS K+TR +  DI  +S  WC+ FGDES GSL 
Sbjct: 288  RAFSQ-GSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLA 346

Query: 361  SYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNI 420
              L   G I+   +  S FA    GL LEL LT  GW++I  I   +F   +P       
Sbjct: 347  DCLKGCGLISGIVSSVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIPKLIHDKT 406

Query: 421  DYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEI 480
            + +   L E N I++ +FLYQS+E  PM+ C+NLS  L  +LE L P  + KG   LIE 
Sbjct: 407  EDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG-SPLIEC 465

Query: 481  DDPN--IDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKR 538
            +  +  I  Y  +  +  WWIG+AIKFQN +   +N +N R ++LG+         +  R
Sbjct: 466  NQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASV--R 523

Query: 539  SEMYTDXXXXXXXXTGKVD-LTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLE 597
            S   TD           VD L+   + Y    Y F+ P+ + FLP        ++Q    
Sbjct: 524  STTKTDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQV 583

Query: 598  CSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGI 657
             S +++ A+L    +S+  +  P+L  KN NYE+WV +E+ +    +KSIVSFEI+   +
Sbjct: 584  SSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSV 643

Query: 658  KPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYT 717
              SP+ T++LE+L Q+L    S+ LYP+ ++GYTYEI+ SSKG+V L  T+SGF EGVY 
Sbjct: 644  CASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYN 703

Query: 718  IAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMW 777
            + K  V+ +K  ++    +S    R+ARI VR KYE A++ NC  LAS+GLLI+LEE MW
Sbjct: 704  LIKIIVEEIKSFSS-RDIISSKVFREARIAVRSKYEEAAAANCTALASLGLLIILEECMW 762

Query: 778  TLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVS 837
             ++DR++ALE     +F  FC  F  +P  + L IQG++   ++IN +L  + T HL+ +
Sbjct: 763  PIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDT 822

Query: 838  NEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFL 897
             E   P       P  K L  GTN FV  N   DDPNNSIVYFIQT +R D  + T T L
Sbjct: 823  REYQGPV----REPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCL 878

Query: 898  TEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYL 957
             E+  SLTLVPDLRNKKQIGY V GGLR+L+ ++G+HIT MS  P  +LE +I EYLSYL
Sbjct: 879  AEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYL 938

Query: 958  QLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNN 1017
            +  +L+T TE +F+   +  +  +++ N  N+++ ++GP +L+ +I ANV++G N     
Sbjct: 939  EKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG-NLEEQG 997

Query: 1018 RQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSI 1077
              M+ H+  +N+I  RR++F  E E  +   L+ +TL  +  FF  KISIYS +RSKLS+
Sbjct: 998  SAMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSV 1057

Query: 1078 MITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRR 1137
            MI SPM  E+I  +++FLQ+E+FLK+KG  I S DL  I++ S G    +++ LF  F  
Sbjct: 1058 MIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSA 1117

Query: 1138 RNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPIIPLQGL 1197
              E  KL  V+++EISK +++S K         P  +    D  +     +   +PL  +
Sbjct: 1118 NGETMKLCNVIIKEISKALVLSLKN--------PSQRTRVDDALRGLSKIVTSALPLTEI 1169

Query: 1198 PDPNVFR 1204
             D N FR
Sbjct: 1170 KDVNQFR 1176

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1206 (40%), Positives = 711/1206 (58%), Gaps = 40/1206 (3%)

Query: 6    VINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLG 65
            V +++V  Y P+S SN+  ++C+L NGIL LLI                  H DP + LG
Sbjct: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEVLG 67

Query: 66   LAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAF 125
            LAHLCEH IL+AGSK++P +  +H ++A+N GS NAYTTGE TTFYFELP S  +GE  F
Sbjct: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLF 127

Query: 126  EFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRF 185
            + +LD  AS FKNP+F+   I+KEIYAI+SEH  N +ST K  YHA RLLAN  HPFSRF
Sbjct: 128  DKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRF 187

Query: 186  STGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDI 245
             TGN  +L   P L K+N+K +L  YFK NY    + +C+RGPQS+N LAKLA   FGD+
Sbjct: 188  CTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDL 247

Query: 246  KPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEH 305
                  +     ++    +R     S+G  S++ H +   FK      +++ +    F  
Sbjct: 248  PASRDRDPTRPPLK----KR----PSSGVASQDLHVRPLDFK----NSKQQTQVQDAFV- 294

Query: 306  PPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVS 365
            P   N + I S+K+PV+R +FPVS K+TR T  DI   S  WC+ FGDE  GSL   L +
Sbjct: 295  PDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKT 354

Query: 366  RGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLIT 425
               I    A  + F+ GN GL LE  LTN GW S + I T +F   +P         +  
Sbjct: 355  NNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAK 414

Query: 426  FLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEID-DPN 484
             L E N  D+  FLYQ +E   ME C+ LS+ L    E L P  + KG   LIE + +P+
Sbjct: 415  CLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKG-SPLIECNQNPS 473

Query: 485  -IDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSEMYT 543
             I  Y  S  +  WWIG+AIKFQNF+   +N +N R+++LGN    ++   +   S+  T
Sbjct: 474  AIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSK--T 531

Query: 544  DXXXXXXXXTGKVD-LTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSLKS 602
            D          K+D L+  +E Y    + F  P  ++FLP        ++Q     S +S
Sbjct: 532  DAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRS 591

Query: 603  KFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPSPE 662
            + + L    ++   + +P+L  KN N+E+WV +ED +    +KSI+S E+    I+  P 
Sbjct: 592  QTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPS 651

Query: 663  ATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAKTF 722
             T+ LEVLAQ+L    S+ LYP+ ++GYTYEI+ S+KG+  L FTISGF EGV  + +  
Sbjct: 652  YTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVI 711

Query: 723  VDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQDR 782
            +D  K +    T ++    RKAR+ VR KYE A+S N   LA++GLLIVLEE MW ++DR
Sbjct: 712  IDQTKSLINSDT-VTPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWPVEDR 770

Query: 783  IDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQHLKVSNEDNR 842
            +DALE  +  SF+ FC  F + P  L +  QG+L Y +EI+ +L++  T HL      + 
Sbjct: 771  LDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTW-HE 829

Query: 843  PTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEYLF 902
            P +     P T  L  GTN F+  +   +DP++SIVYFIQT  R+D + ++LT LTE+L 
Sbjct: 830  PAV---REPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLM 886

Query: 903  SLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQVL 962
            S+TLVPDLR KKQIGY V  GLR+L+ T+G+HIT MS  P  +LE++I++YL+Y++  VL
Sbjct: 887  SMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVL 946

Query: 963  NTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQMKQ 1022
            +  +E +F+   +  F A+ ++ +      ++GP +LL +I ANV +G N       M+Q
Sbjct: 947  SAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSG-NLPEQGAAMRQ 1005

Query: 1023 HRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIMITSP 1082
            H++IRN+I   R++F  + E  D+  L+ LTL ++  FF+ KISI S  RSKLS+M+ SP
Sbjct: 1006 HKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASP 1065

Query: 1083 MAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNEAF 1142
            ++ ++I  +++FLQ+E++LK+KG  I S +L++IV++S+G P  L++ LF  F  R E  
Sbjct: 1066 VSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETL 1125

Query: 1143 KLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEH---QDIEKFWKTDIKPIIPLQGLPD 1199
            +L  V+L+E+SK +++S K R       P + N     Q++ K   T + P+I +Q    
Sbjct: 1126 RLCNVILKELSKAVVLSLKPR-------PTNNNSAGVLQNVRKEVSTAV-PLIEVQA--- 1174

Query: 1200 PNVFRR 1205
             N FR+
Sbjct: 1175 -NHFRQ 1179

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1163 (41%), Positives = 690/1163 (59%), Gaps = 35/1163 (3%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            MS  +V NY++PIYIP S     +K+C+LPNGIL ++I                  HNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120
                GLAHLCEHMIL+AGSK+YPD   +H LI+++NGS NAYTTGEQTTFYFE+P   ++
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180
             E  FE +LD+F+S FK+PLF    ++KEIYAI+SEH+GN  + TKI YHA RLLANS H
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240
            PFSRFSTGNI +L    +L K   K  L +YFK NY   N+T+CI+GPQSVN+L K A++
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  KFGDIKPKNSVEGNNF---SIRAGSFRRSR----SVKSTGDFSKNDHR--KLESFKILET 291
             F  I   +S+  +N    S+++  +   R    S+      SK +    +LE F IL  
Sbjct: 241  YFNGI--DDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSN 298

Query: 292  VWEEKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELF 351
             +  KYK+ KCF+  P  N IFI S K P++R LFP+   +  F K+D+  +  +WCELF
Sbjct: 299  AYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELF 358

Query: 352  GDESPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKL 411
            GDE+  SL  +L     IT CFAF S FA+ ++GL++EL LT +G ++ + I  +I +  
Sbjct: 359  GDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSA 418

Query: 412  LPSFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVF 471
            +      N   L  FL E N IDI RF+ +  ED  M+E S +S+ LQENL    PS + 
Sbjct: 419  IEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL 478

Query: 472  KGFKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEV 531
            K F  + +  +  I  +E +E +  WW+ +A  FQ FLK ++N +N R+L LG++++ + 
Sbjct: 479  KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKF 538

Query: 532  FDKIEKRSEMYTDXXXXXXXXTGKV-----DLTRDDESYAKSYYEFNFPTSNIFLPDYIN 586
                E      TD        T K       L ++D+ +         P  N F+P+ I 
Sbjct: 539  TTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRN----IGIPKRNTFMPE-IG 593

Query: 587  DPLKLQQLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKS 646
              L +    LE  LK   +   P I +   +  P LV KN N E WVL       S   S
Sbjct: 594  KSLAILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWVLNSPLQHSSTESS 653

Query: 647  IVSFEILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRF 706
            I SFEI    IKPSP +T+HLEVL Q+L I+ +  LYPALR+GYTYEI +S  G+V L  
Sbjct: 654  IFSFEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMI 713

Query: 707  TISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASI 766
            TISGF  G+ ++ +  +     I+     ++   + +AR++ RRKYE A+S N VKLAS+
Sbjct: 714  TISGFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASV 773

Query: 767  GLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYL 826
            GLLI+LE++MWTL+DR DALE ++ +SF  FC  F+ + K +   I G  E A +++H +
Sbjct: 774  GLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLI 833

Query: 827  NNNF----TQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQ 882
             +++    T  L    ++N  + C         L  G N +  + G + D NN I YFIQ
Sbjct: 834  YDHWILSDTISLNYFEKNNILSTCF--------LKPGENVYFQHPGDEGDINNCINYFIQ 885

Query: 883  TAKRNDIESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGP 942
            T +RN+    TLT LT+Y+    LV +LRN+KQ+GY+V GG+R LT T+G+HIT+MS   
Sbjct: 886  TGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLAD 945

Query: 943  AHNLENKINEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNE 1002
              +LE  I+EY+  L+   + +  ES F+   L PF+  +++++ N   + +  VNL+++
Sbjct: 946  PEDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDTNNPFNNVTN-VNLVDD 1004

Query: 1003 IVANVQNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEY-EMFDIPFLQGLTLKRYLEFF 1061
            +VANVQ GD+     +QMK H  ++ +I   R     +Y E  D+  ++ LTLK YLEFF
Sbjct: 1005 VVANVQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFF 1064

Query: 1062 ESKISIYSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSK 1121
             + ISI S+ RSK+SI I S MA+E+I +RK+FLQL  FLK+KG  IK ++LK IV+ S+
Sbjct: 1065 RATISINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISE 1124

Query: 1122 GSPVLLIKNLFTSFRRRNEAFKL 1144
            G P  L+K +   F++++EA KL
Sbjct: 1125 GKPSKLLKEIVKYFKKKDEAKKL 1147

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1172 (38%), Positives = 693/1172 (59%), Gaps = 55/1172 (4%)

Query: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDP 60
            M+   V   +VPIY P+S SNR H+  +L NGI ALLI                  HNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS- 119
             +  GLAHLCEHMI+++ SK++P    +H L+ + NG+QNA+TTGEQT+FYFE+PNS + 
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 120  NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSD 179
             G+  F+ ++ V A    +P+F    I+KEI AI +EHE N +  +K  YH  + LA   
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFSRFSTGNIHSLSSIPQL--KKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKL 237
              FSRFSTGNI++L+  P +  K INLKN L  ++ +N+  ENI+I IRG QS++ L KL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  AISKFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKY 297
              + FGD + K++++  +FSI                         ESFK L+ VW  +Y
Sbjct: 241  VQTTFGDFRTKSTIKSQSFSI-------------------------ESFKKLQKVWAARY 275

Query: 298  KN---SKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDE 354
                 SK  + P   N+I I S+K+P++R +FPVS +   F++ ++KI+S +W +LFGDE
Sbjct: 276  TEPLFSK--QEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDE 333

Query: 355  SPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWES-IKDITTTIFSKLLP 413
            S GS+ S   +R  +T+     S+F I + GL+L+ ELTNSGW++ ++ + T +F   LP
Sbjct: 334  SSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLP 393

Query: 414  SFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNL-STILQ-ENLEYLTPSNVF 471
             F   + D +  +L E N I++ +F+YQ  ++  M++CS+L S +LQ E+ +++  +++ 
Sbjct: 394  FFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQCEDPQFILNNSI- 452

Query: 472  KGFKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEV 531
              F    +  D  I  Y  S  + +WW  QA KF +F+K++M+  N +L+ LG+++S + 
Sbjct: 453  -AFSCNRKGSD--IGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDF 509

Query: 532  FDKIEKRSEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKL 591
                +  + +  D           + L         S  +F  P+S  FL     +   L
Sbjct: 510  LKSRQVPTNVKFDEHYRFQYELSLIKLNH----VKMSPKDFRLPSSTAFLFGLEKNLSAL 565

Query: 592  QQLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFE 651
            +Q       KS+ + L    QS+  +  P+L+SKN NYE+WV KE+ +    ++S+++ E
Sbjct: 566  KQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV-KEENSLEYSSRSVITIE 624

Query: 652  ILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGF 711
            ++ +G++PS + T++LE+L Q+L+   +  LYP+ RVGY Y+IA++++G+V L  TI+GF
Sbjct: 625  LINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGF 684

Query: 712  SEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIV 771
             +GV  I +  +D +  I      ++    R +RILVR KYE A+  N   LAS+G+LI+
Sbjct: 685  PQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVLIL 744

Query: 772  LEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKR--LVLLIQGNLEYADEINHYLNNN 829
            LE+ + TL++R+DALE  +  SFK FC   W  PK   + L+IQG+L  A+ +N Y++  
Sbjct: 745  LEKELTTLEERLDALEDIDIESFKMFCKDLWI-PKSNYMNLVIQGDLSIAETVNQYMDG- 802

Query: 830  FTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDI 889
               HL   N  N+ ++     P T  L +G+N F+     ++DP NS+VYFI+T  R + 
Sbjct: 803  IIHHLSGPNV-NQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNP 861

Query: 890  ESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENK 949
               T++ L EY  S+TLVPDLRNKKQIGY+VLGGLR+LT+T+GIHI+VMS  P H +E++
Sbjct: 862  VDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIEDR 921

Query: 950  INEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQN 1009
            I EYL YL+  VL   TE++F+  +L+ ++ L+K NS  KL  ++GP NL+ +I A+V +
Sbjct: 922  IEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHS 981

Query: 1010 GD---NYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKIS 1066
            G+   N       + QH+K++++I  R ++F +     D+  L  LTL+ +   F  KIS
Sbjct: 982  GNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSE--TKVDVCLLSKLTLQEFKRLFMEKIS 1039

Query: 1067 IYSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVL 1126
            I S QR KLS+   +PM + DI    M +QL+ FLK KGF I  ++L+ IV  + G P  
Sbjct: 1040 ILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTS 1099

Query: 1127 LIKNLFTSFRRRNEAFKLGAVVLQEISKIIIV 1158
            L K LF  FR + ++ +L  +VL+EI K I+ 
Sbjct: 1100 LFKELFHHFRTQGQSLRLCTLVLKEIVKQILA 1131

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/1207 (30%), Positives = 616/1207 (51%), Gaps = 114/1207 (9%)

Query: 3    LREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKD 62
            + +V  + VP Y+PL + NR +K+ +LPNGI  ++I                  HNDP  
Sbjct: 2    ITDVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPAT 61

Query: 63   TLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPN-SQSNG 121
              GLAHLCEHMILAAGS  +P  GLFH+LIAK NG  NAYTTGEQT+FYF++P  + S G
Sbjct: 62   VPGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEG 121

Query: 122  EFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHP 181
              AFE +L VF+S FK PLF   +++KEIYAIQSEHE N ++  K+ Y A RLLAN +HP
Sbjct: 122  TLAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHP 181

Query: 182  FSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISK 241
            FSRF TG++++L + P  + IN++  L +YF +N++GENIT+C+RGPQS+N L KL +  
Sbjct: 182  FSRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQN 241

Query: 242  FGDIKPKNSVE---GNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYK 298
            F DIKP   +    GNN       F  +                L+   IL  VW  +Y 
Sbjct: 242  FNDIKPLPVLPTAIGNNRDSDTELFEET----------------LKRLNILYDVWAPRYT 285

Query: 299  NSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGS 358
            +  CF      N I +NS+     R + P+   +TR      ++++++  EL G+E  GS
Sbjct: 286  SLPCFHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELLGNEEVGS 345

Query: 359  LGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVK 418
               +L    W+ +C+ + SEFA+G  G++LE +  ++G+  I++I   +F  L+P +   
Sbjct: 346  FCHFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLIPMYLNM 405

Query: 419  NIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLI 478
              D L  F+KEQ +I+   F+Y      PMEE S+LS  LQ++L         +G K L+
Sbjct: 406  PSDDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHN-------RGIKYLL 458

Query: 479  EIDDPNIDKYE--NSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIE 536
                  +  YE  +    + +W     KF+ FL+ HM   N +++I              
Sbjct: 459  MKSPSFLHNYEEMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVII-------------- 504

Query: 537  KRSEMYTDXXXXXXXXTGKVDLTRD-DESYAKSY---------------YEFNFPTSNIF 580
              SE +T           ++++T + D  Y  +Y               Y+F+FP  N F
Sbjct: 505  PTSEPFTKTVRNLFKNAQQMEVTSETDPYYEFNYSVYSVSFPESRVIFPYQFSFPGPNEF 564

Query: 581  LPDYINDPLKLQQLFLECSLKSKFATLRP--QIQSEPTKRLPQLVSKNLNYEMWVLKEDP 638
            +P    +   L ++    S ++ F+ LRP  ++++   +  P+LV +  + E+W      
Sbjct: 565  IPPKYRNLDTLLEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVD 624

Query: 639  NFIS-----DNKSIVSFEILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYE 693
               S     D KS V+ +I+   I+P+P +++HL ++ +++ +     LY   ++G+++ 
Sbjct: 625  GIFSKVVNADIKSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFH 684

Query: 694  IASSSKGNVTLRFTISGFSEGVYTIAKTFVDTLKKIATDATF-LSKDTVRKARILVRRKY 752
            + ++  G+++    ++G   G+  I +   D ++ I T   + L+   +RKAR+ +R +Y
Sbjct: 685  LQAALDGSMSFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRY 744

Query: 753  EGASSDNCVKLASIGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLI 812
            E A+  + VK+ + GLL+ LE ++W+ ++R+DALE ++   F +F   F+   K   +  
Sbjct: 745  EAATKGSSVKIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFA 804

Query: 813  Q-GNLEYADEINHYLNNNFTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQD 871
            Q  +    D+I  Y+         +   ++    C+     T+ L  G    +   G  +
Sbjct: 805  QSSSTSNIDKIARYVVQRIVTP-GIPEGNDALVECVRDDGHTRMLKPGEERHIKLIGRDN 863

Query: 872  DPNNSIVYFIQTAKRNDI--ESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTE 929
            DPNN +  +++ A    I  +   +   T+YLF LTLVP+LRNK+Q+GY V GGL +L  
Sbjct: 864  DPNNCVFSYLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNN 923

Query: 930  TVGIHITVMSGGPAHNLENKINEYLSYLQLQVLNTFTE--SDFRRIL--LEPFLALLKQN 985
             VG+++ V+S     ++E +I  Y ++++  + +   +   D+ +I+   +P + LL  +
Sbjct: 924  VVGVNVVVVSSTSPEHIEQEIESYYAHVRQYLSDNVDQIWRDYSKIINDRDPLMYLLDHD 983

Query: 986  SFNKLESSSGPV-NLLNEIVANVQNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMF 1044
             +  +E  +  +     + VAN Q                        R F ++D  E+ 
Sbjct: 984  VWYNIERENSDIPEYSRDHVANCQ------------------------RVFKYKDLIELL 1019

Query: 1045 --DIP-------FLQGLTLKRYLEFFESKISIYSRQRS-----KLSIMITSPMAEEDIVS 1090
              D P       +    +++ YL+F +S I  Y  +R       +S+ + SPM + D+  
Sbjct: 1020 VVDTPISGRHPDYTPPFSMQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQ 1079

Query: 1091 RKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRRNEAFKLGAVVLQ 1150
            R++  QLE+FLK+KG  I   DL  I+  + G    + K L+  F+R+NEA K    V  
Sbjct: 1080 RQVKYQLESFLKLKGLVIPERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVAT 1139

Query: 1151 EISKIII 1157
            E  K I+
Sbjct: 1140 ETFKSIL 1146

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  158 bits (399), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 135/511 (26%), Positives = 226/511 (44%), Gaps = 95/511 (18%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R ++  +LPN + ALLI                    DP+   GLAH CEH++   G++
Sbjct: 59  DRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEHLLFM-GNE 117

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           +YPD   + + ++K+ GS NAYT  + T +YF L     N E  +   LD F+ FF  PL
Sbjct: 118 KYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHL-----NHENLYP-ALDRFSGFFSCPL 171

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ +     Y   + L N +HP+ +FSTGNI +L  IP+LK
Sbjct: 172 FNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTLGDIPKLK 231

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            I+++N L  + KNNY    + +C+ G + ++ LA      F D+ P  + +   +  R 
Sbjct: 232 GIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDV-PNLNKQVPYYPARL 290

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                         ++++  +K+        V+ +  K+ K  E                
Sbjct: 291 --------------YTESQLKKM--------VYCKPVKDLKKIE---------------- 312

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
              F FP  D +  +  +     SH    L G E  GSL ++L  +GW  +  A +   +
Sbjct: 313 ---FTFPTPDMDPYWESKPNHYLSH----LIGHEGNGSLLAFLKEKGWAVELSAGSHTIS 365

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIFSKL------LPSFYVKNIDYLITFLKEQNLID 434
             N    +E++LT+ G   + +I  + F  L      LP  ++ N         E     
Sbjct: 366 KDNAVFGIEIDLTDDGMNHVNEIIISTFQYLEMLKVTLPEEWIHN---------ELKSTS 416

Query: 435 IARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEIDDPN-IDKYENSEA 493
           ++ F ++  +D P    SN++  L++  EY+   ++     SLI   +P+ I KY  S  
Sbjct: 417 VSSFKFK-QKDPPSSTVSNMARCLEK--EYIPVVDILS--TSLIREYNPSMIKKYVQS-- 469

Query: 494 NMQWWIGQAIKFQNFLKSHMNHENTRLLILG 524
                              +N EN+R+++ G
Sbjct: 470 -------------------LNWENSRIMLTG 481

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  154 bits (389), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/397 (25%), Positives = 178/397 (44%), Gaps = 57/397 (14%)

Query: 14  YIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHM 73
           +I     +R+++  +LPN + AL+I                   +DP++  GLAH CEH+
Sbjct: 40  FIKPDLDDRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEELPGLAHFCEHL 99

Query: 74  ILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFA 133
           +   GS+++PD   + + ++K+ GS NAYT  + T +YF++ +    G       LD F+
Sbjct: 100 LFM-GSRKFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQVNHEHLKG------ALDRFS 152

Query: 134 SFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSL 193
            FF  PLF+     KEI A+ SE++ N+ +     Y   + L+N  HP+ +FSTGN+ +L
Sbjct: 153 GFFTGPLFSKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHPYHKFSTGNLKTL 212

Query: 194 SSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIK--PKNSV 251
           + IP+ K ++++N L  ++   Y    + +C+ G + ++ L+  A   F D+   P+ + 
Sbjct: 213 NEIPKSKGVDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELFSDVPNLPRPAP 272

Query: 252 EGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNT 311
           E     +     ++   VK   D +K                                  
Sbjct: 273 EFEASILDGAYLKKFIHVKPVKDLTK---------------------------------- 298

Query: 312 IFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITK 371
                     +   F V D    +  +   I SH    L G E  GSL ++L S GW  +
Sbjct: 299 ----------LEVTFVVPDVEDHWESKPNHILSH----LIGHEGSGSLLAHLKSLGWANE 344

Query: 372 CFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIF 408
             A     +  N    ++++LT+ G +  +D+T TIF
Sbjct: 345 LSAGGHTVSKSNAFFCIDIDLTDEGLKHHEDVTHTIF 381

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 107/277 (38%), Gaps = 22/277 (7%)

Query: 699 KGNVTLRFTISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSD 758
           K N  L  TI+GF++ +  +   F++ LK    D         +  + L  + YE   S 
Sbjct: 608 KTNEGLDITITGFNDKLIILLTRFLEGLKAFKPDRKRFEIFKEKSKQHLNNQLYEIPYSQ 667

Query: 759 NCVKLASIGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEY 818
                 S+     + E  WT +++++ +E       + F    +        L+ GN++Y
Sbjct: 668 VSSLYNSL-----VNERSWTAEEKLEVVEQLTFEQLEAFIPTIFEE-MFFETLVHGNIKY 721

Query: 819 --ADEIN---HYLNNNFTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDP 873
             AD+I+     L +N   + ++ N   R     Y  P  K     T+ + +      + 
Sbjct: 722 EEADQIDSLIQMLRSNSVSNSQIKNARIRS----YVLPLGK-----THRYEAKLADTQNV 772

Query: 874 NNSIVYFIQTAKRNDIESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGI 933
           N+ I Y IQ    ++  S       + L        LR K+Q+GY+V         T  I
Sbjct: 773 NSCIQYVIQLGVYDEALSAIGRLFAQMLHE-PCFDTLRTKEQLGYVVFSSSLNNHGTANI 831

Query: 934 HITVMSGGPAHNLENKINEYLSYLQLQVLNTFTESDF 970
            I + S      LE +I  +L     + L   ++ DF
Sbjct: 832 RILIQSEHTTPYLEWRIESFLEQFG-KTLKEMSDRDF 867

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  154 bits (388), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 125/469 (26%), Positives = 211/469 (44%), Gaps = 81/469 (17%)

Query: 14  YIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHM 73
           +I     +R+++  KLPN + AL+I                    DP+   GLAH CEH+
Sbjct: 54  FIKPDLDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGLAHFCEHL 113

Query: 74  ILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFA 133
           +   GS+++PD   + + ++K+ GS NAYT+   T +YFE+     N E  +   LD F+
Sbjct: 114 LFM-GSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEV-----NHEHLYN-ALDRFS 166

Query: 134 SFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSL 193
            FF  PLFN     KEI A+ SE++ N+ +     Y   + L+N  HP+ +FSTGN+ +L
Sbjct: 167 GFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHKFSTGNLITL 226

Query: 194 SSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSV-- 251
              P+   +N+++ L  ++ ++Y    + +CI G + ++ L+  A   F D++  N    
Sbjct: 227 GENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDVRNTNRALP 286

Query: 252 EGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLE-SFKI--LETVWEEKYKNSKCFEHPPG 308
           E ++  +     ++   VK   +      RKLE SF +  ++  W+ K         PP 
Sbjct: 287 EYSSKILNETHLQKIIQVKPVKEL-----RKLEISFMVPDMDRHWQSK---------PP- 331

Query: 309 KNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGW 368
                                               HL   L G E  GSL +YL ++GW
Sbjct: 332 ------------------------------------HLLSHLIGHEGSGSLLAYLKAKGW 355

Query: 369 ITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKL------LPSFYVKNIDY 422
             +  A     +  N    +++ELT  G ES K++  +IF  +      LP  ++     
Sbjct: 356 ANELSAGGHTVSKDNAFFSIDVELTKDGLESYKEVVHSIFQYIEMLRNSLPQDWI----- 410

Query: 423 LITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVF 471
              F++ QN I  A F ++   + P    S L+ +L++  EY+   N+ 
Sbjct: 411 ---FVELQN-ISRANFKFKQKGN-PASTVSALARLLEK--EYIPVENIL 452

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 136/366 (37%), Gaps = 66/366 (18%)

Query: 699  KGNVTLRFTISGFSEGVYTIAKTFVDTLKKIATD----ATFLSKDTVRKARILVRRKYEG 754
            K N  L  T+SGF++ + T+   F+  +K           F  K T     +L    Y  
Sbjct: 622  KTNQGLDITLSGFNDKLVTLMTRFLQGVKDFKPTEERFKIFKDKTTQHLKNLLYEVPYSQ 681

Query: 755  ASSDNCVKLASIGLL-IVLEEYMWTLQDRIDALELTE--------TSSFKEFCYLFWNNP 805
             S          G+   ++ E  W+++++++ +E            + F+E  Y      
Sbjct: 682  IS----------GVYNSLINERSWSVEEKLNVVEHITFEQLLAFIPTVFEELYY------ 725

Query: 806  KRLVLLIQGNLEY--ADEINHYLN-----NNFTQHLKVSNEDNRPTICLYPSPSTKNLDR 858
                 L+ GNL++  A EI   +N     N    +L+V N  NR      P   T   ++
Sbjct: 726  ---ETLVHGNLKFEEAIEIESLINDILITNENHNNLQVKN--NRLRSYFIPKGKTYRFEK 780

Query: 859  GTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEYLFSLTLVP---DLRNKKQ 915
                  + N             IQ   + D+ +  L+ L+     +   P    LR K+Q
Sbjct: 781  ELKDSKNVNS-----------CIQHVTQLDVYNEELSALSGLFAQMIHEPCFDTLRTKEQ 829

Query: 916  IGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQVLNTFTESDFRRILL 975
            +GY+V         T  I I V S      LE +I E+ S     +L   +E DF +   
Sbjct: 830  LGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIEEFYSKFG-AILKDMSEEDFDK-HK 887

Query: 976  EPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQMKQHRKIRNKIIERRF 1035
            +     L Q   N  E SS          A +  GD Y   +RQ K+ R ++    E+  
Sbjct: 888  DALCKSLLQKYKNMGEESS-------RYTAAIYLGD-YNFTHRQ-KKARLVKALSKEQLI 938

Query: 1036 SFQDEY 1041
             F D Y
Sbjct: 939  EFYDNY 944

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  154 bits (388), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 110/391 (28%), Positives = 174/391 (44%), Gaps = 59/391 (15%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R ++  +LPN +  LLI                    DP+   GLAH CEH++   GS+
Sbjct: 19  DRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGLAHFCEHLLFM-GSE 77

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           +YPD   + + ++ N GS NAYT    T ++FE+      G       LD F+ FF  PL
Sbjct: 78  KYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEINYEHLEG------ALDRFSGFFSRPL 131

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           F+     KEI A+ SE++ N+ S     Y   + L+N  HP+ +FSTGNI +L +IP  +
Sbjct: 132 FSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHPYHKFSTGNIQTLGTIPNEQ 191

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            +++++ L  ++ N+Y    + + I G + ++IL   A S F D+               
Sbjct: 192 GLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMFKDV--------------- 236

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                           KN +R+L        V+EEK    +            IN     
Sbjct: 237 ----------------KNLNREL-------PVYEEKMLTEEYLMQ-------IINIKPVQ 266

Query: 321 VIRFL---FPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTS 377
            +R L   F V D +  +  +  +I SH    L G E  GSL ++L   GW T+  A   
Sbjct: 267 DMRKLELSFTVPDLDKEWESKTPRILSH----LLGHEGSGSLLAHLKCLGWATELAAGGH 322

Query: 378 EFAIGNIGLMLELELTNSGWESIKDITTTIF 408
             +  N    ++++LT  G+   +D+T  IF
Sbjct: 323 TISDDNAVFSVDIDLTEEGFNHYEDVTVAIF 353

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 57/275 (20%), Positives = 110/275 (40%), Gaps = 45/275 (16%)

Query: 696 SSSKGNVTLRFTISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGA 755
           S SK    L  T+SGF+  +  + ++F+  +K             + K+R L+ ++    
Sbjct: 577 SFSKTGQGLDITVSGFNHKILILLESFLKGIKNFK----------LEKSRFLIFQEKYIQ 626

Query: 756 SSDNCVKLASIGLL-----IVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVL 810
              N +     G +      V+++  W++++++  ++       + F    +N       
Sbjct: 627 QLKNMLFQVPYGQVSHYYNYVIDDRAWSIKEKLSTMQKLTFEDLENFLPTIFNEV-YFES 685

Query: 811 LIQGNLEYAD--EINHYLNNNFTQHL---KVSNEDNRPTICLYPSPSTKNLDRGTNTFVS 865
           L+ GN E +D  E+N  +    +  +   ++ N+  R  +          L +G      
Sbjct: 686 LVHGNFEKSDAAEVNQLVEKYISGSIHNPQIRNDRLRSYV----------LQKGET--YR 733

Query: 866 YNGHQDDP---NNSIVYFIQTAKRND----IESMTLTFLTEYLFSLTLVPDLRNKKQIGY 918
           Y    +DP   N+ I +  Q    ND    + S+    + E  F++     LR K+Q+GY
Sbjct: 734 YETLLEDPENVNSCIQHVTQIGLYNDRLAALSSLFAQIINEPCFNI-----LRTKEQLGY 788

Query: 919 IVLGGLRVLTETVGIHITVMSGGPAHNLENKINEY 953
           +V         T  I I V S      LE +I+E+
Sbjct: 789 VVFSSSLNNYGTTNIRILVQSEHTTEYLEWRIDEF 823

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  153 bits (387), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 123/459 (26%), Positives = 206/459 (44%), Gaps = 76/459 (16%)

Query: 22  RTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSKQ 81
           R+++  +LPN + ALLI                   NDP+   GLAH CEH++   GS++
Sbjct: 45  RSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDPEPLPGLAHFCEHLLFM-GSRK 103

Query: 82  YPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPLF 141
           +PD   + + ++K+ G  NAYT    T ++FE+     N E  F   LD F+ FF  PLF
Sbjct: 104 FPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEI-----NAEHLFG-ALDRFSGFFTGPLF 157

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLKK 201
           N     KEI A+ SE++ N+ +     Y   + L+N  HP+ +FSTGNI +L  +P+ + 
Sbjct: 158 NKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLKHPYHKFSTGNIQTLKQLPESQG 217

Query: 202 INLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNS---VEGNNFSI 258
           +N+++ L  ++ ++Y    + +CI G + ++ LA+     F D+K K+    V  +   +
Sbjct: 218 LNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTADLFNDVKNKDKPLPVFQDPILL 277

Query: 259 RAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNK 318
           +    +R   V+   +  K D                                       
Sbjct: 278 KEQHLQRIIQVEPVKELRKLD--------------------------------------- 298

Query: 319 SPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSE 378
              I F  P  +K+ +      KI  H+   L G E  GSL S+L + GW  +  A    
Sbjct: 299 ---IEFCVPDYEKHWQ-----SKI-PHILSHLIGHEGNGSLLSHLKTLGWANELSAGGHT 349

Query: 379 FAIGNIGLMLELELTNSGWESIKDITTTIFSKL------LPSFYVKNIDYLITFLKEQNL 432
            +  N    + +ELT  G    KD+T  IF  +      LP  ++        +L+ QN 
Sbjct: 350 VSENNAFFSIAIELTQKGLAHYKDVTHLIFQYIEMLRHSLPQEWI--------YLELQN- 400

Query: 433 IDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVF 471
           I+ A F ++ + + P    S+LS +L++  EY+   ++ 
Sbjct: 401 INKANFKFKQNGN-PSNTVSSLSKMLEK--EYIPVGDIL 436

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 110/287 (38%), Gaps = 29/287 (10%)

Query: 695 ASSSKGNVTLRFTISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEG 754
           AS +K N  L  T+SGF++ +  +   F+  +K    ++        +  + L    YE 
Sbjct: 602 ASLTKTNQGLDITVSGFNDKLIILLTRFLQGIKSFKPNSDRFQIFKDKTIQHLQNSLYEV 661

Query: 755 ASSDNCVKLASIGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQG 814
             S       S+     + E  WT  +++ AL+         F    +        LI G
Sbjct: 662 PYSQMSTLYNSL-----INERTWTTTEKLSALDKISYDQLLTFIPTIFEE-LYFESLIHG 715

Query: 815 NLEY--ADEINHY----LNNNFTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNG 868
           NL+Y  A EI+      L  N   +L++ N+  R  I          L +G  TF  Y  
Sbjct: 716 NLKYDEAMEIDSLVKLLLTENNILNLQIQNDKLRSYI----------LPKG-KTF-RYET 763

Query: 869 HQDDPNNSIVYFIQTAKRNDIESMTLTFLTEYLFSLTLVP---DLRNKKQIGYIVLGGLR 925
              DP N +   IQ   + DI S  L+        +   P    LR K+Q+GY+V     
Sbjct: 764 DLKDPKN-VNSCIQHVTQIDIYSEELSAKCALFAQMIHEPCFDTLRTKEQLGYVVFSSTL 822

Query: 926 VLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQVLNTFTESDFRR 972
               T  I I V S      LE +I+ +      + L T +E  F +
Sbjct: 823 NNHGTANIRILVQSEKSTPYLEWRIDNFYKIFG-KSLKTMSEDTFVK 868

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  150 bits (378), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 108/391 (27%), Positives = 175/391 (44%), Gaps = 53/391 (13%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R+++  +LPN + ALLI                    DP+   GLAH CEH++   GS+
Sbjct: 46  DRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDPEGLPGLAHFCEHLLFM-GSE 104

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           +YPD   + + ++K+ G+ NAYT  + T +YFE+     N E  F   LD FA FF  PL
Sbjct: 105 KYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEV-----NHEHLFG-ALDRFAGFFTCPL 158

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ S     Y   + L N +HP+ +FSTGN  +L  IP   
Sbjct: 159 FNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEHPYHKFSTGNFITLHEIPTSN 218

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            I+++  L  ++K +Y    + +C+ G + ++ L+  A S F D+               
Sbjct: 219 GIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACSLFQDVP-------------- 264

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                +R V   G       + L+   + + +  +  K+ K  E                
Sbjct: 265 ---NIARPVPEYGS------KMLDERSLQKVIHAKSVKDLKKLE---------------- 299

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
                F   D +  +  +   I SH    L G E  GSL ++L  +GW  +  A     +
Sbjct: 300 ---VTFSAPDMDLEWESKPQHILSH----LVGHEGSGSLLAHLKDKGWANELSAGGHSVS 352

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIFSKL 411
             N    ++++LT+ G +  +D+T  IF  L
Sbjct: 353 KENAFFSIDIDLTDLGLKHYEDVTHIIFQYL 383

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  150 bits (378), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 106/388 (27%), Positives = 179/388 (46%), Gaps = 55/388 (14%)

Query: 22  RTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSKQ 81
           R+++  +LPN + ALLI                    DP+   GLAH CEH++   GS++
Sbjct: 72  RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESLPGLAHFCEHLLFM-GSEK 130

Query: 82  YPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPLF 141
           +PD   + + ++K+ GS NAYT  + T ++FE+ +    G       LD FA FF  PLF
Sbjct: 131 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEINHQHLFG------ALDRFAGFFSCPLF 184

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLKK 201
           N     KEI A+ SE++ N+ +     Y   + L N +HP+ +FSTGNI +L ++P+   
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHPYHKFSTGNIETLGTLPKENG 244

Query: 202 INLKNSLNAYFKNNYFGENIT-ICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            N+++ L   F NN++  N+  +CI G + ++ L+    + F DI               
Sbjct: 245 QNVRDEL-LQFHNNFYSANLMKLCILGREDLDTLSDWTYNLFKDIS-------------- 289

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                            N+ R++  +   E + + +Y       HP       +   K  
Sbjct: 290 -----------------NNDREVPHYA--EPIMQSEYLQKIIQVHP-------VKDLKKL 323

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
            I F  P  D + ++  +  +I SHL     G E  GSL ++L + GW  +  A     +
Sbjct: 324 EISFTVP--DMDEKWESKPPRILSHL----IGHEGSGSLLAHLKNVGWANELSAGGHTVS 377

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIF 408
            GN    ++++LT++G    +D+   +F
Sbjct: 378 KGNAFFAVDIDLTDNGLTHYRDVIVLVF 405

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  149 bits (377), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 108/391 (27%), Positives = 176/391 (45%), Gaps = 61/391 (15%)

Query: 22  RTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSKQ 81
           R+++  +LPN + ALLI                    DPK+  GLAH CEH++   GS++
Sbjct: 72  RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLPGLAHFCEHLLFM-GSEK 130

Query: 82  YPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPLF 141
           +PD   + + ++K+ GS NAYT  + T ++FE+ +    G       LD F+ FF  PLF
Sbjct: 131 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVNHQHLFG------ALDRFSGFFSCPLF 184

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLKK 201
           N     KEI A+ SE++ N+ +     Y   + L N+ HP+ +FSTGNI +L ++P+   
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTLPKENG 244

Query: 202 INLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRAG 261
           +N+++ L  + KN Y    + +CI G + ++ L+      F D+    +  G    + A 
Sbjct: 245 LNVRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYDLFKDV----ANNGREVPLYAE 300

Query: 262 SFRRSRSVKSTGDFSK-NDHRKLE-SFKI--LETVWEEKYKNSKCFEHPPGKNTIFINSN 317
              +   ++         D +KLE SF +  +E  WE K         PP          
Sbjct: 301 PIMQPEHLQKIIQVRPVKDLKKLEISFTVPDMEEHWESK---------PP---------- 341

Query: 318 KSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTS 377
                                  +I SH    L G E  GSL ++L   GW  +  A   
Sbjct: 342 -----------------------RILSH----LIGHEGSGSLLAHLKKLGWANELSAGGH 374

Query: 378 EFAIGNIGLMLELELTNSGWESIKDITTTIF 408
             + GN    ++++LT++G    +D+   IF
Sbjct: 375 TVSKGNAFFAVDIDLTDNGLTHYRDVIVLIF 405

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 89/359 (24%), Positives = 135/359 (37%), Gaps = 44/359 (12%)

Query: 696  SSSKGNVTLRFTISGFSEGVYTIAKTF---VDTLKKIATDATFLSKDTVRKARILVRRKY 752
            S +K N  L  T SGF+E +  +   F   V++ +        L   T+R  + L+   Y
Sbjct: 629  SFNKTNQGLAITASGFNEKLIILLTRFLQGVNSFEPKKDRFEILKDKTIRHLKNLL---Y 685

Query: 753  EGASSDNCVKLASIGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLI 812
            E   S       +I     + E  W+  +++   E         F    +        LI
Sbjct: 686  EVPYSQMSNYYNAI-----INERSWSTAEKLQVFEKLTFEQLINFIPTIYEG-VYFETLI 739

Query: 813  QGNLEY-----ADEINHYLNNNFTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYN 867
             GN+++      D +   L  N   +L+VSN  NR    L P        +G  TF    
Sbjct: 740  HGNIKHEEALEVDSLIKSLIPNNIHNLQVSN--NRLRSYLLP--------KG-KTFRYET 788

Query: 868  GHQDDPNNSIVYFIQTAKRNDIESMTLTFLTEYLFSLTLVP---DLRNKKQIGYIVLGGL 924
              +D  N  +   IQ   + D+ S  L+ L+     L   P    LR K+Q+GY+V    
Sbjct: 789  ALKDSQN--VNSCIQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSS 846

Query: 925  RVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQ 984
                 T  I I + S      LE +IN +      QVL    E DF +   E     L Q
Sbjct: 847  LNNHGTANIRILIQSEHTTPYLEWRINNFYETFG-QVLRDMPEEDFEK-HKEALCNSLLQ 904

Query: 985  NSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEM 1043
               N  E S+          A +  GD Y   +RQ K+ + + N   ++   F + Y M
Sbjct: 905  KFKNMAEESA-------RYTAAIYLGD-YNFTHRQ-KKAKLVANITKQQMIDFYENYIM 954

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 123/491 (25%), Positives = 216/491 (43%), Gaps = 86/491 (17%)

Query: 14  YIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHM 73
           +I     +R+++  +LPN   ALLI                    DPK+  GLAH CEH+
Sbjct: 65  FIKPDLDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHFCEHL 124

Query: 74  ILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFA 133
           +   GSK++P+   + + + K+ GS NAYT  + T ++FE+ +   +G       LD F+
Sbjct: 125 LFM-GSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEINHEHLHGA------LDRFS 177

Query: 134 SFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSL 193
            FF  PLFNP   SKEI A+ SE++ N+ +     Y   + L+N  HP+ +FSTGN+ +L
Sbjct: 178 GFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGNLKTL 237

Query: 194 SSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEG 253
             +P+ + ++++N L  ++ ++Y    + +C+ G + ++ ++    + F  +        
Sbjct: 238 DEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYNLFEAV-------- 289

Query: 254 NNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIF 313
                                   N++R L                      P     I 
Sbjct: 290 -----------------------PNNNRPL----------------------PEYNEPIL 304

Query: 314 INSNKSPVIRFLFPVSDKNT---RFTKEDIKIY-----SHLWCELFGDESPGSLGSYLVS 365
           +  N   +I  + PV D       F  +D+ ++      H+   L G E  GS+ S+L +
Sbjct: 305 LEENLKKIIH-VKPVKDLKKLEITFLAQDMDLFWESKPQHILSHLIGHEGSGSILSHLKT 363

Query: 366 RGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLIT 425
             W  +  A     +  N    ++++LT +G++  K+I   +F       Y++ +   I+
Sbjct: 364 LSWANELSAGGHTVSKDNAFFSIDIDLTENGFQHYKEIVHIVFQ------YIEMLK--IS 415

Query: 426 FLKEQ---NLIDIARFLYQSSEDI-PMEECSNLSTILQENLEYLTPSNVFKGFKSLIEID 481
             +E+    L DIA   ++  + + P    SNLS  L++  EY+   N+      L    
Sbjct: 416 LPQERIFLELQDIANASFKFKQKVNPSSTVSNLSKALEK--EYIPVENILST--GLFRKY 471

Query: 482 DPNIDK-YENS 491
           DP I K Y NS
Sbjct: 472 DPEIMKNYVNS 482

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
            (STE23) - involved in a-factor processing [contig 1] FULL
          Length = 1001

 Score =  146 bits (369), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 216/1022 (21%), Positives = 400/1022 (39%), Gaps = 165/1022 (16%)

Query: 2    SLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPK 61
            ++   +N+ +    PL   +R ++  +LPN +  LLI                    DP+
Sbjct: 37   TMASYVNHNIEFKKPL-LDDREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPE 95

Query: 62   DTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNG 121
            +  GLAH CEH++   GS +YP+   + + ++K+ G  NAYT+ + T ++F++     +G
Sbjct: 96   NLPGLAHFCEHLLFM-GSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQVNQGNLHG 154

Query: 122  EFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHP 181
                   LD F+ FF  PLFN     KEI A+ SE++ N+ S     Y   +  ++ +HP
Sbjct: 155  ------ALDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHP 208

Query: 182  FSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISK 241
            + +FSTGN+ +L  +P+ + +++++ L  ++  +Y    + +C+ G + +++L++     
Sbjct: 209  YHKFSTGNLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDL 268

Query: 242  FGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSK 301
            F D+ P   V   ++  R                       L   + LE +   K     
Sbjct: 269  FKDV-PNRDVPVPSYPTR-----------------------LLLPQNLEQIISAK----- 299

Query: 302  CFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGS 361
                 P K+   +  N        F   D +  +  +     SHL     G E  GSL +
Sbjct: 300  -----PVKDIKRVEVN--------FVAPDMDPYWDSKPGHYLSHL----IGHEGSGSLLA 342

Query: 362  YLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFS------KLLPSF 415
            YL S+GW  +  A +   +  N    + ++LT+ G  + +D+  ++F       K LP  
Sbjct: 343  YLKSKGWANELSAGSHTVSKDNGFFSISIDLTDEGIANYEDVVISVFQYIEMLKKELPQE 402

Query: 416  YVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFK 475
            +V          +E      A F +Q  +  P    S LS  L++  EY+   ++     
Sbjct: 403  WV---------FQELRDTAEASFKFQ-QKGHPASTVSALSKALEK--EYIPVGDILSA-- 448

Query: 476  SLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLIL---GNVKSYEVF 532
            SL+   DP +             I + +       + +  EN+R+ ++       S E +
Sbjct: 449  SLLRKYDPEL-------------ISEYV-------AELKPENSRVTLIHKNATTDSVEKW 488

Query: 533  DKIEKRSEMYTDXXXXXXXXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQ 592
               E     YTD         G+               + + P  N F+     D  KL+
Sbjct: 489  YGTEYAITRYTDSLVERMKSPGR-------------NAQLHLPRPNEFISSNF-DVEKLE 534

Query: 593  QLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEI 652
             +                   EP ++ P L+ ++    +W  K+D  ++      VS ++
Sbjct: 535  NV-------------------EP-RQEPLLLLQDGQSRLWYKKDDRFWVPKGHIYVSMKL 574

Query: 653  LGL--GIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISG 710
            +     I  S   +++++++   L  I       +L V +        K N  L   +SG
Sbjct: 575  VHTYSSIVNSMLTSLYVDLVNDFLKDIQYDSQVASLTVSF-------RKTNQGLDLALSG 627

Query: 711  FSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLI 770
            ++E +  +  ++++ + +   +         +  + L    YE   S      AS     
Sbjct: 628  YNEKMPILLTSYLEGISRFKPNQERFKIFQAKLIQKLNNHLYEIPYSQ-----ASDVYNS 682

Query: 771  VLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNF 830
            ++ E  WT++D+++ +E       + F    +        L+ GN  Y   +  +     
Sbjct: 683  LINERSWTIKDKLEVVEQLTFQHLENFLPTIFEQ-FFFEALVHGNFSYETAVEIH---KL 738

Query: 831  TQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIE 890
             + L  ++  N    CL  S   ++L         Y     D  N I   IQ   +    
Sbjct: 739  VKALAPNDIKN----CLLKSSKPRSLHIPPGRAYYYEQRLADEKN-INSCIQHVNQFGTY 793

Query: 891  SMTLTFLTEYLFSLTLVP---DLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLE 947
            S  L         L   P    LR K+Q+GY+V         TV + I + S      LE
Sbjct: 794  SEELAAKAALFAQLIDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRILIQSERDTAFLE 853

Query: 948  NKINEYLSYLQLQVLNTFTESDFRR-------ILLEPFLALLKQNSFNKLESSSGPVNLL 1000
            ++I+ +L+ +  Q+L   +E +F R        LL+ +  L ++NS        G  N L
Sbjct: 854  SRIDAFLAKMG-QILQDMSEEEFERHRTALCKTLLQRYKNLSEENSRFTTAIYIGDYNFL 912

Query: 1001 NE 1002
            N+
Sbjct: 913  NK 914

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  146 bits (368), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/402 (24%), Positives = 181/402 (45%), Gaps = 54/402 (13%)

Query: 7   INYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGL 66
           IN+++    P    +R ++  +LPN + ALLI                    DP++  GL
Sbjct: 46  INHKISFKKP-DLDDRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGL 104

Query: 67  AHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFE 126
           AH CEH++   GS ++PD   + + ++K+ G+ NAYT  + T +YF++ +    G     
Sbjct: 105 AHFCEHLLFM-GSSKFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQVNHEDLRG----- 158

Query: 127 FILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFS 186
             LD F+ FF +PLFN     KEI A+ SE++ N+ +     Y   +   +  HP+ +FS
Sbjct: 159 -ALDRFSGFFTSPLFNKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHPYHKFS 217

Query: 187 TGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIK 246
           TGN+ +L   P+ + +++++ L  ++   Y    + +C+ G + ++ +++     F D++
Sbjct: 218 TGNLKTLGETPKNQGLDIRDELLKFYNKFYSANIMKLCVLGREDLDTMSEWVYELFKDVR 277

Query: 247 PKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHP 306
                  NN S+   S                             +   +YK +K     
Sbjct: 278 ------NNNCSVPEYSI---------------------------PLLPAEYK-TKIIRAK 303

Query: 307 PGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSR 366
           P K+           +   F V D +  +  +     SH    L G E  GSL +YL  +
Sbjct: 304 PVKDL--------KKVEITFAVPDVDVHWESKPHHYLSH----LIGHEGSGSLLAYLKGQ 351

Query: 367 GWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIF 408
           GW  +  A     ++ N    +++ELTN+G +  +D+ +++F
Sbjct: 352 GWANELSAGAHTVSVNNAFFSVDIELTNNGLDHYQDVVSSVF 393

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 123/298 (41%), Gaps = 38/298 (12%)

Query: 690 YTYEIA----SSSKGNVTLRFTISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKAR 745
           Y  E+A    S SK N  L  ++ G++E +  +   F++ +K+             +  R
Sbjct: 607 YDAEVANLHVSFSKTNQGLDISLCGYNEKLTILLTRFLEGIKEFTPKLDRFKIFQDKLVR 666

Query: 746 ILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNP 805
            L    YE   S    +L+ I    ++ E  W+ ++++D   LT+  +F+          
Sbjct: 667 KLNNHLYEVPYS----QLSGI-FNSLINERSWSTKEKLD---LTKQLTFEHLKNFIPTIY 718

Query: 806 KRLV--LLIQGNL--EYADEINHYLN---NNFTQHLKVSNEDNRPTICLYPSPSTKNLDR 858
           ++L   +L+ GN   E A EIN  +     N  ++L+V N   R  I     P  K    
Sbjct: 719 EQLYYEILVHGNFSQEAATEINDLVKMMVPNDIKNLQVKNGKLRSYII----PQEK---- 770

Query: 859 GTNTFVSYNGHQDDPN-NSIVYFIQTAKRNDIESMTLTFLTEYLFSLTLVP---DLRNKK 914
              TF       D+ N NS    IQ   +  I S  L+  T  L  L   P    LR K+
Sbjct: 771 ---TFRMELPLADEKNVNSC---IQHVTQFGIYSEDLSAKTALLAQLIDEPCFDTLRTKE 824

Query: 915 QIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQVLNTFTESDFRR 972
           Q+GY+V         TV + + + S   +  LE++I+ +L      +L    E +F +
Sbjct: 825 QLGYVVFSSALSTHGTVNLRLLIQSERDSSYLESRIDSFLKKFG-NILREMPEEEFEK 881

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  144 bits (363), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 119/457 (26%), Positives = 205/457 (44%), Gaps = 71/457 (15%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R+++  +LPN + ALLI                    DP+   GLAH CEH++   GS+
Sbjct: 49  DRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHLLFM-GSE 107

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           ++PD   + + ++K+ G  NAYT  + T ++FE+      G       LD F+ FF  PL
Sbjct: 108 KFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEINYEHLKGA------LDRFSGFFSCPL 161

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ S     Y   + L+  DHP+ +FSTGN+ +L  IP+ K
Sbjct: 162 FNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPESK 221

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            +N+++ L  ++  NY    + +CI G + ++ L+    S F D+K  +           
Sbjct: 222 NVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDVKNIDK---------- 271

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                        +    D + L   ++ + V  E  K  +  E                
Sbjct: 272 -------------ELPFYDSKILNDDQLTKIVSVEPVKELRKLE---------------- 302

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
            + F+ P  D  T +  +   I SH    L G E  GSL S+L + GW  +  A     +
Sbjct: 303 -VSFVVP--DYETHWESKIPHILSH----LIGHEGNGSLLSHLKTLGWANELSAGGHTVS 355

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIFSKL------LPSFYVKNIDYLITFLKEQNLID 434
            GN    ++++LT +G ++ + +    F  +      LP  ++        +L+ QN+ +
Sbjct: 356 RGNAFFSIDIDLTENGLKNYEQVILLAFQYIEMLKNSLPQKWI--------YLELQNIAN 407

Query: 435 IARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVF 471
            A F ++   + P    S+LS +L++  EY+   N+ 
Sbjct: 408 -ANFKFKQKGN-PSSTVSSLSKLLEK--EYIPVGNIL 440

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  144 bits (363), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/388 (26%), Positives = 177/388 (45%), Gaps = 53/388 (13%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R+++  +LPN + ALLI                    DP++  GLAH CEH++   GS 
Sbjct: 44  DRSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEHLLFM-GSS 102

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           ++P+   + + ++K+ GS NAYT  + T +YF++      G       LD F+ FF  PL
Sbjct: 103 KFPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQVNYEHLYG------ALDRFSGFFTGPL 156

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ +     Y   + L N  HP+ +FSTGN+ +L + P+  
Sbjct: 157 FNKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKEL 216

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            +++++ L  ++  +Y    + +CI G + ++ + K     F D+K  +         RA
Sbjct: 217 GLDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDVKTLD---------RA 267

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                +R + +       DH + E  K+                HP       +   K  
Sbjct: 268 LPEYNTRILDA-------DHLQ-EIIKV----------------HP-------VKELKKV 296

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
            + F+ P  D +  +  +   I SH    L G E  GSL +YL ++GW  +  A     +
Sbjct: 297 EVSFVVP--DVDEHWESKPPHILSH----LIGHEGTGSLLAYLKTKGWANELSAGGHTVS 350

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIF 408
            GN    ++++LT+ G    +++   +F
Sbjct: 351 KGNAFFSVDIDLTDDGLAHYEEVVHNVF 378

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  143 bits (360), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 103/388 (26%), Positives = 171/388 (44%), Gaps = 53/388 (13%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R+++  +LPN + ALLI                    DP++  GLAH CEH++   GS+
Sbjct: 90  DRSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLFM-GSE 148

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           ++PD   + + ++K+ G  NAYT    T ++FE+ +   +G       LD F+ FF  PL
Sbjct: 149 KFPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEVNHEHLHG------ALDRFSGFFTGPL 202

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
            N     KEI A+ SE++ N+ +     Y   + ++N +HP+ +FSTGNI +L   P   
Sbjct: 203 MNADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKL 262

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            +N +N L  ++ ++Y    + +CI G Q ++ L+  A   F D+               
Sbjct: 263 GLNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDV--------------- 307

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                           KN ++ L  +   E + EE++        P       +   K  
Sbjct: 308 ----------------KNLNKALPQYN--ENILEEEHLKKIIKIIP-------VKDLKKL 342

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
            I F+ P  D +  +      + SH    L G E  GS+ SYL   GW     A     +
Sbjct: 343 EINFVVP--DMDLHWESRPHHVLSH----LIGHEGSGSILSYLKKLGWANDLSAGAHTVS 396

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIF 408
             N    + ++LT+ G E+ ++I   IF
Sbjct: 397 KDNAFFGINVDLTDKGLENYQEIALLIF 424

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 95/434 (21%), Positives = 173/434 (39%), Gaps = 52/434 (11%)

Query: 556 VDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSLKSKFATLRPQIQSEP 615
           V+    ++ Y   Y   ++P S I   D +N P  L   F +   +++F     +++ +P
Sbjct: 515 VETDSKEKWYGTEYQVVDYPKSFI---DQLNQP-GLNSEF-KLPRRNEFVATNFEVK-KP 568

Query: 616 TKRL-----PQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPSPEATIHLEVL 670
           T  L     P L+  N   ++W  K+D  +       VS ++      PS ++ I   +L
Sbjct: 569 TDELVPLDEPHLILDNDISKVWYKKDDRFWQPRGYIYVSMKL------PSCQSGIVNSLL 622

Query: 671 AQVLFIITSSYL----YPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAKTFVDTL 726
             +     + Y+    Y A         +S+++G   L  TISGF++ +  +   F++ +
Sbjct: 623 NGLYVDQINDYMKDLQYDASCANLNLSFSSTNQG---LDITISGFNDKLLVLLSRFIEGV 679

Query: 727 KKIATDATFLSKDTVRKARILVRRKYEG-ASSDNCVKLASIGLL--IVLEEYMWTLQDRI 783
           K        L + +  +  I   +  +   +S   V  + +G L   ++ E  W +++++
Sbjct: 680 K--------LYQPSEERFNIFKNKAIQNLKNSLFEVPYSQMGTLYNTIMNESTWPIKEKL 731

Query: 784 DALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEY--ADEINHYLNNNFT---QHLKVSN 838
           D LE      F  F    +N       L+ GN+ Y  A E N  L +  +    +L V N
Sbjct: 732 DVLEALTFDQFVSFVPSIYNE-FYFDALVHGNIRYEEAMEANDLLKSLASFKILNLHVRN 790

Query: 839 EDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLT 898
              R  I          +D            +D+ N+ I + +Q     + E   L+ L 
Sbjct: 791 SRLRSYILPEGESYRYEIDMED---------KDNLNSCIQHVVQLGLYTE-ELSALSGLF 840

Query: 899 EYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQ 958
             +        LR K+Q+GY+V         T  + I V S      LE +I+E+     
Sbjct: 841 AQMIREPCFDTLRTKEQLGYVVFSSNLNNHGTANMRILVQSEHSTSYLEWRIDEFYKKFG 900

Query: 959 LQVLNTFTESDFRR 972
            + LN  +E DF +
Sbjct: 901 -ESLNNMSEEDFEK 913

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/387 (26%), Positives = 175/387 (45%), Gaps = 53/387 (13%)

Query: 22  RTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSKQ 81
           R+++  +LPN + ALLI                    DP++  GLAH CEH++   GS++
Sbjct: 73  RSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENLPGLAHFCEHLLFM-GSEK 131

Query: 82  YPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPLF 141
           +PD   + + ++K+ GS NAYT  + T ++FE+ +    G       LD F+ FF  PLF
Sbjct: 132 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVNHQHLLG------ALDRFSGFFSCPLF 185

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLKK 201
                 KEI A+ SE++ N+ +     Y   + L NS HP+ +FSTGNI +L   P+   
Sbjct: 186 QKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHPYHKFSTGNIETLGESPKENG 245

Query: 202 INLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRAG 261
           +N+++ L  + K+ Y    + +CI G + ++ L++     F D+                
Sbjct: 246 LNIRDELLKFHKHFYSANIMKLCILGREDLDTLSEWTYDLFKDV---------------- 289

Query: 262 SFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSPV 321
                           N+ R++  +   E++ + ++   K  +  P K+           
Sbjct: 290 ---------------SNNDREVPYYP--ESIMQPEHLQ-KIIQVNPVKDL--------KK 323

Query: 322 IRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFAI 381
           +   F V D    +  +  +I SH    L G E  GSL ++L   GW  +  A     + 
Sbjct: 324 LEISFTVPDMEEHWKSKPPRILSH----LIGHEGSGSLLAHLKELGWANELSAGGHTVSK 379

Query: 382 GNIGLMLELELTNSGWESIKDITTTIF 408
           GN    ++++LT++G    +D+   IF
Sbjct: 380 GNAFFAVDIDLTDNGLTHYRDVIVLIF 406

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 123/326 (37%), Gaps = 51/326 (15%)

Query: 663 ATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAKTF 722
           +T++++++   L  +        LR+ +        K N  L  T SGF+E +  +   F
Sbjct: 604 STLYIQMINDALKDLQYDAACADLRISFV-------KTNQGLDITASGFNEKLIVLLTRF 656

Query: 723 VDTLKKIATDAT---FLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTL 779
           +  +            L   T+R  + L+   YE   S       S+     + E  W+ 
Sbjct: 657 LQGVVSFEPKKDRFEILKDKTIRHLKNLL---YEVPYSQMSNYYNSL-----INERSWST 708

Query: 780 QDRIDALE---LTETSSFKEFCY--LFWNNPKRLVLLIQGNLEY-----ADEINHYLNNN 829
            +++   E     + +SF    Y  +F+        L+ GN+++      D +   L  N
Sbjct: 709 AEKLQVFEKLTFEQLNSFIPTIYEGVFFET------LVHGNIKHEEAIEVDSLIKSLIAN 762

Query: 830 FTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDI 889
              +L+VSN  NR    L P   +            Y     DP N +   IQ   + D+
Sbjct: 763 NIDNLQVSN--NRLRSYLLPKGKS----------FRYETDLKDPKN-VNSCIQHVTQLDV 809

Query: 890 ESMTLTFLTEYLFSLTLVP---DLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNL 946
            S  L+ L+     L   P    LR K+Q+GY+V         T  I I + S      L
Sbjct: 810 YSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYL 869

Query: 947 ENKINEYLSYLQLQVLNTFTESDFRR 972
           E +IN +      Q L   T+ DF +
Sbjct: 870 EWRINNFYETFG-QHLKDMTQEDFDK 894

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 106/391 (27%), Positives = 175/391 (44%), Gaps = 61/391 (15%)

Query: 22  RTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSKQ 81
           R+++  +LPN + ALLI                    DP+   GLAH CEH++   GS++
Sbjct: 72  RSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEHLLFM-GSEK 130

Query: 82  YPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPLF 141
           +PD   + + ++K+ GS NAYT  + T ++FE+     N +  F+  LD F+ FF  PLF
Sbjct: 131 FPDENEYSSFLSKHGGSSNAYTASQNTNYFFEV-----NHQHLFD-ALDRFSGFFSCPLF 184

Query: 142 NPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLKK 201
           N     KEI A+ SE++ N+ +     Y   + L N+ HP+ +FSTGNI +L + P+   
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPKENG 244

Query: 202 INLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRAG 261
           +N+++ L  + K+ Y    + +CI G + ++ L+      F ++    S  G      A 
Sbjct: 245 LNIRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVYDLFKNV----SNNGREVPYYAE 300

Query: 262 SFRRSRSVKSTGDFSK-NDHRKLE-SFKI--LETVWEEKYKNSKCFEHPPGKNTIFINSN 317
              +   ++         D +KLE SF +  +E  WE +         PP          
Sbjct: 301 PIMQPEHLQKIIQVRPVKDLKKLEISFAVPDMEEHWESR---------PP---------- 341

Query: 318 KSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTS 377
                                  +I SH    L G E  GSL ++L   GW  +  A   
Sbjct: 342 -----------------------RILSH----LIGHEGSGSLLAHLKKLGWANELSAGGH 374

Query: 378 EFAIGNIGLMLELELTNSGWESIKDITTTIF 408
             + GN    ++++LT++G    +D+   IF
Sbjct: 375 TVSKGNAFFAVDIDLTDNGLIHYRDVIILIF 405

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 41/95 (43%), Gaps = 4/95 (4%)

Query: 881 IQTAKRNDIESMTLTFLTEYLFSLTLVP---DLRNKKQIGYIVLGGLRVLTETVGIHITV 937
           IQ   + D+ S  L+ L+     L   P    LR K+Q+GY+V         T  I I +
Sbjct: 800 IQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILI 859

Query: 938 MSGGPAHNLENKINEYLSYLQLQVLNTFTESDFRR 972
            S      LE +IN +      Q+L   T+ DF +
Sbjct: 860 QSEHTTPYLEWRINNFYETFG-QILRDMTKEDFEK 893

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  139 bits (351), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 117/440 (26%), Positives = 197/440 (44%), Gaps = 57/440 (12%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R ++  +LPN +  LL+                    DP+D  GLAH CEH++   GSK
Sbjct: 66  DRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHLLFM-GSK 124

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           ++P+   + + ++K+ G+ NAYT  + T +YF +     N E  ++  LD F+ FF  PL
Sbjct: 125 KFPNENEYASFLSKHGGASNAYTASQNTNYYFHV-----NHENLYD-ALDRFSGFFSCPL 178

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ +     Y   + L N  HP+ +FSTGN  +L SIP+ K
Sbjct: 179 FNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSK 238

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            +N+++ L  ++  +Y    + + I G + ++ LA+ A   F D+ P +  +   +  +A
Sbjct: 239 GVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDV-PNHGTKVPEYHAQA 297

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                         F+     K+   K                   P KN       KS 
Sbjct: 298 --------------FTPEHLMKVIKVK-------------------PVKNL------KSV 318

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
            I F+ P  DK+  +  +  +  SH    L G E   SL +YL +  W     A  +  +
Sbjct: 319 EISFVVPDMDKH--WQVKPARYLSH----LIGHEGTDSLLAYLKNNSWAIDLSAGATTVS 372

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLITFLKEQNLIDIARFLY 440
            GN    + ++LT+ G    + +   +F  +     V   +++ T LK+   I  A F +
Sbjct: 373 EGNAYFSVNVDLTDEGVVQYEAVICAVFQYINMLKEVLPQEWVFTELKD---IGEAHFKF 429

Query: 441 QSSEDIPMEECSNLSTILQE 460
           +   + P    S+LS  LQ+
Sbjct: 430 KQKGN-PAATVSSLSKNLQK 448

 Score = 33.5 bits (75), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 61/296 (20%), Positives = 125/296 (42%), Gaps = 26/296 (8%)

Query: 666 HLEVLAQVLFIITSSYLYPALR-VGYTYEIA----SSSKGNVTLRFTISGFSEGVYTIAK 720
           H  ++  +L  +   ++  +L+ + Y  E A    S  K N  L  ++SG+++ +  +  
Sbjct: 590 HSSIVNSMLCTLYVDHINDSLKDLAYNAECAGLEISLRKTNQGLDLSLSGYNDKLLVLLA 649

Query: 721 TFVDTLKKIATDATFLSKD--TVRKARILVRRKYEGASSDNCVKLASIGLLI--VLEEYM 776
            F + ++K+     FL ++   V K R++  +K      D       IG L   ++ E  
Sbjct: 650 RFFEGIQKL-----FLREERFMVLKQRLI--QKLHNHLYD--TPYTQIGRLYSSLINERS 700

Query: 777 WTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHY-LNNNFTQHLK 835
           WT Q+++D  E         F    +       LL+ GN  + + +  Y L ++   +  
Sbjct: 701 WTTQEKLDITEQLTFDHLANFVPTIYEQ-MYFELLVHGNFSHEEALEVYDLVSSLVPNEI 759

Query: 836 VSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLT 895
            ++E     +  Y  P+      G   + +    +++ N+ I   IQ    +++ S   +
Sbjct: 760 RNSEGRNSKLRSYFIPAG-----GAYHYETALADKENVNSCIQKVIQLGAYSELLSAKGS 814

Query: 896 FLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKIN 951
            L + + +      LR ++Q+GY+V         TV + I V S   +  LE++I+
Sbjct: 815 LLAQ-MVNEPCFNTLRTEEQLGYVVFSSKLNTHGTVNLRILVQSERSSSYLESRID 869

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  139 bits (349), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/409 (24%), Positives = 182/409 (44%), Gaps = 68/409 (16%)

Query: 7   INYEVPIYIPLSYSNRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGL 66
           I++ V    PL   +R ++  +LPN + ALLI                    DP+D  GL
Sbjct: 42  IDHGVKFTKPL-LDDRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGL 100

Query: 67  AHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFE 126
           AH CEH++   GS ++P+   + + ++K+ G  NAYT+   T ++F++     +G     
Sbjct: 101 AHFCEHLLFM-GSSKFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQVNQESLHG----- 154

Query: 127 FILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFS 186
             L  F+ FF  PLFN     KEI A+ SE++ N+ S     Y   +  +N +HPF +FS
Sbjct: 155 -ALLRFSGFFSCPLFNKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHPFHKFS 213

Query: 187 TGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIK 246
           TGN+ +L  IP+ K +++++ L  ++ ++Y    + +C+ G + ++ +++     F D+ 
Sbjct: 214 TGNLKTLGDIPKSKDVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDLFKDV- 272

Query: 247 PKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESF--KILETVWEEKYKNSKCFE 304
                                          N  R + ++  K+L               
Sbjct: 273 ------------------------------PNSDRPVPTYEAKML--------------- 287

Query: 305 HPPGKNTIFINSNKSPV-----IRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSL 359
            PP   T  IN+   PV     +   F   D + ++  +     SH    L G E  GSL
Sbjct: 288 -PPQYLTQIINAK--PVKDLKKVEITFVAPDVDEQWDSKPGHYLSH----LIGHEGSGSL 340

Query: 360 GSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIF 408
            +YL  +GW  +  A +   +  N    ++++LT+ G ++ + +  ++F
Sbjct: 341 LAYLKLKGWANELSAGSHTVSEDNAFFSVDIDLTDEGVKNYESVIQSVF 389

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 74/369 (20%), Positives = 144/369 (39%), Gaps = 38/369 (10%)

Query: 614 EPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGL--GIKPSPEATIHLEVLA 671
           EP +  P L+ ++   ++W  K+D  ++      VS ++      +  S   T+++E++ 
Sbjct: 537 EPLQE-PLLLKQDRQSKVWYKKDDRFWVPKGHIYVSMKLAHTYSSVVNSMLTTLYVELIN 595

Query: 672 QVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIAKTFVDTLKKI-- 729
             L  +       +L + +        K N  L  ++SG++E +  + K +++ +     
Sbjct: 596 DYLKDLEYDAQVASLHISF-------RKTNQGLDLSLSGYNEKMAILLKRYLEGIANFQP 648

Query: 730 ATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTLQDRIDALELT 789
           A D   + +D + +   L    YE   S       S     V+ E  WT+ ++++ ++  
Sbjct: 649 AEDRFKIYQDKLLQK--LNNHLYEVPYSQVSDVFNS-----VINERAWTIANKLEVVKQL 701

Query: 790 ETSSFKEFCYLFWNNPKRLVLLIQGNLEY-----ADEINHYLNNNFTQHLKVSNEDNRPT 844
           +    K F    +       +L+ GN        AD +   L     Q+ ++ +  ++P 
Sbjct: 702 KFEHLKLFIPAIFEQ-FSFEILVHGNFSCEAALEADNLVRALAPRDVQNFQLKS--SKPR 758

Query: 845 ICLYPSPSTKNLDRGTNTFVSYNGHQDDPN-NSIVYFIQTAKRNDIESMTLTFLTEYLFS 903
             L P            TF       DD N NS +  +        E      L   L  
Sbjct: 759 SVLLPQ---------GKTFCYQQMLADDKNINSCIQHVTQFGSYSEELSAKASLFAQLID 809

Query: 904 LTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQLQVLN 963
                 LR K+Q+GY+V         TV + + + S      LE++I+ +L  +  QVL 
Sbjct: 810 EPAFDTLRTKEQLGYVVFSSALNTHGTVNLRLLIQSERDTAYLESRIDAFLVKMG-QVLQ 868

Query: 964 TFTESDFRR 972
             ++ +F R
Sbjct: 869 EMSDEEFER 877

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  138 bits (348), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/226 (31%), Positives = 121/226 (53%), Gaps = 7/226 (3%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R ++  +LPN + AL+I                    DP++  GLAH CEH++   GS+
Sbjct: 60  DRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPGLAHFCEHLLFM-GSE 118

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           ++PD   + + ++K+ GS NAYT  + T ++FE+     +G       LD F+ FF  PL
Sbjct: 119 KFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEVNADHLHG------ALDRFSGFFSCPL 172

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI A+ SE++ N+ +     Y   + L+N DHP+ +FSTGN+ +L   P+  
Sbjct: 173 FNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFSTGNLETLGDKPKAA 232

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIK 246
            ++++  L  ++  NY    + +CI G + ++ L++ A   F D+K
Sbjct: 233 GLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDVK 278

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 46/90 (51%), Gaps = 6/90 (6%)

Query: 322 IRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFAI 381
           I F+ P  +K     K + KI SH++  L G E  GSL ++L S GW  +  A     + 
Sbjct: 314 ISFVVPDYEK-----KWEAKI-SHIFSHLIGHEGSGSLLAHLKSLGWANELGAGGHTVSD 367

Query: 382 GNIGLMLELELTNSGWESIKDITTTIFSKL 411
           GN    +++ELTN G +  KDI   IF  L
Sbjct: 368 GNAFFNVDIELTNEGLKHYKDIVVLIFQYL 397

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  132 bits (331), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 114/465 (24%), Positives = 202/465 (43%), Gaps = 61/465 (13%)

Query: 21  NRTHKICKLPNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           +R ++  +LPN +   LI                    DP+D  GLAH CEH++   GS+
Sbjct: 77  DRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHLLFM-GSE 135

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
           ++P+   + + ++ + G+ NAYT+ + T +YF + +            LD F+ FF +PL
Sbjct: 136 KFPNENEYSSYLSHHGGASNAYTSTQNTNYYFMVNHGNLYD------ALDRFSGFFTSPL 189

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           F+    +KE+ A+ SE++ N+ S         R L N  HPF +FSTGN  +L   P+ +
Sbjct: 190 FSVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSR 249

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            I ++  L  ++   Y    + + I G + ++ L+  A   F D+ P   ++ + ++ + 
Sbjct: 250 GIEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDV-PDKGIDVHEYNAK- 307

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKCFEHPPGKNTIFINSNKSP 320
                                          V+   Y  +K  +  P K+          
Sbjct: 308 -------------------------------VFTPTYL-TKIIKAKPIKDL--------K 327

Query: 321 VIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFTSEFA 380
            +   F V D  T +        SH    L G ES  SL SYL+S+ W T+ +      +
Sbjct: 328 RVEVSFDVPDTETFWDSRPADYISH----LIGHESSNSLLSYLISQSWATELYCGAQTVS 383

Query: 381 IGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLITFLKEQNLIDIARFLY 440
            GN    + +ELT+ G +  +++  T+F  +      K++     F+ E N I  ++F +
Sbjct: 384 KGNAYFCIHIELTDKGVQDYEEVVYTVFQYI--EMLKKSLPQERIFV-ELNKIGESKFRF 440

Query: 441 QSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEIDDPNI 485
           +  +  P    S+L+  LQ+  ++L P  +F    SLI    P +
Sbjct: 441 K-QKGSPSNTVSSLAKNLQK--DFLPPEIIFNA--SLIRKFKPEL 480

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  107 bits (268), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 211/969 (21%), Positives = 372/969 (38%), Gaps = 185/969 (19%)

Query: 22  RTHKICKL-PNGILALLIXXXXXXXXXXXXXXXXXXHNDPKDTLGLAHLCEHMILAAGSK 80
           R ++  KL  N + AL+I                    DP +  GLAH CEH+ L  GSK
Sbjct: 39  RNYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEHL-LFMGSK 97

Query: 81  QYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFILDVFASFFKNPL 140
            +P+   + + + +N G  NAYT    T ++FE+     N    FE  L  F+ FFK PL
Sbjct: 98  NFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFEI-----NHANLFE-ALRRFSCFFKTPL 151

Query: 141 FNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTGNIHSLSSIPQLK 200
           FN     KEI+AI SE++ N+ +     Y   + L+N +HP+ +FSTG+  +L    +  
Sbjct: 152 FNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHKFSTGSKLTLLENTETL 211

Query: 201 KINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPKNSVEGNNFSIRA 260
            +N++  L  ++   Y    + +CI G + +  L++ A   F ++  KN +    FS   
Sbjct: 212 NLNIREELIKFYNKWYSSNIMNLCIIGREDLGTLSRWAKILFENVPNKNVILP-TFSQPV 270

Query: 261 GSFRRSRSVKSTGDFSKNDHRKLE-SFKILE---TVWEEKYKNSKCFEHPPGKNTIFINS 316
            +    + V S       D ++LE +F I E   T W+ K         P          
Sbjct: 271 WTIADKKKVISVKPVK--DLKQLELTFHIKEDELTTWKSK---------P---------- 309

Query: 317 NKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVSRGWITKCFAFT 376
                                      S++   LFG +  GS+ S L ++  IT   + +
Sbjct: 310 ---------------------------SYILSHLFGHKGNGSISSLLKNQQLITGISSGS 342

Query: 377 SEFAIGNIGLMLELELTNSGWESIKDITTTIFSKL------LPSFYVKNIDYLITFLKEQ 430
              +  N    L  +LT  G    + I   +F  +      LP  ++ N         E 
Sbjct: 343 ENISKENSLFSLNFDLTEDGINQYEKIIKIVFQYIKMLNSNLPQEWIYN---------EL 393

Query: 431 NLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEIDDPNIDKYEN 490
             I    F Y+   + P    S LS  +++      P N     +   E D   ++KY  
Sbjct: 394 KGISDNSFKYKQKIN-PASTVSQLSKRMEKT---FIPINNILSHELFYEYDPQQLNKY-- 447

Query: 491 SEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSEMYTDXXXXXX 550
                       +KF       +  +N+R++++      +  + + K  + Y        
Sbjct: 448 ------------LKF-------LTPDNSRIMLVS-----KNLNGLHKSEKWYGTKYGVKD 483

Query: 551 XXTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECSLKSKFATLRPQ 610
              G +     D S  K   E   P  N F+                CS+K        +
Sbjct: 484 YPDGLL----KDLSNIKENSELYLPHKNEFIST-------------TCSVK--------K 518

Query: 611 IQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKPSPEATIHLEVL 670
           +++   +  P L+  +   ++W  K+D  ++      VS ++        P    H  ++
Sbjct: 519 VENHVAQIEPYLLKDDNISKLWYKKDDTFWLPRATIFVSIKL--------PHT--HSSLV 568

Query: 671 AQVLFIITSSYLYPALRVGYTYEIASS-----SKGNVTLRFTISGFSEGVYTIAKTFVDT 725
           A VL     + +  AL+    Y   +      +K N  L  T++G ++ +  + K +++ 
Sbjct: 569 ANVLTSFYINLVNDALQDLRCYAACADLYVSLNKTNQGLDLTLTGLNDKLLILLKRYLEG 628

Query: 726 LKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLI--VLEEYMWTLQDRI 783
           +K    +         +  + L  R Y+       V    +G +   ++ E  W++++ +
Sbjct: 629 IKSFVPNEERFEVIKKQTIQSLTNRLYD-------VPYIQMGDIYSSLINERSWSVEENL 681

Query: 784 DALELTETSSFKEFCYLFWNNPKRLVL--LIQGNLEY--ADEINHYLNN---NFTQHLKV 836
             ++  +    ++F    +   + L    L  GN++Y  A E++  +     N  ++ +V
Sbjct: 682 KVVQDIDFPQLQDFIPTIY---QELFFETLAFGNIQYEQAQEVDSLVRTLIPNTIKNSQV 738

Query: 837 SNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNN---SIVYFIQTAKRNDIESMT 893
            N+  R  I     PS K       TF  Y   Q D NN    I Y  Q    ++  +  
Sbjct: 739 KNDRLRSYII----PSGK-------TF-KYEVFQKDKNNLNTCIQYICQFGIYSEYLAAV 786

Query: 894 LTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNL----ENK 949
           ++ L + +        LR K+Q+GYIV         T  + I V S      L    EN 
Sbjct: 787 VSLLAQIMHE-PCFNTLRTKEQLGYIVFSSSLSNHGTCNLSIMVQSEYSTDYLQFRIENF 845

Query: 950 INEYLSYLQ 958
           + ++LSYL+
Sbjct: 846 LKDFLSYLK 854

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 77/188 (40%), Gaps = 27/188 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYF-----ELPNSQ 118
           G AH  EH+    G+K     G+   L  +N GS  NAYT+ E T +Y      ++P + 
Sbjct: 70  GTAHFLEHLAFK-GTKNRSQRGI--ELEIENIGSHLNAYTSRENTVYYAKSLREDIPKA- 125

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +      + +P  I +E   I  E E       ++ +     +A  
Sbjct: 126 ----------VDILSDILTKSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYR 175

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D P  R   G I ++ SI   K+ +L+N    Y   NY G+ + +   G    + L   A
Sbjct: 176 DQPLGRTILGPIKNIKSI---KRTDLQN----YIMTNYKGDRMVLASAGSVDHDNLVAYA 228

Query: 239 ISKFGDIK 246
              FG +K
Sbjct: 229 QKYFGHLK 236

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 74/183 (40%), Gaps = 17/183 (9%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFELPNSQSNGEF 123
           G AH  EH+    G++     G+   L  +N GS  NAYT+ E T +Y +      + E 
Sbjct: 66  GTAHFLEHLAFK-GTQNRTQTGI--ELEIENIGSHLNAYTSRENTVYYAK------SLEN 116

Query: 124 AFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFS 183
                +D+ +      + +P  I +E   I  E E       ++ +     +   D P  
Sbjct: 117 DIPQAVDILSDILTRSVLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHAIVYQDQPLG 176

Query: 184 RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFG 243
           R   G I ++ +I        ++ L AY   NY G+ + +   G    + L   A + FG
Sbjct: 177 RTILGPIKNIKTIQ-------RDDLQAYISKNYSGDRMVLVGAGAVDHHKLVDYAQTYFG 229

Query: 244 DIK 246
            I+
Sbjct: 230 HIR 232

>CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098c
          Length = 1021

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H  EH+I   GSK+YP  GL  TL      S NA+T  +QT +        S
Sbjct: 53  PNDS-GVPHTLEHLIFM-GSKKYPYKGLLDTLGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F+ +L V+     NP         E+Y I  +
Sbjct: 106 AGWQGFKKLLPVYLDHLLNPTLTDEACVTEVYHIDPQ 142

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 74/187 (39%), Gaps = 27/187 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYF-----ELPNSQ 118
           G AH  EH+    G++     G+   L  +N GS  NAYT+ E T +Y      ++P + 
Sbjct: 66  GTAHFLEHLAFK-GTQNRSQKGI--ELEIENIGSHLNAYTSRENTVYYAKSLKEDIPKA- 121

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +      + +P  I +E   I  E E       ++ +     +   
Sbjct: 122 ----------VDILSDILTKSVLDPRAIERERDVIIRESEEVDKMHDEVVFDHLHAITYK 171

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D P  R   G I ++ SI        +N L  Y   NY G+ + +   G  + + L + A
Sbjct: 172 DQPLGRTILGPIKNIKSI-------TRNDLREYITKNYKGDRMVLAGAGAVNHDELVEYA 224

Query: 239 ISKFGDI 245
              FG +
Sbjct: 225 QKYFGHL 231

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 75/192 (39%), Gaps = 27/192 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYF-----ELPNSQ 118
           G AH  EH+    G+K     G+   L  +N GS  NAYT+ E T +Y      ++P + 
Sbjct: 68  GTAHFLEHLAFK-GTKNRSQKGI--ELEIENIGSHLNAYTSRENTVYYAKSLKEDIPKA- 123

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +      + +P  I +E   I  E E       ++ +     +   
Sbjct: 124 ----------VDILSDILTRSVLDPEAIERERDVIIRESEEVDKMYDEVVFDHLHEVTYK 173

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D P  R   G I ++ SI        ++ L+ Y  +NY G+ + +   G      L + A
Sbjct: 174 DQPLGRTILGPIKNIQSI-------TRDDLSKYITDNYKGDRMVLAGAGAVDHEKLVEYA 226

Query: 239 ISKFGDIKPKNS 250
              FG +    S
Sbjct: 227 QRCFGHLGKSTS 238

>Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL098C
           - Hypothetical ORF [contig 184] FULL
          Length = 1040

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H  EH+I   GSK+YP  GL  T       S NA+T  +QT +        S
Sbjct: 53  PTDS-GVPHTLEHLIFM-GSKKYPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F+ +L V+     +P  +    + E+Y +  E
Sbjct: 106 AGWLGFKNLLPVYLDHVLHPTISDHACTTEVYHVDPE 142

>AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL098C
          Length = 1029

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 93/231 (40%), Gaps = 16/231 (6%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFA 124
           G+ H  EH+I   GS++YP  GL  T       + NAYT  + T +        S G   
Sbjct: 57  GVPHTLEHLIFM-GSQRYPRKGLLDTAGGITMSTTNAYTASDHTAYEL-----VSAGWLG 110

Query: 125 FEFILDVFASFFKNPLFNPLLISKEIYAIQSE---HEGNISSTTKIFYHAARLLANSDHP 181
           F+ +L V+     +P       + E+Y +       +G + S  +   H +  +A  +  
Sbjct: 111 FKKLLPVYLDHLLHPTLTEHAFTTEVYHLDPNDLTDKGVVYSEMEAREHESSDVAILEKG 170

Query: 182 FSRFSTGNIHSLSSIPQLKK--INLKNS-LNAYFKNNYFGENITICIRGPQSVNILAKLA 238
              F  GN +  S +  L K    L N+ + A+    Y  +NI + I G    + L ++ 
Sbjct: 171 RQMFPEGNGYR-SEVGGLTKHLRTLTNAEVRAFHAEMYTPDNICLVICGNVPEHELLQIV 229

Query: 239 ISKFGDIKPKNSVEGNNFSIRAGSF---RRSRSVKSTGDFSKNDHRKLESF 286
                ++  K       F   A S    R  +S++ST  F + D  + E +
Sbjct: 230 EEFDAELPEKTGPRRRPFVDSASSQIPPRLPKSIESTVPFPELDESRGEIY 280

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 76/191 (39%), Gaps = 28/191 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYF-----ELPNSQ 118
           G AH  EH+    G+K    +G+   L  +N GS  NAYT+ E T +Y      ++P + 
Sbjct: 61  GTAHFLEHLAFK-GTKDRTQSGI--ELEIENIGSHLNAYTSRENTVYYAKSLRDDIPRA- 116

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +      + +P  I +E   I  E E       ++ +     +A  
Sbjct: 117 ----------VDILSDILTRSVLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYK 166

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D    R   G + ++ SI        +  L  Y   NY G+ + +   G    + L K A
Sbjct: 167 DQSLGRTILGPVKNIKSI-------TRKDLKDYITKNYKGDRMVLAGAGAVDHDDLVKQA 219

Query: 239 ISKFGDIKPKN 249
              FG I PK+
Sbjct: 220 ERFFGHI-PKS 229

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 76/193 (39%), Gaps = 28/193 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFE-----LPNSQ 118
           G AH  EH+    G+K     G+   +  +N GS  NAYT+ E T +Y +     +PN+ 
Sbjct: 63  GTAHFLEHLAFK-GTKNRTQVGIEMEI--ENIGSHLNAYTSRENTVYYAKTLTQNIPNA- 118

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +      + +   I +E   I  E E       ++ +     +   
Sbjct: 119 ----------VDILSDILTKSVLDTNAIERERDVIIRESEEVDKMYDEVVFDHLHAITYK 168

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D P  R   G I ++ +I Q         L  Y   NY G+ + +   G    + L + A
Sbjct: 169 DQPLGRTILGPIKNIKTIQQ-------RDLREYISTNYKGDRMVLAGAGDVDHDKLVEYA 221

Query: 239 ISKFGDIKPKNSV 251
              FG I PK+ +
Sbjct: 222 GKYFGHI-PKSEI 233

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 77/203 (37%), Gaps = 17/203 (8%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFELPNSQSNGEF 123
           G AH  EH+     SK+         L  +N GS  NAYT+ E T +Y +          
Sbjct: 68  GTAHFLEHLAFKGTSKRSQKQ---IELDIENIGSHLNAYTSRENTVYYAKTLKEN----- 119

Query: 124 AFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFS 183
                +D+ +    N       I +E   I  E E       ++ +     +A  D P  
Sbjct: 120 -LPLAVDILSDILTNSKLEKNAIERERDVIVRESEEVDKMYDEVVFDHLHEIAYKDQPLG 178

Query: 184 RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFG 243
           R   G I ++ SI        ++ L  Y  +NY G+ + +   G  +   L KLA   FG
Sbjct: 179 RTILGPIKNIKSIN-------RSDLVHYITSNYKGDRMVLAGAGDINHQDLIKLAEKYFG 231

Query: 244 DIKPKNSVEGNNFSIRAGSFRRS 266
            +   +S   NN + +   F R 
Sbjct: 232 HLPKGSSSLVNNMNDQLPVFTRG 254

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 74/191 (38%), Gaps = 28/191 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFE-----LPNSQ 118
           G AH  EH+    G+K     G+   L  +N GS  NAYT+ E T +Y +     +PN+ 
Sbjct: 63  GTAHFLEHLAFK-GTKNRTQVGI--ELEIENIGSHLNAYTSRENTVYYAKTLTQNIPNA- 118

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +DV +      + +   I +E   I  E E       ++ +     +   
Sbjct: 119 ----------VDVLSDILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFDHLHAITYK 168

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D P  R   G I ++ +I        +  L  Y   NY G+ + +   G      L + A
Sbjct: 169 DQPLGRTILGPIENIKTIQ-------RRDLQDYISKNYKGDRMVLAGAGAVDHEKLVEYA 221

Query: 239 ISKFGDIKPKN 249
              FG I PK+
Sbjct: 222 DKYFGHI-PKS 231

>SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1069

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H  EH+I   GS+++P  GL  T       S NA+T  +QT +        S
Sbjct: 82  PTDS-GVPHTLEHLIFM-GSRKFPFKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TS 134

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F+ +L V+     NP         E+Y +  E
Sbjct: 135 AGWLGFKKLLPVYLDHVLNPTLTDEACCTEVYHVDPE 171

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 75/193 (38%), Gaps = 29/193 (15%)

Query: 65  GLAHLCEHMIL-AAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFE-----LPNS 117
           G AH  EH+      ++   D      L+ +N GS  NAYT+ E T +Y +     +PN+
Sbjct: 101 GTAHFLEHLAFKGTTTRSQRDI----ELVIENLGSHLNAYTSRENTVYYAKTLKDNIPNA 156

Query: 118 QSNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLAN 177
                      +D+ +        +   I +E   I  E E       ++ +     +  
Sbjct: 157 -----------IDILSDILTKSTLDKNAIERERSVIIRESEEVDQMYDEVVFDHLHEIVY 205

Query: 178 SDHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKL 237
            D P  R   G I ++++I        +N L  Y   NY G+ + +   G  +   L K 
Sbjct: 206 KDQPLGRTILGPIKNINTIQ-------RNDLQNYITTNYKGDRMVLAGAGDVNHEELVKY 258

Query: 238 AISKFGDIKPKNS 250
           A   FG +K  +S
Sbjct: 259 AEKYFGHVKKSDS 271

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 74/187 (39%), Gaps = 17/187 (9%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFELPNSQSNGEF 123
           G AH  EH+       +   A     L  +N GS  NAYT+ E T +Y +  + Q++   
Sbjct: 66  GTAHFLEHLAFKGTENRSQRA---IELEIENIGSHLNAYTSRENTVYYAK--SLQNDIPK 120

Query: 124 AFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFS 183
           A E + D+          +P  I +E   I  E E       ++ +     +A  D P  
Sbjct: 121 AVEILSDILT----KSTLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHDIAYKDQPLG 176

Query: 184 RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFG 243
           R   G I ++ SI        +  L +Y   NY G+ + +   G    + L   A   FG
Sbjct: 177 RTILGPIKNIKSIS-------RTDLKSYINKNYKGDRMVLAGAGAVDHDNLVTYAQKYFG 229

Query: 244 DIKPKNS 250
            ++  +S
Sbjct: 230 HLQKSDS 236

>NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]
           {ON} Anc_3.93
          Length = 1032

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H  EH+I   GSKQ+P  GL  T+      S NA+T  +QT +        S
Sbjct: 53  PNDS-GVPHTLEHLIFM-GSKQHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F  IL  + +    P       + E+Y +  E
Sbjct: 106 AGWKGFSKILPAYLNHILFPTLTDDACTTEVYHVDPE 142

>KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1042

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H  EH+I   GSK++P  GL  T       S NA+T  +QT +        S
Sbjct: 53  PTDS-GVPHTLEHLIFM-GSKKFPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F+ +L V+     +P       + E+Y +  E
Sbjct: 106 AGWQGFKKLLPVYLDHVLHPTITDDACTTEVYHVDPE 142

>Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} similar
           to Ashbya gossypii AFR334W
          Length = 1032

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 68/169 (40%), Gaps = 13/169 (7%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFA 124
           G  H  EH+I   GSK+YP  GL          + NA+T  +QT +        S G   
Sbjct: 57  GAPHTLEHLIFM-GSKKYPWKGLLDISGGITMSNTNAWTATDQTVYSL-----TSAGWVG 110

Query: 125 FEFILDVFASFFKNPLFNPLLISKEIYAIQSE---HEGNISSTTKIFYHAARLLANSDHP 181
           F+ +L V+     NP       + E+Y I  +    +G + S  +    AA  + N +  
Sbjct: 111 FKKLLLVYLDHIVNPRLTDEACTTEVYYIDPKDLVDKGVVYSEMEGIESAAYSITNLEVQ 170

Query: 182 FSRFSTGNIHSLSS---IPQLKKINLKNSLNAYFKNNYFGENITICIRG 227
              F  GN +   +      L+K++    +  +    Y  +N+ + I G
Sbjct: 171 RLMFPEGNAYRSETGGLTKNLRKLS-NEEIRKFHAEKYSPDNLCLIICG 218

>TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 80/199 (40%), Gaps = 25/199 (12%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G  H  EH+I   GS+Q+P  GL  T       S NA+T  +QT +        S
Sbjct: 53  PTDS-GAPHTLEHLIFM-GSQQHPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQ-----------SEHEGNISSTTKIF 168
            G   F+ +L  +     NP         E+Y +            SE +   S +  + 
Sbjct: 106 AGWQGFKQLLPAYLDHILNPTLTDAACLTEVYHVDPDDLSDKGVVFSEMDAIESQSWFVT 165

Query: 169 YHAARLLANSDHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGP 228
               + L   +    R  TG +      P L++I+  + +  + K+ Y  +N+ + + G 
Sbjct: 166 MLEKQRLMFPEGSGYRSETGGL-----TPNLRQIS-NDEIRKFHKDAYSPDNLCLIVSGN 219

Query: 229 QSVNILAKLAISKFGDIKP 247
              + L K+ + ++ D  P
Sbjct: 220 VPEDELLKI-VQEWDDTLP 237

>TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3.93
           YOL098C
          Length = 1038

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFA 124
           G+ H  EH+I   GS +YP  GL  T+      S NA+T  +QT +        S G   
Sbjct: 57  GVPHTLEHLIFM-GSPKYPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TSAGWTG 110

Query: 125 FEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
           F+ +L ++     NP         E+Y I  +
Sbjct: 111 FKKLLPMYLEHIINPTLTDDAYVTEVYHIDPD 142

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 69/188 (36%), Gaps = 27/188 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYF-----ELPNSQ 118
           G AH  EH+    G+      G+   L  +N GS  NAYT+ E T +Y      ++P + 
Sbjct: 66  GTAHFLEHLAFK-GTTNRSQVGI--ELEIENIGSHLNAYTSRENTVYYAKSLKEDIPKA- 121

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +        NP  I +E   I  E E       ++ +     +   
Sbjct: 122 ----------MDILSDILTRSTLNPKAIERERDVIIRESEEVDKMYDEVVFDHLHAITYK 171

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D    R   G I ++ SI        +  L  Y   NY G+ + +   G    + L +  
Sbjct: 172 DQALGRTILGPIENIKSIQ-------RKDLAEYISTNYTGDRMALVGAGSVDHDKLVEYG 224

Query: 239 ISKFGDIK 246
              FG I+
Sbjct: 225 ERYFGHIR 232

>ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} similar
           to uniprot|Q12496 Saccharomyces cerevisiae YOL098C
           Hypothetical ORF
          Length = 1028

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 7/98 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G  H  EH++   GS++YP  GL  T       S NA+T  +QT +        +
Sbjct: 53  PTDS-GAPHTLEHLVFM-GSQKYPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TT 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEH 157
            G   F+ +L V+     NP         E++ I  +H
Sbjct: 106 AGWQGFKKLLPVYLDHILNPTLTDESCLTEVHHIDPDH 143

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 72/187 (38%), Gaps = 17/187 (9%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFELPNSQSNGEF 123
           G AH  EH+    G++     G+   L  +N GS  NAYT+ E T +Y +      + E 
Sbjct: 67  GTAHFLEHLAFK-GTQNRSQQGI--ELEIENIGSHLNAYTSRENTVYYAK------SLEE 117

Query: 124 AFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFS 183
                +D+ +      + +   I +E   I  E E       ++ +     +   D P  
Sbjct: 118 DIPKAVDILSDILTKSVLDSNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLG 177

Query: 184 RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFG 243
           R   G I ++ SI        ++ L  Y   NY G+ + +   G      L + A   FG
Sbjct: 178 RTILGPIKNIKSI-------TRSDLKDYITKNYKGDRMVLAGAGAVDHERLVQYAQKYFG 230

Query: 244 DIKPKNS 250
            +   +S
Sbjct: 231 HVPRSDS 237

>YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}
           Putative metalloprotease
          Length = 1037

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFA 124
           G  H  EH+I   GSK YP  GL  T    +  + NA+T  +QT +        S G   
Sbjct: 57  GAPHTLEHLIFM-GSKSYPYKGLLDTAGNLSLSNTNAWTDTDQTVYTL-----SSAGWKG 110

Query: 125 FEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGN 160
           F  +L  +     +P         E+Y I  E+ G+
Sbjct: 111 FSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLGD 146

>NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1034

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H  EH+I   GSK++P  GL  T+      S NA+T  +QT +        S
Sbjct: 53  PNDS-GVPHTLEHLIFM-GSKEHPYKGLLDTVGNLCMSSTNAWTATDQTVYTL-----TS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F  +L  + +    P       + E+Y +  E
Sbjct: 106 AGWKGFSKLLPSYLNHILFPTLTDEACTTEVYHVDPE 142

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 11/94 (11%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKN-NGSQNAYTTGEQTTFYFELPNS 117
           +P D+ G+AH+ EH  L  GSK+YP    F  ++ ++ +   NA T  + T + F   NS
Sbjct: 76  NPPDSTGVAHILEHTTL-CGSKKYPVRDPFFKMLNRSLSNFMNAMTGHDYTMYPFATTNS 134

Query: 118 QSNGEFAFEFILDVFASFFKNPLFNPLLISKEIY 151
           +      F+ + DV+     +  F+PLL  ++ +
Sbjct: 135 KD-----FKNLQDVYL----DATFSPLLKQEDFF 159

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 77/186 (41%), Gaps = 18/186 (9%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFELPNSQSNGEF 123
           G AH  EH+    G++     G+   L  +N GS  NAYT+ E T +Y +  + Q +   
Sbjct: 67  GTAHFLEHLAFK-GTQNRSQQGI--ELEIENIGSHLNAYTSRENTVYYAK--SLQEDIPK 121

Query: 124 AFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFS 183
           A E + D+        + +   I +E   I  E E       ++ +     +   D P  
Sbjct: 122 AVEILSDILT----KSVLDSNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLG 177

Query: 184 RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFG 243
           R   G I ++ SI    + +LKN    Y   NY G+ + +   G      L + A   FG
Sbjct: 178 RTILGPIKNIKSI---TRSDLKN----YITKNYKGDRMVLAGAGAVDHEKLVEHAQKYFG 230

Query: 244 DIKPKN 249
            + PK+
Sbjct: 231 HV-PKS 235

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 73/191 (38%), Gaps = 28/191 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYF-----ELPNSQ 118
           G AH  EH+    G++     G+   L  +N GS  NAYT+ E T +Y      ++P + 
Sbjct: 67  GTAHFLEHLAFK-GTQNRSQQGI--ELEIENIGSHLNAYTSRENTVYYAKSLQEDIPKA- 122

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +      + +   I +E   I  E E       ++ +     +   
Sbjct: 123 ----------VDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYK 172

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D P  R   G I ++ SI        +  L  Y   NY G+ + +   G      L + A
Sbjct: 173 DQPLGRTILGPIKNIKSI-------TRTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYA 225

Query: 239 ISKFGDIKPKN 249
              FG + PK+
Sbjct: 226 QKYFGHV-PKS 235

>TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1032

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G  H  EH+I   GSK YP  GL  T       S NA+T  +QT +        +
Sbjct: 53  PNDS-GCPHTLEHLIFM-GSKSYPYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TT 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F+ +L V+      P         E++ I  E
Sbjct: 106 AGWKGFKTLLPVYLDHLLFPTLTDEACITEVHHIDPE 142

>Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 44/109 (40%), Gaps = 10/109 (9%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G  H  EH+I   GSK YP  GL  T    +    NA+T  +QT +        S
Sbjct: 53  PNDS-GAPHTLEHLIFM-GSKSYPYKGLLDTAGNLSMSITNAWTDTDQTVYTL-----AS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIF 168
            G   F  +L  +     +P         E+Y I  E   N+S    +F
Sbjct: 106 AGWKGFSKLLPTYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVVF 151

>KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 982

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQ 118
           +P D+ G+ H+ EH  L  GS +YP    F  ++ ++  +     TG   TFY   P + 
Sbjct: 75  NPPDSTGVPHILEHTTL-CGSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFAT 130

Query: 119 SNGEFAFEFILDVFASFFKNPLFN 142
           +N E  F  + DV+     NPL N
Sbjct: 131 TN-ETDFANLRDVYLDATLNPLLN 153

>NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGS-QNAYTTGEQTTFYFELPNS 117
           +P ++ G+ H+ EH  L  GSK+YP    F  ++ K+  +  NA T  + T F F   N+
Sbjct: 75  NPPNSTGVPHVLEHTTLC-GSKKYPVRDPFFKMLNKSLANFMNAMTGHDYTFFPFATTNA 133

Query: 118 QSNGEFAFEFILDVFASFFKNPLFNPLLISKEIY--AIQSEHEGNISSTTKIFYHAA 172
           +      F  + DV+     +   NPLL  ++ Y    + EH+     TT I +   
Sbjct: 134 KD-----FNNLRDVYL----DATLNPLLKQEDFYQEGWRLEHDTVTDVTTPIVFKGV 181

>Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 44/109 (40%), Gaps = 10/109 (9%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G  H  EH++   GSK YP  GL  T    +    NA+T  +QT +        S
Sbjct: 53  PNDS-GAPHTLEHLVFM-GSKSYPYKGLLDTAGNLSLSVTNAWTDTDQTVYTL-----SS 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIF 168
            G   F  +L  +     +P         E+Y I  E   N+S    +F
Sbjct: 106 AGWKGFSKLLPAYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVVF 151

>KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1037

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 52/119 (43%), Gaps = 10/119 (8%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H  EH+I   GS++YP  GL  T       + NA+T  +QT +        +
Sbjct: 53  PTDS-GVPHTLEHLIFM-GSEKYPYKGLLDTAGNLCMSNTNAWTATDQTVYTL-----ST 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
            G   F+ +L V+      P       + E+Y I  +   ++S    +F   A + + S
Sbjct: 106 AGWKGFKKLLPVYLDHLFFPTLTEDACTTEVYHIDPD---DLSDKGVVFSEMAGIESQS 161

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 77/185 (41%), Gaps = 18/185 (9%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFELPNSQSNGEF 123
           G AH  EH+    G+K     G+   L  +N GS  NAYT+ E T ++ +  + + +   
Sbjct: 70  GTAHFLEHLAFK-GTKNRSQTGI--ELEIENIGSHLNAYTSRENTVYFAK--SLEEDVPR 124

Query: 124 AFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFS 183
           A E + D+        + +P  I +E   I  E E       ++ +     +A  +    
Sbjct: 125 AVEILSDILT----RSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHDVAYKNQALG 180

Query: 184 RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFG 243
           R   G I ++ +I    + +LKN    Y   NY G+ + +   G      L + A   FG
Sbjct: 181 RTILGPIKNIKTI---TREDLKN----YIDKNYKGDRMVLAGAGAIDHEKLIEYAQKSFG 233

Query: 244 DIKPK 248
            I PK
Sbjct: 234 HI-PK 237

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 68/185 (36%), Gaps = 27/185 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFE-----LPNSQ 118
           G AH  EH+      K+         L  +N GS  NAYT+ E T +Y +     +P + 
Sbjct: 52  GTAHFLEHLAFKGTEKRSQKK---IELDIENIGSHLNAYTSRENTVYYAKTLKENVPQA- 107

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +        +   I +E   I  E E       ++ +     +A S
Sbjct: 108 ----------IDILSDILTKSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYS 157

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D    R   G I ++ SI        ++ L  Y   NY G+ + +   G    N + K A
Sbjct: 158 DQSLGRTILGPIKNIKSI-------TRDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYA 210

Query: 239 ISKFG 243
              FG
Sbjct: 211 EKYFG 215

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 68/185 (36%), Gaps = 27/185 (14%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFE-----LPNSQ 118
           G AH  EH+      K+         L  +N GS  NAYT+ E T +Y +     +P + 
Sbjct: 62  GTAHFLEHLAFKGTEKRSQKK---IELDIENIGSHLNAYTSRENTVYYAKTLKENVPQA- 117

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANS 178
                     +D+ +        +   I +E   I  E E       ++ +     +A S
Sbjct: 118 ----------IDILSDILTKSTLDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYS 167

Query: 179 DHPFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLA 238
           D    R   G I ++ SI        ++ L  Y   NY G+ + +   G    N + K A
Sbjct: 168 DQSLGRTILGPIKNIKSI-------TRDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYA 220

Query: 239 ISKFG 243
              FG
Sbjct: 221 EKYFG 225

>KNAG0K00690 Chr11 complement(124385..127477) [3093 bp, 1030 aa]
           {ON} Anc_3.93 YOL098C
          Length = 1030

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 69/179 (38%), Gaps = 24/179 (13%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G  H  EH++   GSKQYP  GL  T       S NA+T  + T +        +
Sbjct: 52  PNDS-GAPHTLEHLVFM-GSKQYPYKGLLDTAGNLCMSSTNAWTATDHTAYSL-----TT 104

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEH---EGNISSTTKIFYHAARLLA 176
            G   F  +L V+      P         E++ I  E+   +G + S      + +  + 
Sbjct: 105 AGWEGFAKLLPVYLDHVLFPTLTDDACVTEVHHIDPENLSDKGVVYSEMDAIENQSWFIT 164

Query: 177 NSD-----HPFS---RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRG 227
           N       HP     R  TG +       QL+ +     +  + K+ Y  +N+ + I G
Sbjct: 165 NLAMQRLVHPNGSGYRSETGGLTH-----QLRDLT-NEQIRQFHKDMYSSDNLCLIITG 217

>Suva_15.67 Chr15 complement(105988..109104) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 41/104 (39%), Gaps = 9/104 (8%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFA 124
           G  H  EH+I   GS  +P  GL  T    +    NA+T  +QT +        S G   
Sbjct: 57  GAPHTLEHLIFM-GSNSHPYKGLLDTAGNLSMSVTNAWTDTDQTVYTL-----ASAGWKG 110

Query: 125 FEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIF 168
           F  +L V+     NP         E+Y +  E   N+S    +F
Sbjct: 111 FSKLLPVYLDHILNPTLTDEACLTEVYHVDPE---NLSDKGVVF 151

>KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.541
           YDR430C
          Length = 994

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G+ H+ EH  L  GS +YP    F  ++ K+  +     TG   TF+   P + +
Sbjct: 88  PPDSTGVPHILEHTTL-CGSVKYPVHDPFFKMLNKSLANFMNAMTGPHYTFF---PFATT 143

Query: 120 NGEFAFEFILDVFASFFKNPLF 141
           NG   F  + DV+     NPL 
Sbjct: 144 NGR-DFANLRDVYLDSILNPLL 164

>KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 7/97 (7%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS 119
           P D+ G  H  EH+I   GS+++   GL  T       S NA+T  +QT +        +
Sbjct: 53  PTDS-GTPHTLEHLIFM-GSQKHHYKGLLDTAGNLCMSSTNAWTATDQTVYTL-----TT 105

Query: 120 NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSE 156
            G   F+ +L  +     NP         E+Y I  E
Sbjct: 106 AGWKGFQKLLPAYLDHILNPTLTDAACMTEVYHIDPE 142

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKN-NGSQNAYTTGEQTTFYFELPNS 117
           +P D  G+ H+ EH  L  GS++YP    F  ++ ++ +   NA T  + T F F   N 
Sbjct: 75  NPPDCTGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLSNFMNAMTAHDYTFFPFSTTN- 132

Query: 118 QSNGEFAFEFILDVFASFFKNPLF 141
               E  F+ + DV+     NPL 
Sbjct: 133 ----ETDFKNLRDVYIDATLNPLL 152

>Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430C
           (CYM1) - Hypothetical ORF [contig 193] FULL
          Length = 987

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 9/87 (10%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQ 118
           +P D  G+ H+ EH  L  GS++YP    F  ++ ++  +     TG   TFY   P + 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFAT 130

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLL 145
           +N +  F  + DV+     +  FNPLL
Sbjct: 131 AN-KADFANLRDVYI----DATFNPLL 152

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 78/186 (41%), Gaps = 18/186 (9%)

Query: 65  GLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQ-NAYTTGEQTTFYFELPNSQSNGEF 123
           G AH  EH+    G++     G+   L  +N GS  NAYT+ E T +Y +  + Q +   
Sbjct: 67  GTAHFLEHLAFK-GTQNRSQQGI--ELEIENIGSHLNAYTSRENTVYYAK--SLQEDIPK 121

Query: 124 AFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFS 183
           A   + D+     K+ L N  +  +    I+   E +      +F H   +    D P  
Sbjct: 122 AVGILSDILT---KSVLDNNAIERERDVIIRESEEVDKMYDEVVFDHLHEI-TYKDQPLG 177

Query: 184 RFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFG 243
           R   G I ++ SI    + +LKN    Y   NY G+ + +   G      L + A   FG
Sbjct: 178 RTILGPIKNIKSI---TRSDLKN----YITRNYKGDRMVLAGAGAVDHEELVEYAQKYFG 230

Query: 244 DIKPKN 249
            + PK+
Sbjct: 231 HV-PKS 235

>Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 75/178 (42%), Gaps = 15/178 (8%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGS-QNAYTTGEQTTFYFELPNS 117
           +P D  G+ H+ EH  L  GS +YP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QSNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEH----EGNISSTTKIFYHAAR 173
           Q      F  +  V+     NPL       +E + ++ E+    E NI     ++     
Sbjct: 134 QD-----FANLRGVYLDSTLNPLLKQEDFDQEGWRLEHENITEPESNIVFKGVVYNEMKG 188

Query: 174 LLANSDHPF-SRFSTGNIHSL--SSIPQLKKINLKNS-LNAYFKNNYFGENITICIRG 227
            ++N+++ F S+F      SL  S    +K  +LK S L  +  +NY   N      G
Sbjct: 189 QISNANYYFWSKFQQSIYPSLNNSGGDPMKITDLKYSDLLDFHHSNYHPSNAKTFTYG 246

>CAGL0K04147g Chr11 (383129..383776) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P53224 Saccharomyces cerevisiae
           YGR038w ORM1
          Length = 215

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)

Query: 244 DIKPKNSVEGN-NFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKYKNSKC 302
           D KP  + +GN N S +    R S  V +       DHR+  S  I+  V +E +++   
Sbjct: 3   DYKPFPAYQGNSNVSAQGSRLRSSSQVSTGASDPVKDHRRKRSSSIISHVEQETFEDDVD 62

Query: 303 FEHPPGKNTIFINSNKSPVIRFLFPV 328
            +  P  N  ++N   + +I  +  V
Sbjct: 63  QQLLPNMNASWVNQRGAWIIHIVVIV 88

>CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 Saccharomyces cerevisiae
           YDR430c
          Length = 990

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 11/93 (11%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGS-QNAYTTGEQTTFYFELPNSQ 118
           P D  G+ H+ EH  L  GS++YP    F  ++ K+  +  NA T  + T F F   N++
Sbjct: 76  PPDATGVPHILEHTTL-CGSEKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFATTNAR 134

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIY 151
                 F  + DV+     N    PLL  ++ Y
Sbjct: 135 D-----FVNLRDVYL----NSTLRPLLKEQDFY 158

>TDEL0A04040 Chr1 complement(719669..722632) [2964 bp, 987 aa] {ON}
           Anc_5.541 YDR430C
          Length = 987

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQ 118
           +P D  G+ H+ EH  L  GS +YP    F  ++ ++  +     TG   TF+   P S 
Sbjct: 75  NPPDCTGVPHILEHTTL-CGSYKYPVRDPFFKMLNRSLANFMNAMTGPDYTFF---PFST 130

Query: 119 SNGEFAFEFILDVFASFFKNPLFNP 143
           +N +  F  +  V+ S   NPL  P
Sbjct: 131 TN-KTDFANLRSVYLSSTLNPLLKP 154

>ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR430C (CYM1)
          Length = 990

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 7/105 (6%)

Query: 60  PKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGS-QNAYTTGEQTTFYFELPNSQ 118
           P D  G+ H+ EH  L  GS++YP    F  ++ ++  +  NA T  + T + F   N +
Sbjct: 76  PPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTAHDHTFYPFATTNQK 134

Query: 119 SNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISS 163
                 F  + D++      PL       +E + ++    G+ SS
Sbjct: 135 D-----FANLRDLYLDATLRPLLRHADFLQEGWRLEHRDVGDASS 174

>Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 74/178 (41%), Gaps = 15/178 (8%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGS-QNAYTTGEQTTFYFELPNS 117
           +P D  G+ H+ EH  L  GS +YP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QSNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQ----SEHEGNISSTTKIFYHAAR 173
           Q      F  +  V+     NPL       +E + ++    ++ + NI     ++     
Sbjct: 134 QD-----FANLRGVYLDSTLNPLLKQEDFDQEGWRLEHKNVTDPDSNIVFKGVVYNEMKG 188

Query: 174 LLANSDHPF-SRFSTGNIHSL--SSIPQLKKINLK-NSLNAYFKNNYFGENITICIRG 227
            ++N+++ F S+F      SL  S    +K  +LK N L  +   NY   N      G
Sbjct: 189 QISNANYYFWSKFQQSIYPSLNNSGGDPMKITDLKYNDLLDFHHRNYHPSNAKTFTYG 246

>YDR430C Chr4 complement(1325501..1328470) [2970 bp, 989 aa] {ON}
           CYM1Lysine-specific metalloprotease of the mitochondrial
           intermembrane space, member of the pitrilysin family;
           degrades proteins and presequence peptides cleaved from
           imported proteins; required for normal mitochondrial
           morphology
          Length = 989

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 60/133 (45%), Gaps = 12/133 (9%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGS-QNAYTTGEQTTFYFELPNS 117
           +P D+ G+ H+ EH  L  GS +YP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDSTGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QSNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQ----SEHEGNISSTTKIFYHAAR 173
           Q      F  +  V+     NPL       +E + ++    ++ E NI     ++     
Sbjct: 134 QD-----FANLRGVYLDSTLNPLLKQEDFDQEGWRLEHKNITDPESNIVFKGVVYNEMKG 188

Query: 174 LLANSDHPF-SRF 185
            ++N+++ F S+F
Sbjct: 189 QISNANYYFWSKF 201

>Suva_2.606 Chr2 complement(1078206..1081175) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 15/178 (8%)

Query: 59  DPKDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGS-QNAYTTGEQTTFYFELPNS 117
           +P D  G+ H+ EH  L  GS +YP    F  ++ K+  +  NA T  + T F F   N 
Sbjct: 75  NPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNP 133

Query: 118 QSNGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQ----SEHEGNISSTTKIFYHAAR 173
           Q      F  +  V+     NPL       +E + ++    ++ + NI     ++     
Sbjct: 134 QD-----FINLRGVYLDSTLNPLLKQEDFDQEGWRLEHNSITDPKSNIVFKGVVYNEMKG 188

Query: 174 LLANSDHPF-SRFSTGNIHSL--SSIPQLKKINLK-NSLNAYFKNNYFGENITICIRG 227
            ++N+++ F S+F      SL  S    +K  NLK N L  +   NY   N      G
Sbjct: 189 QISNANYYFWSKFQQSIYPSLNNSGGDPMKITNLKYNDLLDFHHRNYHPSNAKTFTYG 246

>SAKL0H14718g Chr8 complement(1277222..1279948) [2727 bp, 908 aa] {ON}
            similar to uniprot|P27801 Saccharomyces cerevisiae
            YLR148W PEP3 Vacuolar peripheral membrane protein that
            promotes vesicular docking/fusion reactions in
            conjunction with SNARE proteins required for vacuolar
            biogenesis forms complex with Pep5p that mediates protein
            transport to the vacuole
          Length = 908

 Score = 32.3 bits (72), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 17/107 (15%)

Query: 1043 MFDIPFLQGLTLK-----------RYLEFFESKISIYSRQ---RSKLSIMITSPMAEEDI 1088
            +FDI F+  L+LK             L+ +E  +S+   +    S   +  T  +AE+  
Sbjct: 648  IFDIDFILRLSLKFKKFGCAIYLYSQLKLYEDAVSLALEKGMLESAKLVASTPELAEDYN 707

Query: 1089 VSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSF 1135
            + RK++L++  FL  +G  IK + +K+I+ +S    VL IK+L   F
Sbjct: 708  LGRKLWLRIARFLISQGNDIK-QTIKTIIQDS--GEVLTIKDLLPLF 751

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 133,583,893
Number of extensions: 6319261
Number of successful extensions: 19573
Number of sequences better than 10.0: 125
Number of HSP's gapped: 19955
Number of HSP's successfully gapped: 165
Length of query: 1208
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1087
Effective length of database: 39,606,813
Effective search space: 43052605731
Effective search space used: 43052605731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)