Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.197.127ON47647623500.0
YPL259C (APM1)7.127ON47547622460.0
Smik_6.4667.127ON47647622430.0
Suva_16.457.127ON47847822370.0
NCAS0E021407.127ON48147818650.0
CAGL0K00539g7.127ON45647818210.0
KNAG0L009507.127ON46147818200.0
NDAI0E036807.127ON44447518000.0
TBLA0A009507.127ON46949317940.0
KAFR0L004707.127ON46547517930.0
ZYRO0C05236g7.127ON44747517910.0
Kpol_1062.567.127ON45047417710.0
TDEL0H028907.127ON44247517670.0
SAKL0F05346g7.127ON44747517560.0
Kwal_55.208437.127ON44147417210.0
Ecym_83507.127ON44547517160.0
KLTH0F12584g7.127ON44147417080.0
TPHA0C043207.127ON45448117070.0
ADL017C7.127ON44347516940.0
KLLA0D14311g7.127ON44347516780.0
Ecym_52393.165ON4644905285e-61
KLTH0F06534g3.165ON4665115093e-58
KLLA0C03894g3.165ON4755174963e-56
Kwal_33.141823.165ON4675124929e-56
SAKL0C07414g3.165ON4825254894e-55
CAGL0C05203g3.165ON4755174721e-52
NCAS0C035803.165ON4915114702e-52
TDEL0D045803.165ON4825224642e-51
Kwal_26.81462.555ON5055564601e-50
SAKL0D13090g2.555ON4995414591e-50
NDAI0G029203.165ON4865114501e-49
Kpol_1045.443.165ON4695094379e-48
ZYRO0B04840g3.165ON4765144361e-47
KLTH0D07502g2.555ON5045514381e-47
ADR315W3.165ON4924124344e-47
ABR047W2.555ON4984874232e-45
TBLA0F008403.165ON4815114169e-45
KLLA0F25432g2.555ON5075523908e-41
Suva_15.1033.165ON4913153881e-40
YOL062C (APM4)3.165ON4913153871e-40
TPHA0P006603.165ON4734443842e-40
Ecym_45912.555ON5015033792e-39
Smik_15.963.165ON4913153748e-39
Skud_15.913.165ON4913163731e-38
KNAG0K011503.165ON4745073441e-34
TPHA0I023902.555ON5593773354e-33
ZYRO0E05874g2.555ON5493573108e-30
TDEL0B064302.555ON5253513053e-29
CAGL0K03223g2.555ON5983923002e-28
NCAS0A126502.555ON5883822951e-27
Kpol_1056.132.555ON5413652941e-27
KAFR0A020602.555ON5403582877e-27
Smik_8.232.555ON6033662852e-26
Skud_8.262.555ON5963822816e-26
KNAG0C055502.555ON5823702791e-25
KAFR0C010203.165ON4285012751e-25
Suva_8.332.555ON5963842754e-25
YHL019C (APM2)2.555ON6053862729e-25
TBLA0B067602.555ON6572562052e-16
NDAI0B016102.555ON6722801812e-13
KAFR0D035602.522ON4553351268e-07
TPHA0C041302.522ON5331641269e-07
KLLA0E18789g2.522ON4973391232e-06
KLLA0D11396g3.575ON5361361161e-05
TDEL0A029702.522ON4961581124e-05
ZYRO0E09746g3.575ON5381371125e-05
AGL061W2.522ON4111551099e-05
KLTH0D06556g2.522ON4561611081e-04
SAKL0A09218g2.522ON4732891053e-04
Kwal_26.79572.522ON4561511044e-04
CAGL0A04741g3.575ON5362031027e-04
NCAS0F040103.575ON5471371027e-04
TBLA0E001403.575ON5431591010.001
TBLA0I006202.522ON6091681010.001
NCAS0A048702.522ON489219970.003
KLTH0G00528g3.575ON633137970.003
AFR274C3.575ON532122970.003
Kpol_1018.422.522ON575165970.003
Ecym_60073.575ON537137960.004
TDEL0D064303.575ON536137960.004
Kwal_47.192923.575ON538139950.005
NDAI0B063203.575ON540122920.012
SAKL0F00594g3.575ON545137920.013
Skud_6.1423.575ON546122910.017
ZYRO0B01738g2.522ON492159900.020
TPHA0G037003.575ON539137900.021
Smik_7.3713.575ON598122900.021
YFR051C (RET2)3.575ON546122900.022
KLTH0H11770g1.388ON15692840.031
CAGL0L02145g2.522ON54336880.032
Suva_4.5482.522ON484151880.035
Skud_2.4192.522ON484153860.052
SAKL0D08074g1.388ON156104810.090
CAGL0B04983g1.388ON156116810.090
Suva_12.63.575ON546122820.16
Kpol_380.133.575ON535137810.21
YBR288C (APM3)2.522ON483162800.29
KAFR0J001303.575ON543123790.47
Smik_2.4302.522ON484150780.50
YLR170C (APS1)1.388ON15690750.57
TBLA0A012601.388ON156117740.61
Kpol_507.73.575ON533131770.83
NDAI0G052101.388ON156102730.84
KNAG0A069702.522ON50545761.0
TDEL0B061901.388ON156107721.3
Smik_12.2321.388ON15690721.3
ZYRO0E05236g1.388ON15687711.6
ZYRO0D07128g5.21ON509131723.2
Skud_12.2361.388ON15692684.3
ZYRO0G05984g2.133ON371126695.3
TBLA0C069905.21ON51138705.6
Ecym_72662.522ON51766705.6
Kwal_14.26071.388ON15684668.6
Suva_10.2681.388ON15687659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.19
         (476 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   909   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   869   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   868   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   866   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   723   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   706   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   705   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   697   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   695   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   695   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   694   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   686   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   685   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   681   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   667   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   665   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   662   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   662   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   657   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   650   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   207   5e-61
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   200   3e-58
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   195   3e-56
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   194   9e-56
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   192   4e-55
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   186   1e-52
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   185   2e-52
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   183   2e-51
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   181   1e-50
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   181   1e-50
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   177   1e-49
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   172   9e-48
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   172   1e-47
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   173   1e-47
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   171   4e-47
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   167   2e-45
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   164   9e-45
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   154   8e-41
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   154   1e-40
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   153   1e-40
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   152   2e-40
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   150   2e-39
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   148   8e-39
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   148   1e-38
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   137   1e-34
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   133   4e-33
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   124   8e-30
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   122   3e-29
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   120   2e-28
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   118   1e-27
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   117   1e-27
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   115   7e-27
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   114   2e-26
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   112   6e-26
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   112   1e-25
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   110   1e-25
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   110   4e-25
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   109   9e-25
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    84   2e-16
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    74   2e-13
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    53   8e-07
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    53   9e-07
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    52   2e-06
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    49   1e-05
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    48   4e-05
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    48   5e-05
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    47   9e-05
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    46   1e-04
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    45   3e-04
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    45   4e-04
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    44   7e-04
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    44   7e-04
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    44   0.001
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    44   0.001
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    42   0.003
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    42   0.003
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    42   0.003
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    42   0.003
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    42   0.004
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    42   0.004
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    41   0.005
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    40   0.012
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    40   0.013
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    40   0.017
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    39   0.020
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    39   0.021
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    39   0.021
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    39   0.022
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    37   0.031
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.032
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    39   0.035
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    38   0.052
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    36   0.090
CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly ...    36   0.090
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     36   0.16 
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    36   0.21 
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    35   0.29 
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    35   0.47 
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    35   0.50 
YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}  ...    33   0.57 
TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.38...    33   0.61 
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    34   0.83 
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    33   0.84 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   1.0  
TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {...    32   1.3  
Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {O...    32   1.3  
ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {O...    32   1.6  
ZYRO0D07128g Chr4 (618590..620119) [1530 bp, 509 aa] {ON} highly...    32   3.2  
Skud_12.236 Chr12 complement(447306..447776) [471 bp, 156 aa] {O...    31   4.3  
ZYRO0G05984g Chr7 (470636..471751) [1116 bp, 371 aa] {ON} simila...    31   5.3  
TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa] ...    32   5.6  
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    32   5.6  
Kwal_14.2607 s14 complement(831030..831500) [471 bp, 156 aa] {ON...    30   8.6  
Suva_10.268 Chr10 complement(472748..473218) [471 bp, 156 aa] {O...    30   9.4  

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/476 (93%), Positives = 445/476 (93%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQICETKMLKQYITQ            RNATRPPVALTNSVSWRPEGIIHKKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
           TSAATSDNI                   VNIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
           KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476
           EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/476 (89%), Positives = 433/476 (90%), Gaps = 1/476 (0%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP LLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VAIVTSL ANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDD+N  P 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNI-PS 239

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
            SA TSDN                    VNIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 240 ASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 299

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
           KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEI+IPVPDDA
Sbjct: 300 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 359

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           DTPTFKYSHGSLKYVPEKSAILWK+RSFPGGKEYSMSAELGLPSISN+ +G+R +PKSNA
Sbjct: 360 DTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNA 419

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476
           EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 420 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/476 (89%), Positives = 431/476 (90%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDHNGKPLLSRRYRDD+PLSAIDKF TLLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLVAIVTSL ANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLD+DSN P  
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
            SAATSDN                    VNIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
           KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEI+IPVPDDA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSIS   +G R IPKSNA
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476
           ++LKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/478 (88%), Positives = 430/478 (89%), Gaps = 2/478 (0%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH+GKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLVAI TSL ANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNATRPPVALTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDD SN PP 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 241 TSAATSDNIXXXXXXX--XXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPP 298
            S  TSDN                      VNIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD 358
           DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEI+IPVPD
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKS 418
           DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISN  +G + IPK+
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 419 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476
           NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/478 (74%), Positives = 400/478 (83%), Gaps = 30/478 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCD  G PLL+RRYRDDIP+SAI+KFPTLLSDLEE++NL+PPCL++NG++YLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+YLVAI  S+ ANAA IF FL+KLV+VL +YLKTVEEESIRDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNA RPP ALTNSVSWR   I +KKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDS--NTP 238
           DI+ESINMLMTQKGQ+LRSEIIG+VKV S+LSGMPDLKLGINDKGIFSK++DDDS  N  
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 239 PPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPP 298
              +++T+D                      NIELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 272 ASVASSTTDK------------------KKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313

Query: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD 358
           DG F+LMNYRLST+IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KSTATNV+IIIPVP+
Sbjct: 314 DGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPE 373

Query: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKS 418
           DADTP FKYSHGS+KYVPEK+ I+WK+RSFPGGKEYSMSA++ LPSI N IE H+A    
Sbjct: 374 DADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGN-IEEHKA---- 428

Query: 419 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476
                K PVQIKFQIPYFTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 429 -----KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/478 (72%), Positives = 393/478 (82%), Gaps = 24/478 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASA+YFCD+ G+PLLSR+YRDDIP SAID+FP LLS+ EE++NLIPPC+ HNG+++LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYLVAI TS+  NAA IF+FLHK++EVLS+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI E KMLKQYITQ            RNA RPP +LTNSVSWRPEGI HKKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPP- 239
           DI+ESINMLMTQKGQVLRSEIIG+VKV SKLSGMPDLKLGINDKG+FSKYL+ D N  P 
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 240 -PTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPP 298
            P  ++  ++                     N+ELEDLKFHQCVRLSKFENEK ITFIPP
Sbjct: 241 APDDSSVDES-------------KPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPP 287

Query: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD 358
           DG F+LM+YRLST IKPLIWCDVN++ HS SRIEI C+AKAQIK+KSTATNVEI+IPVP+
Sbjct: 288 DGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPE 347

Query: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKS 418
           DADTP FKYSHGS+KYVPEK+AILWK+R+FPG KEYSM+AE+GLPS +   E        
Sbjct: 348 DADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE-------- 399

Query: 419 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476
            +E LK PVQ+KFQIPYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 400 -SEKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/478 (71%), Positives = 391/478 (81%), Gaps = 21/478 (4%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCD  GKPLLSRRY+DD+PLSAIDKF TLL+DLE++S +IPPC+NHNG+EYLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VA+ TSL  N A +F FLHKL+ VL +YLKTVEEESIRDNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI E +MLK+YITQ            RNA RPP  L NSVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDS---NT 237
           DIVESINML+TQKGQVLRSEIIG VK+ S+LSGMPDLKLGIND+GIF+KYL+ ++   N 
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 238 PPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIP 297
           P P    +                        NIELEDLKFHQCVRLSKFENEKIITFIP
Sbjct: 241 PDPQEHGSG--------VAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIP 292

Query: 298 PDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVP 357
           PDG+FDLMNYRL+T+IKPLIWCDV++QVHS SRIEI C+AKAQIK+KS A NV+I+IPVP
Sbjct: 293 PDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVP 352

Query: 358 DDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPK 417
           DDADTP+FKYSHGS+KYVPE+SAILWK++SFPGGKEY+M AE+GLPS+ +  E     PK
Sbjct: 353 DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE-----PK 407

Query: 418 SNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
                +K PVQ+KF+IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 408 -----VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/475 (72%), Positives = 387/475 (81%), Gaps = 32/475 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASA+YFCD  G+PLLSR+YRDDIPL+AIDKF +LL+DLEE+S++IPPCL +N  +YLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QH+D+YLVAI   LR N A +F FL+K+++VL DYLKTVEEESIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            +NA RPP ALT+SVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DIVESINMLMTQKGQ+LRSEI+G VK+ S+LSGMPDLKLGINDKGIFSK L +D      
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
           TS   +                        IELEDLKFHQCVRLSKFE EKIITFIPPDG
Sbjct: 241 TSKKQN-----------------------KIELEDLKFHQCVRLSKFETEKIITFIPPDG 277

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
            F+LMNYRLST+IKPLIWCD+NVQVHSNSRIEIHC+AKAQIK+KSTATNVEI+IPVP+DA
Sbjct: 278 DFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDA 337

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           DTP FKYSHGS+K+VPEKSAILWK+RSFPGGKEYSM+AEL LPS S+         KS  
Sbjct: 338 DTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSS---------KSEE 388

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
              K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 389 VQNKKPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/493 (70%), Positives = 393/493 (79%), Gaps = 44/493 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S++ FCD  GK LLSR+YRDDIPL+AID F TLL  LEE+S+++PPCL HNG+ YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VA+ TSL  NA+ +FTFLHKLVEV+S+YLK VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNA RPP ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLD-------- 232
           DIVESINMLMTQ+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+        
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 233 ----------DDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                       S+TP P++     +                     N+ELEDLKFHQCV
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGS----------------SRKTSNVELEDLKFHQCV 284

Query: 283 RLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIK 342
           RLSKFENEKIITFIPPDG F+LM+YRL+T IKPLIWCDVN+ VHS SR+EIHC+AKAQIK
Sbjct: 285 RLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIK 344

Query: 343 RKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGL 402
           +KS A NVEI+IPVPDDADTP+F+YSHGS+K+VPEK+AILWK+RSF GGKEYSM+A+LGL
Sbjct: 345 KKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGL 404

Query: 403 PSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVR 462
           PSI ++ +     PK     LK PVQIKFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVR
Sbjct: 405 PSIDDNEK-----PK-----LKRPVQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVR 454

Query: 463 YITQSGDDYTIRL 475
           YITQSGDDYTIRL
Sbjct: 455 YITQSGDDYTIRL 467

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 391/475 (82%), Gaps = 10/475 (2%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MASAVYFCDH GKPLLSR+YRDDIPLSAIDKF +LLSD EE+SNL+PPC++HNG++Y+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLYL A+ TS++AN + IF FLHK+++VL  YLKTVEEESIRDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YG+PQI ETKMLK+YIT             RNA RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DI+ESINML+TQKGQVLRSEI+G+V+V S+LSGMPDLKLGIND+GIF+KYL+ ++     
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNN---IG 237

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
            +    D                      NIELEDLKFHQCVRLSKFENEKII+FIPPDG
Sbjct: 238 IAKNGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDG 297

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
           +FDLMNYRLST+IKPLIWCDV++Q +   RIEIHCKAKAQIK+KS ATNVEI+IPVP+DA
Sbjct: 298 EFDLMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDA 354

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           D+P FKYSHG +KY+PEK+ +LWK+ SFPGGKEYSM+A++GLPSIS + + +  +   + 
Sbjct: 355 DSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQS- 413

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
              K PVQ+KF+IPYFTTSGIQVRYLK+NEPKLQYK+YPWVRYITQSGDDYTIR+
Sbjct: 414 ---KKPVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/475 (70%), Positives = 386/475 (81%), Gaps = 30/475 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M SAVYFCD  G+P+LSRRYRDDIP+SAIDKF  LL  LEE+S++IPPCL+H+G++YLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY+VA+ TSL  N A +F FLHKL+EVL +YLK+VEEES+RDNF+IIYELLDE+MD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            + A RPP  +TNSVSWR   I+HKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DIVESINMLM Q+GQVLRSEIIG +KV SKLSGMPDLKLGINDKGIFSKY++ DS+  P 
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSD--PV 238

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
           T+A T                        NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 239 TTAVTEGK------------------KKTNIELEDLKFHQCVRLSKFENEKIITFIPPDG 280

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
            F+LMNYRLS  +KPLIWCDVNVQVHS SRIEIHC+A+AQIK++S A +VEI+IPVPDDA
Sbjct: 281 AFELMNYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDA 340

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           DTP+FKY+HGS+K+VP+K+AILWK+RSF GGKEYSMSA++GLPSI+       A+ K   
Sbjct: 341 DTPSFKYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSIN-------ALDKPK- 392

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
             +K PVQIKFQIPYFTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 393 --VKRPVQIKFQIPYFTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKL 445

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/474 (72%), Positives = 389/474 (82%), Gaps = 24/474 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S VYFCD +GKP+LSRRYRDDIPLSAIDKF  +L + EE+S+++PPCL + G+ YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QH+D+Y+VA+ TS + N A IF FLH+LV VL DYLK+VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            RNA RPPVALTNSVSWR EGI +KKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DI+ESINMLM Q+GQVLRSEIIG+VKV S+LSGMPDLKLGINDKGIFSKYL+++ +   P
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
                 D+                     NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VQIINDDSTTNGKKS--------------NIELEDLKFHQCVRLSKFENEKIITFIPPDG 286

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
           +F+LMNYRL+T IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KS A NVEI+IPVPDDA
Sbjct: 287 EFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDA 346

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           DTPTFKYSHGS+K++PEK+AILWKLRSF GGKEYSM+A+LGLPS+ + IE     PK   
Sbjct: 347 DTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSV-DGIEP----PK--- 398

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
             +K PVQIKFQIPYFTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 399 --VKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/475 (70%), Positives = 382/475 (80%), Gaps = 34/475 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD  G+P+LSRRYRDDIPLSAID+F  LL+DLEE+S++IPPCLNH G++YLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           +H DLY+VA+ TSL  NAA +FTFLHKLVE L DYLKTVEEES+RDNFVIIYELLDE+MD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            +   RPP  LTNSVSWR +GI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           DIVESINM+M Q+GQVLRSEIIG V V S+LSGMPDLKLGINDKGIF++  D ++     
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR--DPETGESQV 238

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
           T+                           + ELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 239 TAGKKKS----------------------SAELEDLKFHQCVRLSKFENEKIITFIPPDG 276

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
           +F+LM+YRL+T +KPLIWCDVNVQVHS SRIEIHC+AKAQIK+KS A NVEI+IPVPDDA
Sbjct: 277 EFELMSYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDA 336

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           DTP+F+YSHGS+K+VPEK+AILWK+RSF GGKEYSM+A++GLPSI N +E     PK   
Sbjct: 337 DTPSFRYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSI-NGVEK----PK--- 388

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
              K PVQ+KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQ+GDDYTIRL
Sbjct: 389 --FKRPVQVKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIRL 441

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/475 (67%), Positives = 382/475 (80%), Gaps = 29/475 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD  GK +LSRRY+DDIP +AIDKFP LL + E++S++IPPCL HNG++YLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY++ +  SL  N A +F FL+K+VEVL++Y+K VEEESIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            +N  RPP+ALTNSVSWRPEGI++KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           D+VESINML+TQ+GQVLRSEI+G VKV S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
             +AT                        NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 DLSATGKK-------------------KANIELEDLKFHQCVRLSKFENEKIITFIPPDG 281

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
            F+LM+YRL+T IKPLIWCD+ +QVHS SRIE+HC+AKAQIK+KSTA NVEI+IPVP+DA
Sbjct: 282 DFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDA 341

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           D+P F+YSHGS+K+ PEK+AILWK++SFPGGKEYSM+A+LGLPS+S D E          
Sbjct: 342 DSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVS-DFE---------E 391

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
            ++K PVQ+KFQIPYFTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 392 PVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/474 (67%), Positives = 379/474 (79%), Gaps = 35/474 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI++FP LL + E++S+++PPCL HNGL+Y+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+Y++ +  SL  N A +F+FL+KLVEVL++YLKTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            +N  RPP  LT SVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           D+ ESINML+T  GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+   ++  N    
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTS--EEGGNNAEG 238

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
            S   S                       NIELEDL+FHQCVRLSKFENEKII+FIPPDG
Sbjct: 239 GSGKKS-----------------------NIELEDLQFHQCVRLSKFENEKIISFIPPDG 275

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
            FDLMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEI+IPVP+DA
Sbjct: 276 DFDLMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDA 335

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           D+P F+YSHGSLKYVPEKSAILW++++F GGKEYS +A+LGLPS++ D+E    +PK+  
Sbjct: 336 DSPKFRYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMT-DVE----VPKA-- 388

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
              K P+Q+KFQIPYFTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 389 ---KRPIQVKFQIPYFTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/475 (66%), Positives = 379/475 (79%), Gaps = 30/475 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S +YFCD  GK LLSRRY+DDIP+SAI++FP LL + E++SN+IPPC +HNG++YLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+ AN A +F+FLH LV+VL +Y+K VEEESI+DNFVIIYELLDEVMD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
            GIPQI +TKML+QYITQ            +N  RPP +LT +VSWRPEGI +KKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           D++ESINM+MTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++  +++ + P  
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
             + T                        NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 QPSITRKK--------------------SNIELEDLKFHQCVRLSKFENEKIITFIPPDG 280

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
            F+LM+YRLST IKPLIWCD  +QVHS SR+E+HC+AKAQIK KSTA NVEI+IPVP+DA
Sbjct: 281 DFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDA 340

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           D+P F+YSHGS+K+VPEK+AILWK++SFPGGK+YSM+AE+GLPS+ NDI  +        
Sbjct: 341 DSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSV-NDIADYN------- 392

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
              K PVQIKFQIPYFTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 393 --FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/474 (67%), Positives = 375/474 (79%), Gaps = 35/474 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS +YFCD+ GK +LSRRYRDD+P SAI+KFP+LL + E++S+++PPCL HNG++YLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHND+Y++ +  SL  N A +F+FL+KLVEVL++Y+KTVEEESIRDNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           YGIPQI ETKMLKQYITQ            +N  RPP  LT SVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           D+ ESINML+T  GQVLRSEI+G V V S+LSGMPDLKLG+NDKGIF+      S+    
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESASSSE--A 238

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
           T    S                       NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 239 TEGKKS-----------------------NIELEDLKFHQCVRLSKFENEKIITFIPPDG 275

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
            F+LMNYRLST IKPLIWCD  +QVHS SRIEIHC+AKAQIK+KSTA NVEI+IPVP+DA
Sbjct: 276 DFELMNYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDA 335

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           D+P F+YSHGSLKYVPEKSAILWK+++F GGKEYS +A+LGLPS++ D E  RA      
Sbjct: 336 DSPKFRYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMT-DAEVPRA------ 388

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
              K P+Q+KFQIPYFTTSGIQVRYLKINEPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 389 ---KRPIQVKFQIPYFTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/481 (67%), Positives = 381/481 (79%), Gaps = 35/481 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD+ GKP+L+RRYRDDI ++AID F  LL  LEE++ +IPPC+ H G+ YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           +H+D+Y+VA+ TS + N A IF FLH+LVEVL +Y+K V EES+RDNFVIIYELLDE+MD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXX--XXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEA 178
           +GIPQI ETKMLK+YITQ              +NA RPP  LTNSVSWRPEGI +KKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLD----DD 234
           FLDI+ESINML+TQ+GQVLRSEI+G V+V S+LSGMPDLKLGIND+GIFS YL+    D 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 235 SNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIIT 294
           S++  P      D                       IELEDLKFHQCVRLSKFENEKIIT
Sbjct: 241 SSSSTPIPEGVEDK-------------------KPQIELEDLKFHQCVRLSKFENEKIIT 281

Query: 295 FIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIII 354
           FIPPDG+FDLMNYRL+T IKPLIWCDVN+QVHS SRIEIHC+AKAQIK+KS A NVEI+I
Sbjct: 282 FIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILI 341

Query: 355 PVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRA 414
           PVPDDADTP F+YSHGS+K++PEK+AILWKLRSF GGKEYSMSA+L LPS+ + +E    
Sbjct: 342 PVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSV-DGVEP--- 397

Query: 415 IPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
            PK     ++ PVQ+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIR
Sbjct: 398 -PK-----VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451

Query: 475 L 475
           L
Sbjct: 452 L 452

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/475 (66%), Positives = 381/475 (80%), Gaps = 32/475 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M S +YFCD  GK LLSRRY+DDIP +AI++FP LL + E++S+++PPC + NG++YLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+  N A +F++LHKL+EVL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
           +GIPQI +TKML+QYITQ            +N  RPP  LTNSVSWRPEGI++KKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           D+VESINML+TQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++  DDD      
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEE--G 238

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
            S  T                        NIELEDLKFHQCVRL+KFENEKIITFIPPDG
Sbjct: 239 ASGGTKKK--------------------SNIELEDLKFHQCVRLTKFENEKIITFIPPDG 278

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
            F+LM+YRLST IKPLIWCDV +QVHS SRIEIHC+AKAQIK+KSTA NVEI+IPVP+DA
Sbjct: 279 DFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDA 338

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           D+P F+YSHG++K+VP ++AILWK++SFPGGK+YSM+AE+GLPS+S++ + H+       
Sbjct: 339 DSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSD-HK------- 390

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
             LK PVQIKFQIPYFTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 391 --LKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/475 (65%), Positives = 374/475 (78%), Gaps = 32/475 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           MAS V FCD  GKPLLSRRY+DD+  SA++ F  LL + E++S+++PPC +HNG+ Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
           Q+ND+Y++A+  S+  NA  +F F++KL+ V+ +Y+K VEEESIRDN++IIYELLDE+MD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
            G+PQ+ ETKMLKQYITQ            +N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240
           D++ESINMLMTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+   +D  ++P P
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT--TNDQEDSPEP 238

Query: 241 TSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300
             ++   N                     NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 239 VVSSKKKN--------------------SNIELEDLKFHQCVRLSKFENEKIITFIPPDG 278

Query: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360
           +FDLM YRLST IKPLIWCDV VQVHS SRIEIHC+AKAQIK+KS A NVEI+IP+P+DA
Sbjct: 279 EFDLMTYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDA 338

Query: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420
           D+PTFKYS G++K+VPEK+AILWK  SF GGKEYSM+A+LGLPS+S D E     PK   
Sbjct: 339 DSPTFKYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVS-DAEP----PK--- 390

Query: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
             LK PVQIKFQIPYFTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 391 --LKRPVQIKFQIPYFTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  207 bits (528), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 143/490 (29%), Positives = 235/490 (47%), Gaps = 43/490 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++     G  ++S+  +D+I L   + F   ++++L+ +S    P L      +  
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           I+ N    +  V+    ++A I+ FL+   ++L  Y     E+S++ +F++ YE+LD V+
Sbjct: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQICETKMLKQYITQX-------------XXXXXXXXXXXRNATRPPVALTNS--V 164
           D GIP+  E   +  YI++                         R  +   + LT+    
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175

Query: 165 SWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224
            WR EGI +KKNE +LD+ E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234

Query: 225 GIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVRL 284
                YL   SNT    +   ++                      ++ LED KFHQCV+L
Sbjct: 235 -----YLSPSSNTQSSGNDGWAEE--------ENGTKAIKNAITGSVILEDCKFHQCVQL 281

Query: 285 SKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRK 344
            KF+ E++I F+PPDG F+LM Y +   +         V       +E     K+    K
Sbjct: 282 DKFDQERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSK 341

Query: 345 STATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPS 404
             A +VE+ IP P D        S G  K++PE++AI+WK+  + G  E   SA +    
Sbjct: 342 LCAKDVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMG 401

Query: 405 ISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 464
             ND         +  +  + P+ ++F+I  F+ SG+ VRYLK+ E  L Y +  WV+YI
Sbjct: 402 NGND-------SLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYI 454

Query: 465 TQSGDDYTIR 474
           ++SG  Y +R
Sbjct: 455 SKSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  200 bits (509), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 153/511 (29%), Positives = 253/511 (49%), Gaps = 83/511 (16%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++     G+ L+S+  R  +P S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH-NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           ++   +L++VA+  S  A++AAI+ FL+KL  +L  +    E E ++++F+  YELLD V
Sbjct: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114

Query: 119 MDYGIPQICE-----TKMLKQYITQXXXXXXXXXXXXRNATR-PPVA------------- 159
           ++ G+P   E     +KM  +                    R  PVA             
Sbjct: 115 LEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLH 174

Query: 160 -----LTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214
                + +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 175 DSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234

Query: 215 PDLKLGINDK-GIFSKYLDDDSNTPP----PTSAATSDNIXXXXXXXXXXXXXXXXXXXV 269
           P  + G+ND   + + + D++S T      P +AA S                       
Sbjct: 235 PVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGS----------------------- 271

Query: 270 NIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSN 328
            + LED KFHQCV+L KF++E+ I FIPPDG F+LM Y +   +  P     V     +N
Sbjct: 272 -VMLEDCKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKAN 330

Query: 329 SRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSF 388
           S I+     K+    K TA +V++ IPVP +        S+G  K+VPE+SAI+WK   +
Sbjct: 331 S-IDYRVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKY 389

Query: 389 PGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEI-----LKGPVQIKFQIPYFTTSGIQV 443
            G  E S+SA               A+P  ++ +      K P+ +KF+I  F+ SG+ V
Sbjct: 390 QGLTENSLSAT--------------AVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVV 435

Query: 444 RYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           R+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 436 RFFDVSEGDRNYKMVKWIKYLSKSG-AYEVR 465

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  195 bits (496), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 144/517 (27%), Positives = 249/517 (48%), Gaps = 86/517 (16%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA++  +  G  L+S+  +D +  S  D F T +++D   +S ++   L     +++ 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58

Query: 60  IQHND---LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
            + +D   ++LVA+  S   +++ I+ +LHKL +++  +    +E+ ++D F+++YE+L+
Sbjct: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116

Query: 117 EVMDYGIPQICETKMLKQYITQXXXXXXXXXXXXR-----------NATRPP-------- 157
             ++ GIPQ   T  L Q I +            +           N  + P        
Sbjct: 117 LTLENGIPQ---TTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSS 173

Query: 158 ---VALTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214
              ++  +   WRP G+ +KKNE +LDI E I +L+ + G +++S + G V   S LSGM
Sbjct: 174 SIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGM 233

Query: 215 PDLKLGINDK--------------GIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXX 260
           P  +LG+ND                + S+Y D  +    P +AA S              
Sbjct: 234 PLCQLGLNDTYSIHGNEKSELSIVEMMSEY-DIKNKKAIPNAAAGS-------------- 278

Query: 261 XXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCD 320
                     + LED KFHQCV+L+K+E   +I F+PPDG F LM YR+   I       
Sbjct: 279 ----------VILEDCKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVI 328

Query: 321 VNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSA 380
             V++  NS +      ++      +A +V + IPVP       F  S G  KY   +  
Sbjct: 329 PEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKC 388

Query: 381 ILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKG---PVQIKFQIPYFT 437
           ++WK   + G  E ++S ++ +P+ S+D+          +++L+    P+ + F+I  F+
Sbjct: 389 MVWKYNKYKGSTENTLSGKVAIPATSHDL----------SDLLRWSRPPISMGFEIVMFS 438

Query: 438 TSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
            SG+ VR+LK  EP+L Y+   W++YI+ SG  Y IR
Sbjct: 439 NSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AYEIR 474

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  194 bits (492), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 147/512 (28%), Positives = 250/512 (48%), Gaps = 84/512 (16%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ L+S+  +  +  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH-NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           I+   +L++VA+  S  A++AAI+ FL++L E+L  +     E  +++ F+I YELLD V
Sbjct: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114

Query: 119 MDYGIPQICE-TKMLKQYITQXXXXXXXXXXXXRNA---------------TRPPVA--- 159
           ++ G+P   E + +  +   +             N                 RP      
Sbjct: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174

Query: 160 -----LTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGM 214
                  +++ WR  GI +KKNE FL++ E I++L+++ G +L+S + G V+  + LSGM
Sbjct: 175 DIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234

Query: 215 PDLKLGINDK-GIFSKYLDDD-----SNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXX 268
           P  + G+ND   + + + DDD     +    P +AA S                      
Sbjct: 235 PVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGS---------------------- 272

Query: 269 VNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHS 327
             + LED KFHQCV+L KF++E+ I FI PDG F+LM Y +   +  P     +   V S
Sbjct: 273 --VMLEDCKFHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRS 330

Query: 328 NSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRS 387
           NS I+     K+    K TA +V++ IPVP +  +     S+G  K+VPE+SAI+WK   
Sbjct: 331 NS-IDYQITIKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSK 389

Query: 388 FPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEIL-----KGPVQIKFQIPYFTTSGIQ 442
           + G  E S+SA               A+P  ++ +      + P+ +KF+I  F+ SG+ 
Sbjct: 390 YQGLTENSISAT--------------AVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLV 435

Query: 443 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           VR+  ++E    YK   W++Y+++SG  Y +R
Sbjct: 436 VRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  192 bits (489), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 149/525 (28%), Positives = 239/525 (45%), Gaps = 95/525 (18%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ ++S+  RD I  S  + F   ++++L+ +S    P L      +  
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           I+ +    +  VT   A++AAI+ FL+K   +L  Y     EES+++ F+  YELLD V+
Sbjct: 57  IRSSSNLWIVAVTRSNADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DYGIPQICE-----TKMLKQYITQXXXXXXXXXXXXRNAT------RPPVALTNSVS--- 165
           + G+P   E     +KM ++ +                A       R P  L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
                             WR  GI +KKNE FLD+ E IN+L+++ G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 NSKLSGMPDLKLGINDK-----GIFSKYLDDDS------NTPPPTSAATSDNIXXXXXXX 256
            + LSG P  + G+ND      G  S+ LD  S          P +AA S          
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS---------- 285

Query: 257 XXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-P 315
                         ++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +   +  P
Sbjct: 286 --------------VQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLP 331

Query: 316 LIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYV 375
                +     +N  +E     K+    K TA +V + IPVP          S+G  ++V
Sbjct: 332 FKITPIFSVRSNNGAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFV 391

Query: 376 PEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEIL------KGPVQI 429
           PE++A+LWK   + G  E ++SA                +P  N   L      + P+ +
Sbjct: 392 PEENAVLWKFAKYQGLTENTLSA--------------LTVPMDNQSSLNLQQWSRPPMSL 437

Query: 430 KFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
            F+I  F+ SG+ VR+ K++E    Y +  WV+YI++SG  Y +R
Sbjct: 438 TFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYISRSG-AYEVR 481

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  186 bits (472), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 149/517 (28%), Positives = 245/517 (47%), Gaps = 86/517 (16%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SAV      G+ ++S+ +++++  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56

Query: 60  IQHN----DLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115
           I+ N    DL+LV++  S   N  A++ FL+K   +L  Y     EE +++ F++ YELL
Sbjct: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114

Query: 116 DEVM-DYGIPQICE----TKMLKQYITQXXXXXXXXXXXXRNATRPPVA----------- 159
           D ++ + G P   +     K +    ++            +N+T P +            
Sbjct: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174

Query: 160 ------------LTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
                       +   + WRP+GI HKKNE FL + E I++L++++G +L+S + G + +
Sbjct: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234

Query: 208 NSKLSGMPDLKLGINDKGIFSKYLDDDSNT--------PPPTSAATSDNIXXXXXXXXXX 259
            + LSG P  + G+ND    S   DD  ++          P +AA S             
Sbjct: 235 VTHLSGTPVCQFGLNDS--LSVKNDDYGDSFDYIKNKKAIPKAAAGS------------- 279

Query: 260 XXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIW 318
                      + LED KFHQCV L KF+ ++II F+PPDG  +LM Y + + I  P   
Sbjct: 280 -----------VLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKV 328

Query: 319 CDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEK 378
             +     S + +E     K+    K TA NV + IPVP +        S+GS K+ PE+
Sbjct: 329 SPIVTYSSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEE 388

Query: 379 SAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSN-AEILKGPVQIKFQIPYFT 437
            A+LW    + G  E ++SA   +   S D       P+ N  +  K P+ + F+I  F+
Sbjct: 389 KAMLWTFNKYNGLTENTLSA---VTITSKD------APRLNIQQWQKPPISLDFEIMMFS 439

Query: 438 TSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
            SG+ VRY  I E + +YK+  W+RY+++SG  Y IR
Sbjct: 440 NSGLVVRYFTIKESE-RYKTVKWIRYVSKSG-SYEIR 474

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  185 bits (470), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 142/511 (27%), Positives = 242/511 (47%), Gaps = 58/511 (11%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A+      G+ ++S+ ++  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQH---NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+    ++L++VA V+    ++AAI+ FL+KL  +L  Y     EE +++ F+I++ELLD
Sbjct: 57  IKSTRGDNLWIVA-VSRNNVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLD 114

Query: 117 EVM--DYGIPQICETKMLKQYITQXXXXXXXXXXXXRNA------------------TRP 156
            +M    GIP + E  ++   ++              N                   + P
Sbjct: 115 VMMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGP 174

Query: 157 PVALTNSVS------------WRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGD 204
            +   NS S            WRP+GI+HKKNE  L + E IN+L+++ G VL++ + G 
Sbjct: 175 KLLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGS 234

Query: 205 VKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXX 264
           + + + LSG P  + G+ND    S    D   +          N                
Sbjct: 235 IDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVG- 293

Query: 265 XXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNV 323
                ++ LED KFHQCV L KF+ ++II F+PPDG  +LM Y +   +  P     +  
Sbjct: 294 -----SVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVT 348

Query: 324 QVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILW 383
              + + +E     K+    + +A NV + IPVP +        ++GS K++PE+SA++W
Sbjct: 349 NTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIW 408

Query: 384 KLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQV 443
           +   F G  E ++SA + +P+  N          S  +  K P+ + F+I  F+ SG+ V
Sbjct: 409 RFNKFNGLTENTLSA-VTIPTKDN-------TQLSLQQWSKPPMSLDFEILMFSNSGLVV 460

Query: 444 RYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           RY  I E   +YK+  W++YI++SG  Y IR
Sbjct: 461 RYFTITERDQKYKAVKWIKYISRSG-SYEIR 490

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  183 bits (464), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 148/522 (28%), Positives = 245/522 (46%), Gaps = 89/522 (17%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M SA+      G+ ++++  +  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHN---DLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+ +    L+LVA+  S  AN+ AI+ FL+KL  V+ D     +E ++++NF+  YE+LD
Sbjct: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114

Query: 117 EVMDYG-IPQICE-----TKML----KQYITQXXXXXXXXXXXXRNATRP---------P 157
            V++ G IP   E     +KM     KQ                 N + P         P
Sbjct: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174

Query: 158 VALT---------------NSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII 202
             LT               +++SWRP GI +KKNE  L++ E I++L+++ G +L+S + 
Sbjct: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234

Query: 203 GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDS---------NTPPPTSAATSDNIXXXX 253
           G + + + LSGMP  + G+ND    S    DDS             P +AA         
Sbjct: 235 GTIDLTTHLSGMPICQFGLNDS--LSVEFGDDSISEVEDFANKKAIPKAAAG-------- 284

Query: 254 XXXXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTI 313
                            + LED KFHQCV L KF  +++I F+PPDG  +LM Y +   +
Sbjct: 285 ----------------RVMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNL 328

Query: 314 K-PLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSL 372
             P     +   +   + I+     K+    K +A +V + IPVP          S+G  
Sbjct: 329 NLPFKVTPIVTSIGRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKC 388

Query: 373 KYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQ 432
           K+VPE+SA++WK   + G  E ++SA + +PS        +  P+        P+ + F+
Sbjct: 389 KFVPEESAMIWKFTKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRP-------PMSLNFE 440

Query: 433 IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           I  F+ SG+ VRY K+++   +Y++  W++YI++SG  Y IR
Sbjct: 441 IMMFSNSGLVVRYFKVSDKDERYRTAKWIKYISKSG-SYEIR 481

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  181 bits (460), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 150/556 (26%), Positives = 241/556 (43%), Gaps = 132/556 (23%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S+++  D    PL+ + ++    +   + F     ++ + SN+  P + H G+ ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYLVAI-VTSLRANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYELLDE 117
             + LY V++ V SLR++  +   +L+    +L  YL+   ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 VMDYGIPQICETKMLKQYI-----------------------TQXXXXXXXXXXXXRNAT 154
            +D+GIPQ+ +  +++  I                        +            ++  
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 155 RPPVALTNS---------VSWRPEGIIHKKNEAFLDIVESINMLMTQKG-QVLRSEIIGD 204
           +      NS         +SWRP+GI + KNE F+D++ES   +M  K  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXX 264
           +   S LSGMP +K+ IN      K L D                               
Sbjct: 236 IICRSYLSGMPVVKICIN------KMLKDRDQF--------------------------- 262

Query: 265 XXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWC 319
                   L   KFHQCV L    ++  I FIPPDG F L  Y++   I       LI  
Sbjct: 263 --------LSSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEY 314

Query: 320 DVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADT--------PTFKYSHGS 371
            V V+     +++I  K +   K +++AT ++I +P+ D  +T        P FK   GS
Sbjct: 315 KV-VEKPKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGS 373

Query: 372 LKYVPEKSAILWKLRSFPGGKE---YSMSAELGLPSISNDIEGHR--------------- 413
           + +      +LWK     GG     +SM  E  L     D E HR               
Sbjct: 374 ILFNLSDGYLLWKANGMKGGHGETYHSMQVEFFL----FDAEAHRKEAEELKNSMDPPPL 429

Query: 414 ----------AIPKSNAEILKGPVQ----IKFQIPYFTTSGIQVRYLKINEPKLQYKSYP 459
                     A+       +  PV+     +F++PYFT+SG++V YLKI E +LQY+S+P
Sbjct: 430 REGVRMEELYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFP 489

Query: 460 WVRYITQSGDDYTIRL 475
           WVRY T +  +Y  ++
Sbjct: 490 WVRYKTINDTEYAFQM 505

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  181 bits (459), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/541 (25%), Positives = 241/541 (44%), Gaps = 108/541 (19%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S +Y  D   +PL+ + ++    +S  ++   L      +  ++P   ++ G+ +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEESIELFQQAHSKHPMVP-VFHYKGIHFVYI 56

Query: 61  QHNDLYLVAIVTSL--------RANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVI 110
           + +  Y ++ V  +          N  AI T+L     +L  Y  +  +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEVMDYGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRP-------------- 156
           IYELLDE +D+G+PQ+ +  +++ YI              +  ++               
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 157 ---PVALTNSVSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLS 212
                  T+++SWRP+GI + KNE FLD++E I   M   K ++ ++ + G ++  S LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIE 272
           GMP LK+G          L   +++ P       +N                        
Sbjct: 237 GMPKLKIG----------LSKITSSLPKEREQFMNNA----------------------- 263

Query: 273 LEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHS 327
               KFHQCV L   + + I++FIPPDG+F L  Y+L   ++      L+  DV  +   
Sbjct: 264 ----KFHQCVSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKK 318

Query: 328 NSRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHGSLKYVPEKS 379
             +I I        K +++ + + I IP+         D A  P FK   G++ +     
Sbjct: 319 RPKILISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDD 378

Query: 380 AILWKLRSFPGGK---EYSMSAEL----------GLPSISNDI------------EGHRA 414
            +LW++ S  GG    E+SM  E            L  + N +            E ++ 
Sbjct: 379 LLLWEVGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQ 438

Query: 415 IPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           + ++        V ++F+IPY+T SG++V+YLKI E +LQY S+PWVRY T + ++Y  +
Sbjct: 439 VHENENTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQ 498

Query: 475 L 475
           +
Sbjct: 499 I 499

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  177 bits (450), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 139/511 (27%), Positives = 243/511 (47%), Gaps = 61/511 (11%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M + +      G+ ++S+ ++  +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQH----NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELL 115
           I+     ++L+LVA  T   AN+AAI+ FL+KL  +L +Y    +EE +++ F+I++ELL
Sbjct: 57  IRSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELL 114

Query: 116 DEVM-DYGIPQICE-TKMLKQYITQXXXXXXXXXXX---------XRNATRPPVALT--- 161
           D ++   GIP   E +K++ +   +                      N    P  L    
Sbjct: 115 DVMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRND 174

Query: 162 -----------NSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSK 210
                      N  SWRP+ I HKKNE  L + E IN+L+ + G +L++ + G + + ++
Sbjct: 175 SSQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTR 234

Query: 211 LSGMPDLKLGINDKGIF----SKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXX 266
           LSG P  + G+ND        S+Y   +  T    S+    N+                 
Sbjct: 235 LSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVG------ 288

Query: 267 XXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQV 325
              N+ LED KFHQCV L KF+ E+II F+PPDG  +LM Y +   +  P     +    
Sbjct: 289 ---NVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNS 345

Query: 326 HSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKL 385
            +   ++     K+    + +A  V + IPVP          S+G+ K+VP ++A++WK 
Sbjct: 346 VTGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKF 405

Query: 386 RSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSN-AEILKGPVQIKFQIPYFTTSGIQVR 444
             + G  E ++SA + +PS        + + ++   +  + P+ + F+I  F+ SG+ VR
Sbjct: 406 NKYNGLTENTLSA-VTVPS--------KEVNQTTLQQWARPPMSLDFEILMFSNSGLVVR 456

Query: 445 YLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475
           Y  I+E    YK+  W++Y+++SG  Y +R 
Sbjct: 457 YFTISEGHQNYKAVKWIKYVSKSG-SYEVRF 486

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  172 bits (437), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 144/509 (28%), Positives = 235/509 (46%), Gaps = 76/509 (14%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M + V      G+ ++S+  + +   S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHND---LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+ N    L+LVA+  S  AN+ AI+ FL+K   +L+ +     E ++++ F+  YELLD
Sbjct: 57  IRSNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLD 114

Query: 117 EVMDY-GIPQICETKMLKQYITQX----------------XXXXXXXXXXXRNATRPPVA 159
            +++  G+P   E   +   ++                             RN     V 
Sbjct: 115 LMLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVD 174

Query: 160 LTNS----VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMP 215
             N+      WRP GI +KKNE FL+I E I++L+++   +L++ + G V + S LSG P
Sbjct: 175 TMNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTP 234

Query: 216 DLKLGINDKGIFSK--YLDDDSN------TPPPTSAATSDNIXXXXXXXXXXXXXXXXXX 267
             + G+ND     +  Y + D N        P  +A T                      
Sbjct: 235 TCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGT---------------------- 272

Query: 268 XVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHS 327
              + LED KFH+CV L KF  ++II F+PPDG  +LM Y +   I        NV ++S
Sbjct: 273 ---VVLEDCKFHECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-INS 328

Query: 328 NSR--IEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKL 385
            SR  ++     K+    K +A +V + IPVP          S+G  ++VPE+S I+WK 
Sbjct: 329 RSRTGLDYRITLKSLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKF 388

Query: 386 RSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRY 445
             + G  E  +SA   +   SND            +  + P+ + F+I  F+ SG+ VRY
Sbjct: 389 AKYNGLTENKLSA---VTVSSNDTTQLML-----QQWARPPISLDFEIMMFSNSGLVVRY 440

Query: 446 LKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           LKI E   +Y++  W++YI++SG  Y +R
Sbjct: 441 LKIMEKDQKYRTVKWIKYISRSG-SYEVR 468

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  172 bits (436), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 139/514 (27%), Positives = 236/514 (45%), Gaps = 79/514 (15%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFP-TLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +A++     G+ ++S+ + + +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 60  IQHN--DLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
           I+ N  D   +  V+   AN+ AI+ FL+K   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115

Query: 118 VMDYG-IPQICETKMLKQYIT---------------QXXXXXXXXXXXXRNATRPPVALT 161
           V+  G IP   E   +   I+                             N + P     
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 162 NSVS--------------WRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKV 207
           N+ S              WRP GI +KKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 NSKLSGMPDLKLGINDKGIF----SKYLDDD---SNTPPPTSAATSDNIXXXXXXXXXXX 260
            + LSG P  + G+ND        S +LD     +    P +AA S              
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGS-------------- 281

Query: 261 XXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCD 320
                     + LED KFHQCV L KF  E+II F+PPDG  +LM Y +   +  L +  
Sbjct: 282 ----------VMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKI 330

Query: 321 VNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSA 380
             V     S +E     K+    K +A +V + IPVP          S+G  K+  E++A
Sbjct: 331 TPVVTPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENA 390

Query: 381 ILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSG 440
           ++W+   + G  E ++SA + +P+        +  P+        P+ + F+I  F+ SG
Sbjct: 391 MVWRFNKYHGLTENTLSA-VTVPTSDTTQLTLQQWPRP-------PMSLGFEIMMFSNSG 442

Query: 441 IQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           + VRY ++++   +Y+   W++YI++SG  Y +R
Sbjct: 443 LVVRYFRVSDKDEKYRVVKWIKYISKSG-SYEVR 475

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  173 bits (438), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 153/551 (27%), Positives = 234/551 (42%), Gaps = 123/551 (22%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S V+  D    PL+ R  +    ++  + +      +  QS    P +   G+ Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLK---SIAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 61  QHNDLYLVAIVTS-LRANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYELLDE 117
             + LY V++    LR N   I  +L+    +L  YLK   V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 VMDYGIPQICETKMLKQYI------------TQXXXXXXXXXXXXRNATRPPVA------ 159
            +DYGIPQ+ +  +++  I            +Q            ++      A      
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 160 -------------LTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQK-GQVLRSEIIGDV 205
                         T ++SWRP+GI + KNE F+DI+E  + LM  K  QV ++ + G +
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXX 265
              S LSGMP +++ IN      K L D                                
Sbjct: 236 NCRSYLSGMPIVRVCIN------KMLKDK------------------------------- 258

Query: 266 XXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLI-WCDVN 322
               ++ L   KFHQCV L    ++  I FIPPDG F L  Y+L   I   P+I   D  
Sbjct: 259 ----DLFLGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYK 314

Query: 323 V-QVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDD--------ADTPTFKYSHGSLK 373
           + +     R+ +    +   K +++AT ++I IP  D            P FK  HGS+ 
Sbjct: 315 INERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVF 374

Query: 374 YVPEKSAILWKLRSFPGGK---EYSMSAELGL-------------------PSISND--I 409
           +      +LW  +   GG     YSM  E  L                   P +     +
Sbjct: 375 FNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHL 434

Query: 410 EGHRAIPKSNAEILKGPVQ-----IKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 464
           E   A  KSN E  KG  Q      +F++PY+T+SG++V YLKI+E  L+Y+S+ WVRY 
Sbjct: 435 EELYAQVKSNKE-GKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYK 493

Query: 465 TQSGDDYTIRL 475
           T +  +Y  ++
Sbjct: 494 TINDTEYAYQV 504

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  171 bits (434), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 117/412 (28%), Positives = 200/412 (48%), Gaps = 52/412 (12%)

Query: 48  PCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDN 107
           P L      +  I+ +    + +V    A++AAI+ FL+ + ++L  Y    EE ++ D+
Sbjct: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103

Query: 108 FVIIYELLDEVMDYGIPQICETKMLKQYITQX-XXXXXXXXXXXRNATRPPVALTNSVS- 165
           F++ YELLD V+D G+PQ  E   +   +++              N+ R     T +VS 
Sbjct: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163

Query: 166 ------------WRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSG 213
                       WR EGI +KKNE +LD++E +++L+ + G +L++ + G V+  + LSG
Sbjct: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223

Query: 214 MPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIEL 273
           MP    G ND     +        P        +++                       L
Sbjct: 224 MPLCHFGFNDSQSLRQRSPRRQYAPRVFGTDERESVV----------------------L 261

Query: 274 EDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEI 333
           ED KFHQCV+L+KF+ E++I F+PPDG+F+LM Y +   ++P       V   +   IE 
Sbjct: 262 EDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEY 321

Query: 334 HCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKE 393
               ++    K +A +VE+ IP P    +     S G  K+VPE++AI+WK+  F G  E
Sbjct: 322 RITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTE 381

Query: 394 YSMSAELGLPSISNDIEGHRAIPKSNAEIL----KGPVQIKFQIPYFTTSGI 441
            ++SA     +I+++ +GH       A++L    + P+ +K +I  F+T+ +
Sbjct: 382 NTLSA----VTIADE-QGH------YAQVLDQWPRPPISMKLEIMMFSTAAL 422

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  167 bits (423), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/487 (25%), Positives = 213/487 (43%), Gaps = 112/487 (22%)

Query: 48  PCLNHNGLEYLFIQHNDLYLVAIVTSLRANA-AAIFTFLHKLVEVLSDYL-KTVEEESIR 105
           P L+H G +Y++IQ + LY +++   +       +F +L +L ++   YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEVMDYGIPQICETKMLKQYITQXXXXXXX---XXXXXRNATR------- 155
           DNF ++YEL+DE +D GIPQ+ +  +++ Y+                   A R       
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 156 ----PPVA------------LTNSVSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLR 198
               P  A             T+++SWRP GI + KNE FLD+VE +  LM  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXX 258
           +++ G +   S LSGMP L +G+N      K +  D +                      
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN------KMVAQDRDFT-------------------- 254

Query: 259 XXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTI--KPL 316
                            + FHQCV L +   ++ ITF+PPDG+F L +Y+L+     +PL
Sbjct: 255 ---------------SQVHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPL 299

Query: 317 I---WCDVNVQVHSN----SRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDAD 361
           I    C   V+         R+ +        K +   + +++ +P+         D + 
Sbjct: 300 IKLEECRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSF 359

Query: 362 TPTFKYSHGSLKYVPEKSAILW---KLRSFPGGKEYSMSAELGL----------PSISND 408
            P FK   G + +      +LW   K +   G + ++M ++  L            +S  
Sbjct: 360 PPRFKCDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTS 419

Query: 409 IEGHRAIPKSNAEIL------------KGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYK 456
           ++   A P    E L               +++ F++PY T SG++V +LKI EP+LQY+
Sbjct: 420 MDPLPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQ 479

Query: 457 SYPWVRY 463
           S+PW+RY
Sbjct: 480 SFPWIRY 486

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  164 bits (416), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 130/511 (25%), Positives = 230/511 (45%), Gaps = 68/511 (13%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M +AV      G+ L+ + ++  +  +  D F      +    N+  P L      + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRV---QVINNDNIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
           +    + L+LVA+  S  A++ AI+ +L+KL  ++  Y  T  E+ ++D F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVYGLT-HEDILKDEFIVCHELLDI 115

Query: 118 VMDY-GIPQICE------------TKMLKQYITQXXXXXXXXXXXXRNAT---RPPVALT 161
            +   G+P   E             ++L     +             N+T    P     
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 162 NS----------------VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDV 205
           NS                + WR   I +KKNE  ++++E IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXX 265
            + + LSGMP  ++G+ND         ++++      A+  D +                
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQG--GENAHWTNEDRASNRDAMPDVSGD---------- 283

Query: 266 XXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PL-IWCDVNV 323
                + LE  KFHQCV L K+  + +I FIPPDG+F+LM Y +S  +  P  I   V +
Sbjct: 284 ----RVILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTL 339

Query: 324 QVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILW 383
             H  + +    K K+   RK +A NV + IPVP          S G  K++PE++ ++W
Sbjct: 340 TSHGTA-LSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVW 398

Query: 384 KLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQV 443
               F G  E  ++A+         +       +S  +  + P+ + F++  F+ +G+ V
Sbjct: 399 SFHRFNGSTENHLNAQ--------TVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIV 450

Query: 444 RYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
           RYLK+ E  + Y +  W++YI+ +G  Y +R
Sbjct: 451 RYLKVQEKNMHYNTIKWIKYISAAG-SYEVR 480

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  154 bits (390), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 140/552 (25%), Positives = 230/552 (41%), Gaps = 122/552 (22%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAID-KFPTLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M+S     D   +PL+ R  R   P+  +D     L ++L+       P    NG  Y  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLK----TVEEESIRDNFVIIYELL 115
           I  ++LY   I+     N+ +  + LH L E+     K     + + ++RDNF +I+E++
Sbjct: 58  ITRDNLYFAMIMQV--NNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVI 115

Query: 116 DEVMDYGIPQICETKMLKQYITQXXXXXXXXXXXXRNATR--PP-------------VAL 160
           +E  DYGI Q+    ++  +I               +     PP               +
Sbjct: 116 EESSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTM 175

Query: 161 TNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKL 219
           T++VSWRP+GI + KNE FLD++E +  +M  +  V+R+ +I G +   S LSGMP L +
Sbjct: 176 TSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSI 235

Query: 220 GINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
           G+N                         N+                       ++ LKFH
Sbjct: 236 GLN--------------------KLMQKNVHF---------------------MKRLKFH 254

Query: 280 QCVRLSKF--ENEKIITFIPPDGKFDLMNYRLSTTI--KPLIWCD---VNVQVHSNSRIE 332
           +CV L     E   +I FIPPDG+F+L NY+L+  +  +P+I      ++ +   N   +
Sbjct: 255 ECVDLHTLIKEESPVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQ 314

Query: 333 IHCKAKAQI----KRKSTATNVEIIIPVP--------DDADTPTFKYSHGSLKYVPEKSA 380
                KA I    K + +A  + I IP+         D    P FK   G + +     +
Sbjct: 315 DKLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGS 374

Query: 381 ILWKLRSFPGG---KEYSMSA--ELGLPSISNDIEGHRAIPKSNAEILKGP--------- 426
           I+WK+ +  GG   K Y +    E+    I   +E           +  GP         
Sbjct: 375 IIWKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQY 434

Query: 427 ----------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 464
                                 + + F+IPY+  SG++V Y KI EP+L Y+S+PWVRY 
Sbjct: 435 HGKTTEYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYK 494

Query: 465 TQSGDDYTIRLT 476
           T + ++Y  +++
Sbjct: 495 TVNDNEYIYQVS 506

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  154 bits (388), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 160/315 (50%), Gaps = 22/315 (6%)

Query: 162 NSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           N ++WRP+GIIHKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPVCRFGL 255

Query: 222 NDK-GIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQ 280
           ND  G+ S   +D  N        + +                      ++ LED KFH+
Sbjct: 256 NDSLGMQS---EDQENWLSQQDQHSHNGFENKNCFPKAAAG--------SVLLEDCKFHE 304

Query: 281 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKAKA 339
           CV + KF    II F+PPDG  +LM Y +   I  P     +      ++ ++     K+
Sbjct: 305 CVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEVDYRITLKS 364

Query: 340 QIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAE 399
               K +A +V + IPVP          S+G+ K+VPE++A++W+   F G  E ++SA 
Sbjct: 365 LFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTENTLSAV 424

Query: 400 LGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYP 459
               S +  +        S  +  + P+ + F++  F+ SG+ VRY  I+    ++++  
Sbjct: 425 TVSTSDTTQL--------SLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVK 476

Query: 460 WVRYITQSGDDYTIR 474
           W++YI++SG  Y +R
Sbjct: 477 WIKYISKSG-SYEVR 490

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 74/129 (57%), Gaps = 11/129 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S    P L      +  
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 60  IQH---NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLD 116
           I+    ++L+LV I  S  AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD
Sbjct: 57  IRSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLD 114

Query: 117 EVM-DYGIP 124
            ++   GIP
Sbjct: 115 IMLGGNGIP 123

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  153 bits (387), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/315 (29%), Positives = 160/315 (50%), Gaps = 22/315 (6%)

Query: 162 NSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           N ++WRP+GIIHKK+E FL + E IN+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQ 280
           ND  G+ S+  D+          + SD                      ++ LED KFH+
Sbjct: 256 NDSLGMQSE--DEKKWLAQQQRHSGSD---------FGNKNFIPKAAAGSVLLEDCKFHE 304

Query: 281 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKAKA 339
           CV L KF    II F+PPDG  +LM Y +   I  P     +      ++ I+     K+
Sbjct: 305 CVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDYRITLKS 364

Query: 340 QIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAE 399
               K +A +V + IPVP          S+G  K+VPE++A++W+   + G  E ++SA 
Sbjct: 365 LFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTLSAV 424

Query: 400 LGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYP 459
               S +  +           +  + P+ ++F++  F+ SG+ VRY  I+    ++++  
Sbjct: 425 TVSTSDTTQLNLQ--------QWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSKHRAVK 476

Query: 460 WVRYITQSGDDYTIR 474
           W++YI+++G  Y +R
Sbjct: 477 WIKYISKAG-SYEVR 490

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 75/127 (59%), Gaps = 7/127 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
            +H D L+LV I  S  AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD +
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 M-DYGIP 124
           +   GIP
Sbjct: 117 LGGNGIP 123

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  152 bits (384), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 122/444 (27%), Positives = 200/444 (45%), Gaps = 70/444 (15%)

Query: 65  LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM-DYGI 123
           L++VAI  S  AN+  I+ FL+KL  +L+ Y     EE + + F++ YE++D ++    +
Sbjct: 65  LWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 124 PQICETKMLKQYIT----QXXXXXXXXXXXXRNATRPPVALTNS---------------V 164
           P   E   +   I+    +             N    P  LT +               +
Sbjct: 123 PINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQSDI 182

Query: 165 SWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK 224
            WRP GI +KKNE FL + E IN+L+++   +L++ + G + + S LSG P  + G+ND 
Sbjct: 183 PWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLND- 241

Query: 225 GIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXX-----XXXXXXXVNIELEDLKFH 279
                YL           + T +NI                         ++++ED  FH
Sbjct: 242 -----YL-----------SMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFH 285

Query: 280 QCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEI---HCK 336
           QCV L KF +E++I F+PPDG F+LM Y +          D+N+      R+ I    C 
Sbjct: 286 QCVSLDKFNDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCS 337

Query: 337 AKAQIKRKS------TATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPG 390
            + +I  KS      +A +  + IP+P          S G   +    +  +WK   + G
Sbjct: 338 MRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKG 397

Query: 391 GKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINE 450
             E  +  E  +PS S DI        S  +  + P+ + F+I  F+ SG+ V+YLK+ E
Sbjct: 398 LTENELILE-TVPSSSTDI-------LSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVME 449

Query: 451 PKLQYKSYPWVRYITQSGDDYTIR 474
              +Y+   W++Y+++SG  Y IR
Sbjct: 450 RVQKYRPVKWIKYVSKSG-SYEIR 472

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  150 bits (379), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 124/503 (24%), Positives = 218/503 (43%), Gaps = 117/503 (23%)

Query: 48  PCLNHNGLEYLFIQHNDLYLVAIVTSL-RANAAAIFTFLHKLVEVLSDYL-KTVEEESIR 105
           P L +   +Y+FIQ + LY +++   L       +F++L++L  +   YL + + +  I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 106 DNFVIIYELLDEVMDYGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPV------- 158
            NF +I+EL+DE +  G PQ+ +  +++ YI +            R AT           
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYI-KVQVVKDSPEPATREATVTNTKKNKKKD 159

Query: 159 ----------------------ALTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQV 196
                                   T+++SWRP+GI + KNE +LD++E +  L+  +   
Sbjct: 160 SKKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMN 219

Query: 197 LRSEII-GDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXX 255
           ++S  + G ++  S LSGMP L +G+N     ++Y    +N                   
Sbjct: 220 IKSNTVYGYIQCRSYLSGMPMLTIGLNKLNSENEYFMRRAN------------------- 260

Query: 256 XXXXXXXXXXXXXVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK- 314
                                 FHQCV L +   +K+I+F PPDG+F L NY+L+  +  
Sbjct: 261 ----------------------FHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSD 298

Query: 315 -PLIW---CDVNVQVHSNS----RIEIHCKAKAQIKRKSTATNVEIIIPVP--------D 358
            P+I    C V ++         R+ +        K + + + + I +P+         D
Sbjct: 299 PPMIKLEDCKVKLKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVD 358

Query: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGG---KEYSMSAELGLPSISNDIEGHRAI 415
            +  P FK   G + +      +LW++    GG   K   M +E  L +  ++    + +
Sbjct: 359 LSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQL 418

Query: 416 PKSN--AEILKGP---------------------VQIKFQIPYFTTSGIQVRYLKINEPK 452
             S     I +GP                     ++++F+IPY+T SG++V +LKI E +
Sbjct: 419 SNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQ 478

Query: 453 LQYKSYPWVRYITQSGDDYTIRL 475
           LQ++S+PWVRY T + D Y  +L
Sbjct: 479 LQFQSFPWVRYKTINHDIYAYQL 501

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  148 bits (374), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 90/315 (28%), Positives = 155/315 (49%), Gaps = 22/315 (6%)

Query: 162 NSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGI 221
           N ++WRP+GI HKK+E FL + E +N+L+++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 222 NDK-GIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQ 280
           ND  G+ S   +D+          +  N                     ++ LED KFH+
Sbjct: 256 NDSLGMQS---EDEKKWLAQQQHHSRGNFESKNFIHKAAAG--------SVLLEDCKFHE 304

Query: 281 CVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKAKA 339
           CV L KF     I F+PPDG  +LM Y +   I  P     +      ++ I+     K+
Sbjct: 305 CVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRITLKS 364

Query: 340 QIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAE 399
               K +A +V + IPVP          S+G  K+VPE++A++W+   + G  E ++SA 
Sbjct: 365 LFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSAV 424

Query: 400 LGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYP 459
               S +  +           +  + P+ + F++  F+ SG+ VRY  I     ++++  
Sbjct: 425 TVSTSDTTQLNLQ--------QWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVK 476

Query: 460 WVRYITQSGDDYTIR 474
           W++YI++SG  Y +R
Sbjct: 477 WIKYISRSG-SYEVR 490

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 75/127 (59%), Gaps = 7/127 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
            +H D L+LV I  S  AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD +
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 M-DYGIP 124
           +   GIP
Sbjct: 117 LGGNGIP 123

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  148 bits (373), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/316 (28%), Positives = 159/316 (50%), Gaps = 22/316 (6%)

Query: 161 TNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLG 220
           +N ++WR  GIIHKK+E FL + E +N+L+++ G +L+S + G + + + L+G P  + G
Sbjct: 195 SNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDIVTHLNGTPVCRFG 254

Query: 221 INDK-GIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
           +ND  G+ S   +D+ N        +  +                     ++ LED KFH
Sbjct: 255 LNDSLGMQS---EDEKNWLAQQHQHSRSDFGNKNFLPKAAAG--------SVLLEDCKFH 303

Query: 280 QCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIWCDVNVQVHSNSRIEIHCKAK 338
           +CV + KF    II FIPPDG  +LM Y +   I  P     +      ++ I+     K
Sbjct: 304 ECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEIDYRITLK 363

Query: 339 AQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSA 398
           +    K +A +V + IPVP          S+G  K+VPE++A++W+   + G  E ++SA
Sbjct: 364 SLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTLSA 423

Query: 399 ELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSY 458
                S +  +        S  +  + P+ + F++  F+ SG+ VRY  I+    ++++ 
Sbjct: 424 ATVSTSDTTQL--------SFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAV 475

Query: 459 PWVRYITQSGDDYTIR 474
            W++YI++SG  Y +R
Sbjct: 476 KWIKYISKSG-SYEVR 490

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 75/127 (59%), Gaps = 7/127 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M S V      G+ +L++ +++ +  S  D F   ++++L+ +S ++   L      ++ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
            +H D L+LV I  S  AN+AAI+ FL+KL  V++ Y +   EE++++ F+I++E+LD +
Sbjct: 59  SKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 M-DYGIP 124
           +   GIP
Sbjct: 117 LGGNGIP 123

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  137 bits (344), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/507 (23%), Positives = 229/507 (45%), Gaps = 67/507 (13%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPT-LLSDLEEQSNLIPPCLNHNGLEYLF 59
           M +AV      G+ ++S+ ++  +  S  D F   +++ L+ +S ++   L      Y+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  IQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
                L++V+ V+    N+AA + FL+K   +L+ Y +   EE +++ F++ +ELLD ++
Sbjct: 59  TPGEGLWVVS-VSRNNENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTMV 116

Query: 120 DYG-IPQICETKML---------------------KQYITQXXXXXXXXXXXXRNATRPP 157
           + G IP   +   +                     +Q  T               A+ P 
Sbjct: 117 EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNP- 175

Query: 158 VALTNSVSWRP----EGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSG 213
                 +S  P    +G   K+NE  + + ESI++L+++ G +L++ + G + + +KL G
Sbjct: 176 ----GGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEG 231

Query: 214 MPDLKLGINDKGIFSKYLDDDSNT---PPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVN 270
               + G+ND    S   D+ SN+   P  +      N+                     
Sbjct: 232 AAVCQFGLND----SLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVG------------T 275

Query: 271 IELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSR 330
           + L D KFHQCV L +F+ ++II F PP+G  +LM Y +   +         V   +N+ 
Sbjct: 276 VLLRDCKFHQCVSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNE 335

Query: 331 IEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPG 390
            +     K+    K +A NV + IPVP          S+G+ K++PE++A++WK   + G
Sbjct: 336 TDYRVTIKSLFPGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNG 395

Query: 391 GKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKI-- 448
             E  +SA + +P+             +  +  + P+ + F+I  ++ +G+ VRY  +  
Sbjct: 396 LTENKLSA-ITVPT-------RDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLD 447

Query: 449 -NEPKLQYKSYPWVRYITQSGDDYTIR 474
            +    ++K+  W++Y++ SG  Y +R
Sbjct: 448 KHNNNTKFKTVKWIKYVSHSG-SYEVR 473

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  133 bits (335), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 111/377 (29%), Positives = 160/377 (42%), Gaps = 105/377 (27%)

Query: 161 TNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKL 219
           T +VSWR +GI + KNE FLD+VES+  LM  K +V+R  +I G +K  S LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
            +N      K L DD                                      L   KFH
Sbjct: 282 ALN------KILQDDKQF-----------------------------------LGHAKFH 300

Query: 280 QCVRLS--------------------KFENEKIITFIPPDGKFDLMNYRLSTTIK-PLIW 318
           QCV L+                     F N+K I FIPPDG+F L  Y L   +K P + 
Sbjct: 301 QCVSLNSINIKDLEKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVI 360

Query: 319 CDVNVQVHSN---SRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPTFKY 367
              +  +  N    R++I  K +   KR+++ + + I IP+         D +  P FK 
Sbjct: 361 NMTSFDIKPNFKKFRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKS 420

Query: 368 SHGSLKYVPEKSAILWKLRSFPGG---KEYSMSAELGL---------------------- 402
             G + +   +  ++W++ +  GG    E  M AE  L                      
Sbjct: 421 DVGKVLFNISEDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPL 480

Query: 403 ---PSISNDIEGHRAIPKSNAEILKGPVQ---IKFQIPYFTTSGIQVRYLKINEPKLQYK 456
              P +    E       +    LK   Q   ++F+IPY T SG++V YLKI E  L+Y+
Sbjct: 481 RNGPKLEELYEEMHENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQ 540

Query: 457 SYPWVRYITQSGDDYTI 473
           S+PWVRY T + D+Y  
Sbjct: 541 SFPWVRYKTLNDDEYAF 557

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 73/142 (51%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQ-SNLIPPCLNHNGLEYLF 59
           M+S ++  D   +PL+S+  +       +   P ++   +E  +   PP +  +   Y++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IQHNDLYLVAIVTSLR---ANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYEL 114
           ++ + L+ VA +  +     N   I  +L +L  +L +Y K   + +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEVMDYGIPQICETKMLKQYI 136
           +DE +D+GI Q+ +  +++ YI
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYI 136

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  124 bits (310), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 105/357 (29%), Positives = 155/357 (43%), Gaps = 88/357 (24%)

Query: 161 TNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKL 219
           T  VSWR +GI + KNE FLD+VE +  L   K +V+R  +I G +   S LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
            +N      K L  D+                                     +   KFH
Sbjct: 293 ALN------KLLQRDAQF-----------------------------------MSHSKFH 311

Query: 280 QCVRLSKFENEKIITFIPPDGKFDLMNYRLS-----TTIKPLIWCDVNVQVHSNSRIEIH 334
           QCV L    NEK + FIPPDG+F L  Y L      T I  +   ++  Q+    ++ I 
Sbjct: 312 QCVALETL-NEKELEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRIL 369

Query: 335 CKAKAQIKRKSTATNVEIIIPVPD-------DADTPT-FKYSHGSLKYVPEKSAILWKLR 386
              +   K +++ + + + IP+         D   PT FK + G + +      +LW++ 
Sbjct: 370 LTIETHFKTRNSTSILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIG 429

Query: 387 SFPGGK---EYSMSAELGL-----PSISNDIEGHRAIP------------------KSNA 420
              GG    ++SM AE  L          +   H   P                  + + 
Sbjct: 430 QMRGGHGETQFSMVAEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDP 489

Query: 421 EILKGPVQ-----IKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 472
           E+L   +Q     + F+IPY T SG++V YLKI E +LQY+S+PWVRY T S ++Y 
Sbjct: 490 EVLVKSIQSQLVGMDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 65/141 (46%), Gaps = 11/141 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S +Y  D N +PL+S+       + +I    TL+   +E  S+  PP + +    ++ 
Sbjct: 1   MSSCLYILDENLEPLISKN------IKSIPNLNTLVEVFQEVYSSNAPPIVFNRNWYFIH 54

Query: 60  IQHNDLYLVAIV--TSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDE 117
            + + L  ++ +  T   ANA  I  ++ +   +L  YL   + +       ++  L   
Sbjct: 55  TKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVLDNVLLVLELL 114

Query: 118 VM--DYGIPQICETKMLKQYI 136
               ++G+PQ+ E  ++K YI
Sbjct: 115 EESSEFGVPQMTEPSVMKDYI 135

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  122 bits (305), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 101/351 (28%), Positives = 151/351 (43%), Gaps = 88/351 (25%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + +NE FLD+VE +  LM     +++  +I G +   S LSGMP LK+   
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIA-- 273

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
               F+K    D                                      +   KFHQCV
Sbjct: 274 ----FNKLSQKDEQF-----------------------------------ISHSKFHQCV 294

Query: 283 RLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHCKA 337
                 NEK I FIPPDG F L  Y L   +K      L+   V  ++    +I++ C  
Sbjct: 295 TWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKLVSFGVKPKL-KKYKIQMSCTI 352

Query: 338 KAQIKRKSTATNVEIIIPVPD-------DADTPT-FKYSHGSLKYVPEKSAILWKLRSFP 389
           +   K +++ + + + IP+         D   P  FK   G + +      +LW +    
Sbjct: 353 ETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMK 412

Query: 390 GGK---EYSMSAELGL-------------------PSISNDIEGHRAIPKSNAEILKGP- 426
           GG    + SM+AE  L                   P + +  +      + + E  KGP 
Sbjct: 413 GGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNE--KGPS 470

Query: 427 ------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 471
                 + +KF+IPY T SG+QV YLKI+E +LQY+S+PWVRY T + ++Y
Sbjct: 471 KMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 73/140 (52%), Gaps = 9/140 (6%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S ++  D N +PL+S+  +    L  I +    +   E Q     P ++ +   ++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHNDLYLVAIVTSL--RANAAAIFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELLD 116
           + + L  V+++ +    AN   I TFL +   +L  YL    +++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EVMDYGIPQICETKMLKQYI 136
           E +D+G+ QI +  +++ YI
Sbjct: 116 ESIDFGVIQITDASIMRDYI 135

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  120 bits (300), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 106/392 (27%), Positives = 163/392 (41%), Gaps = 128/392 (32%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD++E +  L+  + G V RS I G +   S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K L +D                                      +  ++FHQCV
Sbjct: 309 ------KLLQNDKQF-----------------------------------ISQVQFHQCV 327

Query: 283 RLSKFEN----------------------EKIITFIPPDGKFDLMNYRLSTTIK--PLI- 317
            L   E                       E  I FIPPDG F L +Y L   I+  P++ 
Sbjct: 328 SLDSIEKVIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVK 387

Query: 318 WCDVNVQVH-SNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD-------DADTP-TFKYS 368
            C   +       +++I    +   K  ++ + +++ IP+         D   P  FK S
Sbjct: 388 LCSFEITPKWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTS 447

Query: 369 HGSLKYVPEKSAILWKLRSFPGGKEY-------------SMSAELGL------------- 402
           +G + Y      +LW++    GGK +             +M+AE GL             
Sbjct: 448 NGRVVYNISDDFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKER 507

Query: 403 ------------PSISN-------DIEGHRAI---PKSNAEILKGPVQIKFQIPYFTTSG 440
                       P + +       + +G+ ++   PK+N  +L     + F+IPY T SG
Sbjct: 508 ETSMNPPPLRTGPKLEDIYKETHEENDGYNSVGQKPKNNLNLL----SMDFEIPYCTCSG 563

Query: 441 IQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 472
           ++V YLKI+E +LQY+S+PWVRY T + D+Y 
Sbjct: 564 LKVEYLKIDEDQLQYQSFPWVRYKTINDDEYA 595

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 78/141 (55%), Gaps = 10/141 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S++Y  D   +PL+S+  +    L  +++   L      QS    P ++     +++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHNDLYLVAIVTSLR---ANAAAIFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELL 115
           + + LY VA+V +     AN  AI T+L +L ++  DY+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEVMDYGIPQICETKMLKQYI 136
           DE +DYGI Q+ E  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 157/382 (41%), Gaps = 117/382 (30%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +   M  K  V+R  +I G++   S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K L  D                                      L ++KFHQCV
Sbjct: 310 ------KILKQDVQF-----------------------------------LSNVKFHQCV 328

Query: 283 RL---------------SKFENEKI--------ITFIPPDGKFDLMNYRLSTTIK--PLI 317
            L                K +NE+         I FIPPDG+F L  Y L   +K  P+I
Sbjct: 329 SLDSIRARSNPPAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMI 388

Query: 318 WC---DVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPTFK 366
                ++  ++H   +I+IH   +   K  ++ + + + IP+         D +  P FK
Sbjct: 389 KLRNFEIIPKLHK-FKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFK 447

Query: 367 YSHGSLKYVPEKSAILWKLRSFPGG---KEYSMSAELGL--------------------- 402
              G++ +      +LW++ +  GG      SM AE  L                     
Sbjct: 448 CEQGTVLFNLSDKFLLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPP 507

Query: 403 -----------PSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEP 451
                        I  + +      +   E L   + + F++PY T SG+++ YLKI E 
Sbjct: 508 LREGPKLEELYKKIHEEGDSDEVSTRKKNESL---LTMDFEVPYCTCSGLKIEYLKIEED 564

Query: 452 KLQYKSYPWVRYITQSGDDYTI 473
           +LQY+S+PWVRY T S D+Y  
Sbjct: 565 QLQYQSFPWVRYKTISDDEYAF 586

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 81/143 (56%), Gaps = 13/143 (9%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEE--QSNLIPPC--LNHNGLE 56
           M+S+++  D   +P++ +  R      A+   P+L++  +E  +SN + P   LN    +
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFIQHNDLYLVAIV-TSLRANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYE 113
           +L I+ + L  +++V  + R N   +FT+L +  ++L DYL    +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEVMDYGIPQICETKMLKQYI 136
           L+DE +D+G+ Q  ++ ++K Y+
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYV 137

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 157/365 (43%), Gaps = 98/365 (26%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           VSWR +GI + KNE FLD++E +  LM    G++ ++ I G++K    LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K + +D                                      + + KFHQCV
Sbjct: 276 ------KLIKNDEQF-----------------------------------ISNSKFHQCV 294

Query: 283 RLSKFE------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWCDVNVQVH-- 326
            ++  +            + K I FIPPDG+F L  Y L   ++  P+I    N+++   
Sbjct: 295 SINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIKPK 353

Query: 327 -SNSRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHGSLKYVPE 377
               +I+IH   +   K++++ + + I IP+         D    P FK   G + +   
Sbjct: 354 LKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNIS 413

Query: 378 KSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAE-----ILKGP------ 426
              ++W++ S  GG   S +  +    I N  E  R   +         + +GP      
Sbjct: 414 DDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIY 473

Query: 427 -------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQS 467
                              + +KF++PY T SG++V YLKI E ++ Y+S+PWVRY T +
Sbjct: 474 EQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTIN 533

Query: 468 GDDYT 472
            D+Y 
Sbjct: 534 DDEYA 538

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 74/141 (52%), Gaps = 10/141 (7%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M+S ++  D + +PL+S+  +    L+ I +F  L  + +E     PP        Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKL--NYKENG---PPVFTVLEWHYVFI 55

Query: 61  QHNDLYLVAIV--TSLR-ANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYELL 115
           + + L+ +  +  T  R  N  A+  +L +L  +L  Y    +++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEVMDYGIPQICETKMLKQYI 136
           DE MD+GI Q+ +  ++K YI
Sbjct: 116 DESMDFGIVQLTDPSIIKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  115 bits (287), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 93/358 (25%), Positives = 149/358 (41%), Gaps = 90/358 (25%)

Query: 163 SVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGI 221
           SVSWR +GI + KNE FLD++E +   M     +++  +I G++   S LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQC 281
           N      K +  D                                      L   KFHQC
Sbjct: 282 N------KIIYQDKQF-----------------------------------LSSCKFHQC 300

Query: 282 VRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHCK 336
           V     +  K++ F+PPDG F L  Y L   +       LI  +V  ++    ++++   
Sbjct: 301 VMPDSVDEGKVLEFVPPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVT 359

Query: 337 AKAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLRSF 388
            ++  K+ ++ T + I IP+         D +     +   G + +      +LW++ + 
Sbjct: 360 IESTFKKTNSTTKLNIKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAM 419

Query: 389 PGGK-EYSMSAELGLPSISNDIEGH------------RAIPK------------------ 417
            GG  +  M A+  L +    +               R  PK                  
Sbjct: 420 KGGNSQLKMGADFALFNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTR 479

Query: 418 ---SNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 472
              S+ E     +++ F+IPY T+SG++V YLKI EP LQY+++PWVRY T S D Y 
Sbjct: 480 KGESSDETKGNLIKMDFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 72/142 (50%), Gaps = 14/142 (9%)

Query: 1   MASAVYFCDHNGKPLLSRRYRD----DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLE 56
           M+S +Y  + + + LLS+  +     DIPLS       L      +  +  P + +    
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLS-------LFKKQFHKHQVTTPVIIYEDYI 53

Query: 57  YLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           +  IQ + LY V+ +   + N      +L++   +L +Y  +K +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVSSI-DCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDEVMDYGIPQICETKMLKQYI 136
           ++E +D+GI QI ++ ++K YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 99/366 (27%), Positives = 162/366 (44%), Gaps = 82/366 (22%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DKGIFSKYLDDDSNTPPPTS---AATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
                 K L+ D+     +S     + D+I                     IE  + K  
Sbjct: 320 ------KILNRDAQFLSNSSFHQCVSLDSIK-------------------TIEKREEKED 354

Query: 280 QCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC-DVNVQVH-SNSRIEIHC 335
               L    + K + F+PPDG+F L  Y L   +K  P+I   D  ++      +I+I  
Sbjct: 355 DDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIET 414

Query: 336 KAKAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLRS 387
           K +   K  ++ + + + IP+         D +    FK + G + +      +LW++++
Sbjct: 415 KIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQA 474

Query: 388 FPGGKEY----------------SMSAELGLPSIS--NDIEGHRAIPKSNAEILKGP--- 426
             G +E+                SM AE  L +    + ++  +    +   +  GP   
Sbjct: 475 MKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLE 534

Query: 427 --------------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQ 466
                               V I F+IPY T SG+++ YLK+ EP+LQY+S+PWVRY T 
Sbjct: 535 ELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTT 594

Query: 467 SGDDYT 472
           S D+Y 
Sbjct: 595 SDDEYA 600

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYR-DDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M+S+++  D N + L+S+  R      S +  F     D        PP L+ N   ++ 
Sbjct: 1   MSSSLFILDENLELLVSKNIRALPSLSSVLSSFKQCYHDEA------PPILSQNDWFFIH 54

Query: 60  IQHNDLYLVAIV-TSLRAN--AAAIFTFLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           ++ + L+ V+++ T+ + N     I  FL +   +L +Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTKDVILDNVLLVLEL 114

Query: 115 LDEVMDYGIPQICETKMLKQYI 136
           +DE +D+GI Q+ +  ++K YI
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYI 136

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  112 bits (281), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 101/382 (26%), Positives = 161/382 (42%), Gaps = 114/382 (29%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++   S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K L+ D     P   + S+                              FHQCV
Sbjct: 313 ------KILNRD-----PQFMSNSN------------------------------FHQCV 331

Query: 283 RLSKFE-------------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC-D 320
            L                       + + I F+PPDG+F L  Y L   +K  P+I   D
Sbjct: 332 SLDSINTIEKGQEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKD 391

Query: 321 VNVQVH-SNSRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHGS 371
             ++     S+I+I  K +   K  ++ + + + IP+         D +    FK ++G 
Sbjct: 392 FEIKPKLKKSKIQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGK 451

Query: 372 LKYVPEKSAILWKLRSFPGGKEY----------------SMSAELGLPSIS--NDIEGHR 413
           + +      +LW++++  G +E                 SM AE  L +    + ++   
Sbjct: 452 VVFNLSDDFLLWEIQTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEM 511

Query: 414 AIPKSNAEILKGP-----------------------VQIKFQIPYFTTSGIQVRYLKINE 450
               +   +  GP                       V I F+IPY T SG++V YLK+ E
Sbjct: 512 KTSMNPPPLRTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEE 571

Query: 451 PKLQYKSYPWVRYITQSGDDYT 472
           P+LQY+S+PWVRY T + ++Y 
Sbjct: 572 PQLQYQSFPWVRYKTVNDEEYA 593

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 80/142 (56%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S+++  D + +P++S+  R      A+    ++LS  ++   +  PP L  N   ++ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 60  IQHNDLYLVAIV-TSLRAN--AAAIFTFLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           ++ + L+LV+++ T+ + N     I  FL +   +L  Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 115 LDEVMDYGIPQICETKMLKQYI 136
           +DE +D+GI Q+ +  ++K YI
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYI 136

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  112 bits (279), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 93/370 (25%), Positives = 154/370 (41%), Gaps = 105/370 (28%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FL+++E +   M     V++  +I G+++    LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K +++D                                      L + KFHQCV
Sbjct: 313 ------KIVNEDKQF-----------------------------------LANCKFHQCV 331

Query: 283 RLSKFE--NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWCDVNVQVHSNSRIEIHCKAK 338
            L+  E  + K + F+PPDG+F L  Y L   ++  P++   VN +V    +        
Sbjct: 332 SLASLESSDHKDVEFVPPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLL 390

Query: 339 A-QIKRKSTATNVEIIIPVP----------DDADTPTFKYSHGSLKYVPEKSAILWKLRS 387
             +   K+T    ++ + VP          D +     K   G++ +      +LW++ S
Sbjct: 391 TIETHFKTTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGS 450

Query: 388 FPGGK---EYSMSAELGL-------------------------PSI-------------- 405
             GG    + SM  E  L                         P +              
Sbjct: 451 MSGGHGETQLSMGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDD 510

Query: 406 ---SNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVR 462
              +  +  HR  P++    +   + + F++PY T+SG++V YLKI EP+L+Y+S+PWVR
Sbjct: 511 DGNTEPVAEHRLQPRTRE--IDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVR 568

Query: 463 YITQSGDDYT 472
           Y T S  +Y 
Sbjct: 569 YTTLSDAEYA 578

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 69/139 (49%), Gaps = 8/139 (5%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLS-AIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLF 59
           M+S +Y  D N + L+S+  +    L   I +F  L       SN  P    H+   + +
Sbjct: 1   MSSVLYILDENLETLISKNIKAVPSLEYPIAQFKKLYG-----SNAPPVIDYHDLFTFTY 55

Query: 60  IQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYL--KTVEEESIRDNFVIIYELLDE 117
           IQ + L  V++V  +         +L    EVL +YL  K +++  + DN V+I EL++E
Sbjct: 56  IQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIEE 115

Query: 118 VMDYGIPQICETKMLKQYI 136
            +D+G  Q+ ++ +L  YI
Sbjct: 116 TIDFGAIQVTDSGLLADYI 134

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 121/501 (24%), Positives = 218/501 (43%), Gaps = 99/501 (19%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           M SA+      G+ ++S+ YR++I  S  + F   + +     N+  P L      +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVIN---NFNVRSPILTLGSTTFHHI 57

Query: 61  QH-------NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYE 113
           +        ++L+LV  V    AN+AAI+ FL KL  +L  Y  T  E  ++D F+ ++E
Sbjct: 58  RSTANDPTDDELWLVC-VNRNNANSAAIWEFLQKLNLILQQYGIT-SESKLKDEFMTVHE 115

Query: 114 LLDE-VMDYGIPQICETKMLKQYI-------TQXXXXXXXXXXXXRNA--TRPPVALTNS 163
           +LD  ++  GI Q  + K +   +       T             RN   T P    +  
Sbjct: 116 ILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLI 175

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIND 223
            + R +   HKKNE F  + ES+N+L+++ G +L++ + G +++ S L+G P  +     
Sbjct: 176 PTNRHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQF---- 229

Query: 224 KGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCVR 283
                + +DD +                                    ++ D KF QC+ 
Sbjct: 230 -----ELVDDQT------------------------------------KITDFKFDQCIE 248

Query: 284 LSKFENEKIITFIPPDGKFDLMNYRLST-------TIKPLIWCDVNVQVHSNSRIEIHCK 336
             +    + +     DG+ +++NY +          I P++     V+   + RI +   
Sbjct: 249 KVQ---SRTVRVAATDGELEIVNYHVRDDKINIPFKITPIV---STVKDTVDYRISL--- 299

Query: 337 AKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSM 396
            K+   +  +AT+V + IPVP +        S+G  K+  E++A++W    F G  E ++
Sbjct: 300 -KSLFPKNLSATDVVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTL 358

Query: 397 SAELGLPSISNDIEGHRAIPKSNAEILKGP-VQIKFQIPYFTTSGIQVRYLKINEP-KLQ 454
           SA          I   R I   N E    P +Q+ F+I  ++ SG+ +R L I +  K +
Sbjct: 359 SAI--------TIADGRQI--MNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRR 408

Query: 455 YKSYPWVRYITQSGDDYTIRL 475
           YK+  W++YI+++G  Y +R 
Sbjct: 409 YKASRWIKYISRAG-SYEMRF 428

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  110 bits (275), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 101/384 (26%), Positives = 155/384 (40%), Gaps = 117/384 (30%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K L+ D     P   + S                              KFHQCV
Sbjct: 312 ------KLLNRD-----PQFMSNS------------------------------KFHQCV 330

Query: 283 RLSKFE------------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLI---WC 319
            L                      + K I FIPPDG+F L  Y L   +K  P+I     
Sbjct: 331 SLDSINIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGF 390

Query: 320 DVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHGS 371
           ++  ++    +I+I  K +   K  ++ + + + IP+         D +    FK + G 
Sbjct: 391 EIKPKL-KKFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGK 449

Query: 372 LKYVPEKSAILWKLRSFPGGKEY---------------SMSAEL---------------- 400
           + +      +LW++ +  G +E                SM AE                 
Sbjct: 450 VVFNLSDDFLLWEIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELK 509

Query: 401 ------------GLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKI 448
                        L  +   +   R +   +       V + F+IPY T SG++V YLK+
Sbjct: 510 TSMNPPPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKV 569

Query: 449 NEPKLQYKSYPWVRYITQSGDDYT 472
            EP+LQY+S+PWVRY T S D+Y 
Sbjct: 570 EEPQLQYQSFPWVRYKTISDDEYA 593

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 78/142 (54%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNL-IPPCLNHNGLEYLF 59
           M+S+++  D + +PL+S+  R      AI    ++LS  ++  +   PP L+ NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYLVAIVTSL---RANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVIIYEL 114
           ++ + L+ ++++ +      +  +I  FL +   +L  Y +   + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEVMDYGIPQICETKMLKQYI 136
           +DE +D+GI Q+ +  ++K YI
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYI 136

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  109 bits (272), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 101/386 (26%), Positives = 158/386 (40%), Gaps = 118/386 (30%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +  LM  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K L+ D     P   + S                               FHQCV
Sbjct: 318 ------KILNRD-----PQFMSNS------------------------------SFHQCV 336

Query: 283 RLSKFE--------------------NEKIITFIPPDGKFDLMNYRLSTTIK--PLIWC- 319
            L                        + + I FIPPDG+F L  Y L   +K  P++   
Sbjct: 337 SLDSINTIEKDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLK 396

Query: 320 DVNVQVH-SNSRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHG 370
           D  ++      +I+I  K +   K  ++ + + + IP+         D +    FK + G
Sbjct: 397 DFEIKPKLKKFKIQIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIG 456

Query: 371 SLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAI----PKSNAE----- 421
            + +      +LW++++  G +E+S +      S  +D     ++    P  N E     
Sbjct: 457 KVVFNLSDDFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRL 516

Query: 422 ------------ILKGP-----------------------VQIKFQIPYFTTSGIQVRYL 446
                       +  GP                       V I F+IPY T SG++V YL
Sbjct: 517 QEEMKTSMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYL 576

Query: 447 KINEPKLQYKSYPWVRYITQSGDDYT 472
           K+ EP+LQY+S+PWVRY T S ++Y 
Sbjct: 577 KVEEPQLQYQSFPWVRYKTVSDEEYA 602

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 79/142 (55%), Gaps = 12/142 (8%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEE-QSNLIPPCLNHNGLEYLF 59
           M+S+++  D N +PL+S+  R      A+    ++LS  ++   +  PP L+ N   ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHNDLYLVAIV-TSLRANA--AAIFTFLHKLVEVLSDY--LKTVEEESIRDNFVIIYEL 114
           ++ + L+ V+++ T+ + N     I  FL +   +L  Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEVMDYGIPQICETKMLKQYI 136
           +DE +D+GI Q+ +  ++K YI
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYI 136

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 112/256 (43%), Gaps = 60/256 (23%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEII-GDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E    +M  K  ++R  +I G +     LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K L  D                                      L  L+FHQCV
Sbjct: 347 ------KLLQKDQQF-----------------------------------LSQLRFHQCV 365

Query: 283 RLSKFENEKIITFIPPDGKFDLMNYRLSTTIK-----PLIWCDVNVQVHSNSRIEIHCKA 337
            L   +N++I  FIPPDG+F L  Y L   +K      LI  ++  ++    +I+I+   
Sbjct: 366 SLETIQNKEI-EFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKLKK-FKIQINLSI 423

Query: 338 KAQIKRKSTATNVEIIIPVP--------DDADTPTFKYSHGSLKYVPEKSAILWKLRSFP 389
               K +++ + + + IP+         D   +P FK + G +K+      +LW++ S  
Sbjct: 424 TTFFKVQNSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMK 483

Query: 390 GGKE---YSMSAELGL 402
           GG      +M+AE  L
Sbjct: 484 GGHGENIKAMTAEFFL 499

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 7/91 (7%)

Query: 387 SFPGGKEYSMSAELGLPS----ISNDIEGHRAIPKSNAEILKGP--VQIKFQIPYFTTSG 440
           S P     +  A +  P+    + ND   ++ IP   A +   P  + + F+IPY+  SG
Sbjct: 564 SIPSTGTTNAGANIATPASTSVVKNDTSSNKEIPLKKA-LSNKPQYLTVDFEIPYYACSG 622

Query: 441 IQVRYLKINEPKLQYKSYPWVRYITQSGDDY 471
           ++V YLKI E +L Y+S+PWVRY T +  DY
Sbjct: 623 LKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIP---PCLNHNGLEY 57
           M S ++  D N +PL+S+  R      AI  F +++    +  +      P ++ N   +
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDL-YLVAI-VTSLRANAAAIFTFLHKLVEVLSDYLKT--VEEESIRDNFVIIYE 113
           + I+ + L +L AI +    ++  ++  +L K   +L  +LKT  +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEVMDYGIPQICETKMLKQYI 136
           L+DE +D+GI Q+ +  ++K Y+
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYV 137

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 112/280 (40%), Gaps = 82/280 (29%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMT-QKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           +SWR +GI + KNE FLD++E +   M  +KG + ++ I G++     LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
                 K L +DS                                     L +  FHQCV
Sbjct: 355 ------KILQNDSQF-----------------------------------LSNAHFHQCV 373

Query: 283 RLSKF-----------------ENE--------KIITFIPPDGKFDLMNYRLSTTIK--P 315
            L                    ENE        K I FIPPDG F L  Y L   +K  P
Sbjct: 374 SLDSLHLQSAEDDDGDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLP 433

Query: 316 LI---WCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVP--------DDADTPT 364
           +I     D+  ++ S  +++IH   +   K  +  + + + IP+         D +    
Sbjct: 434 VIKLKLFDIKPKL-SKYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIK 492

Query: 365 FKYSHGSLKYVPEKSAILWKLRSFPGGK-EYSMSAELGLP 403
           FK   G + +    + ++W++ S  GG  E +MS     P
Sbjct: 493 FKCDQGKVLFNLSDNFLIWEIGSMKGGHGEVTMSMMAEFP 532

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 38/46 (82%)

Query: 427 VQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 472
           ++I F+IPY+T SG+++ YLKI EP+LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 82/165 (49%), Gaps = 34/165 (20%)

Query: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLE---EQSNLIP--------PC 49
           M+S ++  D N +P+L++  R     S  + F  LL   E   +Q N I         P 
Sbjct: 1   MSSCIFILDENLEPILNKNIR-----SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLPI 55

Query: 50  LNHN---------------GLEYLFIQHNDLYLVAIVTSLRANAAAI-FTFLHKLVEVLS 93
           LN N               G ++L I+ + L  V+I+ +   N+  I F++L +  ++L 
Sbjct: 56  LNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLK 115

Query: 94  DYLKT--VEEESIRDNFVIIYELLDEVMDYGIPQICETKMLKQYI 136
            YL    +++  + DNF+++ ELLDE +D+GI Q  ++ ++K YI
Sbjct: 116 SYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYI 160

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 75/335 (22%), Positives = 132/335 (39%), Gaps = 77/335 (22%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLM------TQKGQVLRSEIIGDVKVNSKLSGMPDL 217
           V WR + I   +NE ++D+ E++ + +      + + ++L   I G V V+S + G+P L
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPML 232

Query: 218 KLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDL- 276
           ++                                                    + +D+ 
Sbjct: 233 EVSFG-----------------------------------------------GCDFKDII 245

Query: 277 -KFHQCVRLSKF--ENEKIITFIPPDGKFDLMNYR--LSTTIKPLIWCD-VNVQVHSNSR 330
            KFH CV +++F   +  II FIPPDGKF LM Y   LS+    LI C+  N   +SN  
Sbjct: 246 PKFHDCVEVNEFLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDE 305

Query: 331 IEIHCKAKAQIKRKSTATNVEIIIPVPD---DADTPTFKYSHGSLKY-----VPEKSAIL 382
            EI         +     N+++ +   +    +     + +HG  +Y     + +   + 
Sbjct: 306 FEITLNINKS-NKVPKINNLQVCLNFENREGQSKVKILRNTHGRFEYGKNTWIFDSELLT 364

Query: 383 WKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKF--QIPYFT-TS 439
             L    G  E     E        D EG R + K   E+    +  ++  Q+P  T  S
Sbjct: 365 GTLPVLRGCVEEETKNE---EDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVS 421

Query: 440 GIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474
            I +R    + P+ Q + +  V+Y+T++  +Y IR
Sbjct: 422 SINIRNDSTSNPQRQ-QLFKGVKYVTKTS-NYEIR 454

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 67/164 (40%), Gaps = 61/164 (37%)

Query: 163 SVSWRPEGIIHKKNEAFLDIVESINMLMTQKG----------QVLRSEIIGDVKVNSKLS 212
           +V WR   + H  NE +LD+VESI++++  K           +++   IIG   V S L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 213 GMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIE 272
           G P +++ I+  G                                              +
Sbjct: 261 GNPIVEMKIDMAGN---------------------------------------------D 275

Query: 273 LEDLKFHQCVRL------SKFENEKIITFIPPDGKFDLMNYRLS 310
           LE +  H+CV+        +FEN K+I F+PPDG F L +Y ++
Sbjct: 276 LESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 137/339 (40%), Gaps = 86/339 (25%)

Query: 162 NSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMP--DLKL 219
           + V WR  GI +  NE F+D+ E IN ++ +KG++L   I G + +N+ LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
           G+ D  +   +L+                                             FH
Sbjct: 267 GLLDHKL--SHLNT-------------------------------------------TFH 281

Query: 280 QCVRLSKFE--NEKI------ITFIPPDGKFDLMNYRLSTTIKP--LIWCDVNVQVHSNS 329
           +C+   K    N+ I      +TF+PPDG+  L  Y L    +   L   DVN+Q     
Sbjct: 282 RCILEDKANSINDLIAGKFTKLTFVPPDGRTRLCQYTLPLVKRDSNLGIIDVNLQSSLGK 341

Query: 330 RIEIHCKAKAQIKRKSTATNVE-----IIIPVPDDADTPTFKYSHGSLKYVPEKSAILWK 384
           R++   + +  +   +T   +E     I +           + +HG ++    +  + W 
Sbjct: 342 RLD-EFEVRVTVGMSTTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMTRGEVNWH 400

Query: 385 L-RSFPGGKEYSMS--AELGLPSISNDIEGHRAI----PKSNAEILKGPVQIKF------ 431
           L ++   G    +   AEL     SND    R+     P S+   L  P  IK       
Sbjct: 401 LDKNMVCGSMAVLRCIAELEPELASNDQTSSRSSVVQPPSSHLTSLLQPSFIKCYYEHKS 460

Query: 432 QIPYFTTSGIQVRYLKI--NEPKLQYKSYPWVRYITQSG 468
           Q+P    SGI+++ + +    PK   K +  V+Y+T++G
Sbjct: 461 QLP----SGIKLQSIDVVNGGPK---KPFKGVKYLTKTG 492

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 65/136 (47%), Gaps = 8/136 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD   D  +  +  F TL+++  +Q   +        + Y++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+L +N       L+  V+ +   LK + EE + D+   I    DE++ 
Sbjct: 61  PFDDYYII-LITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 121 YGIPQICETKMLKQYI 136
            G  +      +K ++
Sbjct: 120 MGYKENLSLTQIKTFL 135

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 59/158 (37%), Gaps = 57/158 (36%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKGQVLR----------SEIIGDVKVNSKLSG 213
           V WR  G+ +  NE ++D+ ESI+++  + G+  R            I G   V   LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIEL 273
            P + L ++  G       +D   P                                   
Sbjct: 271 NPTVDLQLDLAG-------NDLGVPA---------------------------------- 289

Query: 274 EDLKFHQCVRLSKFENEK--IITFIPPDGKFDLMNYRL 309
               FH+CV L   +N     + FIPPDG+F+LM Y +
Sbjct: 290 ----FHECVELDNHQNPSNCDLRFIPPDGRFNLMQYSI 323

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 69/137 (50%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++R+   D  L  +  F +L+++L  +   +      N + Y++ 
Sbjct: 5   AASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV----EGNHVRYVYR 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N     + L+ L + +++ L + +E  I D+   I    DEV+ 
Sbjct: 61  PFDDYYII-LITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVI 119

Query: 121 YGIPQICETKMLKQYIT 137
            G  +   +  +  Y+T
Sbjct: 120 MGYKENLSSTQVTTYLT 136

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 57/155 (36%), Gaps = 49/155 (31%)

Query: 158 VALTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQ---VLRSEIIGDVKVNSKLSGM 214
           V    +V WR     +  NE ++D+VE++N  + QKG    ++   + G + V   LSG 
Sbjct: 134 VEAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGN 193

Query: 215 PDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELE 274
           P ++L +   G                                               L+
Sbjct: 194 PTVQLKLRTSG---------------------------------------------HPLD 208

Query: 275 DLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL 309
           +   H+CV L +      + F+PPDG+F L  Y +
Sbjct: 209 NSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 60/161 (37%), Gaps = 50/161 (31%)

Query: 154 TRPPVALTNSVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQV-----LRSEIIGDVKVN 208
            + P A    V WR  G+ +  NE ++D+VE++++++ +  +      +R  + G V   
Sbjct: 176 AKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFR 235

Query: 209 SKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXX 268
           S LSG P + L +  +G        D   P                              
Sbjct: 236 SHLSGNPVIALNLRLRG-------HDLGMP------------------------------ 258

Query: 269 VNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRL 309
                     HQC   S       + F+PPDGKF LM+Y +
Sbjct: 259 --------ALHQCCLDSYQGRPDQLRFVPPDGKFQLMHYSI 291

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/289 (20%), Positives = 98/289 (33%), Gaps = 82/289 (28%)

Query: 53  NGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLK--TVEEESIRDNFVI 110
           +GL Y  +Q  +     I      N    F FL  +  +L+ Y     ++   I  N+  
Sbjct: 72  DGLRYWCLQRTE-----IGEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 111 IYELLDEVMDYGIPQICETKMLKQY---------------------ITQXXXXXXXXXXX 149
           +  L + ++D G P I +   LK+                      I+            
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 150 XRNATRPPVALTN---SVSWRPEGIIHKKNEAFLDIVESINMLMTQKGQV-----LRSEI 201
             +     V+  N   +V WR  G+ +  NE ++D+ E++N+++ +         +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 202 IGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXX 261
            G+V     LS  P ++L +N  G        D   P                       
Sbjct: 247 DGEVGFKCYLSENPLVELDLNTNG-------HDLGIP----------------------- 276

Query: 262 XXXXXXXVNIELEDLKFHQCVRLSKFE-NEKIITFIPPDGKFDLMNYRL 309
                           FH+CVR    + +   + FIPPDG F LM Y +
Sbjct: 277 ---------------AFHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 61/151 (40%), Gaps = 50/151 (33%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLM--TQK-GQV--LRSEIIGDVKVNSKLSGMPDLK 218
           V WR  G+ +  NE ++D+VE+I++++  T+K GQ+  +R  I G V   S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKF 278
           L +N  G        D   P                                        
Sbjct: 246 LKLNLHG-------HDLGVPA--------------------------------------L 260

Query: 279 HQCVRLSKFENEKIITFIPPDGKFDLMNYRL 309
           H C +     + + + F+PPDGKF LM Y +
Sbjct: 261 HPCCQAQYTGSPENLQFVPPDGKFRLMQYTI 291

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 84/203 (41%), Gaps = 15/203 (7%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++R+   +  +  +  F  L+S++          L    + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRYVYR 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+ ++N     + L+     ++ YL + +E  I DN   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVT 119

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180
            G  +      ++ Y+              RN     +  T     R + I  K+ E  L
Sbjct: 120 MGYKENLSISQVETYLAMESHEERIQEIIERNK---EIEATEERKRRAKEIARKEQERKL 176

Query: 181 DI----VESINMLMTQKGQVLRS 199
            I     E+ N++   + + + S
Sbjct: 177 GIYGGEFETANLVANSQNRFMAS 199

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++R+   D  +  +  F  L+S +      +        + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N     + L+   + ++ YL + +E  + DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVV 119

Query: 121 YGIPQICETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLTAAQVSTYLS 136

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 65/159 (40%), Gaps = 8/159 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++ D   D  +  +  F  L++    +   +        + YL+ 
Sbjct: 5   AASITTRNGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D YL+ I+T+ ++N     + L    + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-IITNRQSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIV 119

Query: 121 YGIPQICETKMLKQYITQXXXXXXXXXXXXRNATRPPVA 159
            G  +      ++ Y+T             RN      A
Sbjct: 120 MGYKENLTMAQVETYLTMESHEERIQEIIERNKESEATA 158

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (42%), Gaps = 51/168 (30%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKG------------------QVLRSEIIGDV 205
           V WR   + +  NE ++D++E I+++  ++                   +++R++IIG++
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXX 265
            V S LS  P +++ + D+     Y D        T  + +D                  
Sbjct: 316 NVRSYLSDNPMVEVTLVDR----NYSD------QKTGWSEND-----------------L 348

Query: 266 XXXVNIELEDLKFHQCVRL--SKFENEKI--ITFIPPDGKFDLMNYRL 309
              +N+ L    FH CV +   K  N+    I FIPPDGKF LM Y +
Sbjct: 349 FKQLNLGLP--MFHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 88/219 (40%), Gaps = 40/219 (18%)

Query: 278 FHQCVRLS-------------KFENEKIITFIPPDGKFDLMNYRL----STTIKPLIWCD 320
           FH CV                 F+ ++++ F+PPDGKF L  Y +       +   +  D
Sbjct: 273 FHACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRD 332

Query: 321 VNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD-----------DADTPTFKYSH 369
             +QV     + ++ K + ++ R     ++ ++ PV D           D++    + +H
Sbjct: 333 GLIQVSFEDGLGLN-KDEFEV-RLHVRESIAVVDPVEDLVVTLQFSNGNDSNVKMLRATH 390

Query: 370 GSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQI 429
           G+     E     W+  S     E S      LP +   I+  + + +     L   V +
Sbjct: 391 GTFVGQDEDRQCSWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLT-SVAV 442

Query: 430 KFQIPYFTTSGIQVRYLKIN--EPKLQYKSYPWVRYITQ 466
           ++  P    SG +V  L ++   P+++ K +  VR +T+
Sbjct: 443 RYGYPGELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLE---EQSNLIPPCLNHNGLEYLFI 60
           AV      GKPLLSR++RD     + D+   LLS+ +    +S+     +    + Y++ 
Sbjct: 101 AVSIVTRQGKPLLSRQFRD----ISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYK 156

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N       L    + ++ YL + +E  I +N   I    DEV+ 
Sbjct: 157 PFDDYYII-LITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVIT 215

Query: 121 YGIPQICETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 216 MGYKENLSISQINTYLS 232

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV     +GKPL+SR+++D   D  +  +  F  L+++   Q   +        + Y++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFV----EEEHVRYVYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N       L+   + ++ +LK   E+ I DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 121 YG 122
            G
Sbjct: 120 LG 121

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 68/165 (41%), Gaps = 65/165 (39%)

Query: 166 WRPEGIIHKKNEAFLDIVESINML----------MTQKGQVLRSEIIGDVK----VNSKL 211
           WR + + H  NE ++D+VES++++          +T+  Q ++  + G +K    V S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNI 271
           +G P ++L +   G       +D   P                                 
Sbjct: 263 NGNPLVELQLELSG-------NDIGHPS-------------------------------- 283

Query: 272 ELEDLKFHQCVRLSKF----ENEKI--ITFIPPDGKFDLMNYRLS 310
                 FH+CV + ++    +N  I  + FIPPDGKF LM+Y ++
Sbjct: 284 ------FHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV     +GKPLLSR++RD   D  +  +  F  L++    +   +        + Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRYIYI 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N       L+   + ++  LK   EE + ++   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 121 YGIPQICETKMLKQYIT 137
            G  +      +  +++
Sbjct: 120 LGYKESLSLSQINTFLS 136

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR++R+   D  L  +  F +L++++      +        + Y++ 
Sbjct: 5   AASITTRTGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFV----EDEHVRYVYR 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N     + L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVV 119

Query: 121 YGIPQICETKMLKQYIT 137
            G  +      +  Y++
Sbjct: 120 MGYKENLSITQVNTYLS 136

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 63/139 (45%), Gaps = 12/139 (8%)

Query: 4   AVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLE-----YL 58
           AV      GKPLLSR++R+     + D+   LLS+   Q  +      H  +E     Y+
Sbjct: 5   AVSIVTRQGKPLLSRQFRE----ISKDRVTELLSNF--QGLVAKSSSQHTFVEDEHVRYV 58

Query: 59  FIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEV 118
           +   +D Y++ ++T+ ++N       L    + ++ YL + +E  I +N   I    DEV
Sbjct: 59  YKPFDDYYII-LITNRQSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEV 117

Query: 119 MDYGIPQICETKMLKQYIT 137
           +  G  +      +  Y++
Sbjct: 118 ITMGYKENLSMTQINTYLS 136

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++RD   D  +  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRHGKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N     + L+   + ++  L   +E  I DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVV 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 63/137 (45%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           AV     +GKPLLSR++RD   D     +  F  L+++   Q   +        + Y++ 
Sbjct: 5   AVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVANSSSQHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D Y++ ++T+ ++N       L+   + ++  L++ +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDEIIA 119

Query: 121 YGIPQICETKMLKQYIT 137
            G  +      +  +++
Sbjct: 120 MGYKENLSLTQINNFLS 136

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L+S++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFV----EDKHVRYVYR 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+ ++N       L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/159 (20%), Positives = 61/159 (38%), Gaps = 51/159 (32%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINML-----MTQKGQVLRSEIIGDVKVNSKLSGMPDLK 218
           V WR   + +  +E ++DI+E+++++          Q++   I G V V S LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKF 278
           + ++  G                                              E+     
Sbjct: 252 MDMDLAG---------------------------------------------NEMYAPSM 266

Query: 279 HQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLI 317
           HQCV + +  +   + FIPPDG  +L+NY +   + P +
Sbjct: 267 HQCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNPKV 304

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR++ +   D  +  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EHVRYVYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D YL+ ++T+ ++N     + L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIV 119

Query: 121 YGIPQICETKMLKQYIT 137
            G  +    + +  YI+
Sbjct: 120 MGHKENLTIQQVNNYIS 136

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L++++      +        + Y++ 
Sbjct: 58  AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFV----EDKHVRYVYR 113

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+ ++N     + L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 114 PFDNYYII-LITNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 172

Query: 121 YG 122
            G
Sbjct: 173 MG 174

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L+S++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYR 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+ ++N       L+   + ++ YL + +++ I  N   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 37.0 bits (84), Expect = 0.031,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 53  NGLEY-----LFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDN 107
           N LEY     ++ ++  LY +  ++S   N       +H+ VE +  Y   V E  I  N
Sbjct: 50  NILEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFN 109

Query: 108 FVIIYELLDEVM--DYGIPQICETKMLKQYIT 137
           F   YE+L+EV+  D  + +  +  +L+  +T
Sbjct: 110 FTKAYEILNEVLVCDGSMTETSKQAILRSVMT 141

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 3/36 (8%)

Query: 278 FHQCV-RLSKFENEKI--ITFIPPDGKFDLMNYRLS 310
           FH CV + S  + EKI  ++FIPPDG+F LM Y ++
Sbjct: 314 FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 62/151 (41%), Gaps = 47/151 (31%)

Query: 164 VSWRPEGII-HKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGIN 222
           V WR      H+ NE ++D++E+ ++++ +K   LR        VN  + G  D++  +N
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLR-------LVNGDICGAVDVRSYLN 251

Query: 223 DKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFHQCV 282
           D  + S  L+   N                                   E+     H+CV
Sbjct: 252 DNPLVSVKLNTMGN-----------------------------------EIGIPSLHECV 276

Query: 283 RLS---KFENEKIITFIPPDGKFDLMNYRLS 310
            ++   +F    I TFIPPDGKF L+ Y ++
Sbjct: 277 EINDDGEFTPSNI-TFIPPDGKFRLLEYSIN 306

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 60/153 (39%), Gaps = 53/153 (34%)

Query: 164 VSWR-PEGIIHKKNEAFLDIVESINMLMTQKGQVLR---SEIIGDVKVNSKLSGMPDLKL 219
           V WR  +   H+ NE ++D++E+ +++   K   LR     I G V V S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
            +N  G       +D   P                                        H
Sbjct: 259 KLNTMG-------NDIGVPT--------------------------------------LH 273

Query: 280 QCVRLSKFENEKI---ITFIPPDGKFDLMNYRL 309
           +CV + K + E +   ITFIPPDGKF L+ Y +
Sbjct: 274 ECVEI-KDDGEFLPSNITFIPPDGKFRLLEYSV 305

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 35.8 bits (81), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 6/104 (5%)

Query: 33  PTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVL 92
            T+LS   +  N+    L +N  + ++ ++  LY V  V+  + N       +H+ VE +
Sbjct: 39  ATILSRKPKMCNI----LEYNDHKVVYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETM 94

Query: 93  SDYLKTVEEESIRDNFVIIYELLDEVM--DYGIPQICETKMLKQ 134
             Y   V E  I  NF   Y +LDEV+  D  I +  + ++LK 
Sbjct: 95  DRYFGNVCELDIIFNFNKAYSILDEVLICDGSITETSKKEVLKH 138

>CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170c APS1 Clathrin coat assembly protein AP19
          Length = 156

 Score = 35.8 bits (81), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 14/116 (12%)

Query: 11  NGKPLLSRRYRDDIPLSAIDKF-------PTLLSDLEEQSNLIPPCLNHNGLEYLFIQHN 63
            GK  LS+ Y    PLS  +K        PT+L+   +  N+    L ++  + +F ++ 
Sbjct: 13  QGKVRLSKWYA---PLSTKEKAKIIKDLTPTILARKPKMCNI----LEYSDHKVVFRRYA 65

Query: 64  DLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
            LY +  +T    N       +H+ VE +  Y + V E  I  NF   Y++LDE++
Sbjct: 66  SLYFICGITIGHDNELLTLELIHRYVETMDTYFENVCELDIIFNFHKAYDILDELV 121

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A       GKPLLSR+++D   D  L  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRYVYR 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             ++ Y++ ++T+ ++N       L+   + ++ YL +  ++ I  N   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 62/137 (45%), Gaps = 8/137 (5%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      +GKPLLSR++ +   D  +  +  F  L++++      +        + Y++ 
Sbjct: 5   AASITTRSGKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EHVRYVYK 60

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120
             +D YL+ +VT+ ++N     + L+   + ++ YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-LVTNRQSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEIIV 119

Query: 121 YGIPQICETKMLKQYIT 137
            G  +      +  Y+ 
Sbjct: 120 MGNKEDLTISQVNTYLA 136

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 62/162 (38%), Gaps = 60/162 (37%)

Query: 164 VSWR-PEGIIHKKNEAFLDIVESINMLMTQKGQVLR---SEIIGDVKVNSKLSGMPDLKL 219
           V WR      H+ NE ++D++E+ +++  +K   LR     I G V V S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
            +N  G       +D   P                                        H
Sbjct: 259 KLNTMG-------NDIGIPS--------------------------------------LH 273

Query: 280 QCVRLSKFENEKI-----ITFIPPDGKFDLMNYR--LSTTIK 314
            CV +    N+ +     ITFIPPDGKF L+ Y   LS+ +K
Sbjct: 274 DCVEI----NDGVFSPSNITFIPPDGKFRLLEYSVDLSSQVK 311

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 60/123 (48%), Gaps = 8/123 (6%)

Query: 4   AVYFCDHNGKPLLSRRYRD---DIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60
           A      NGKPLLSR+++D   D  L  +  F  L+S L+  SN      +H  + Y++ 
Sbjct: 5   AASITTSNGKPLLSRQFKDLSRDRVLELLSNFQNLVS-LKHSSNHTFVEDDH--VRYVYK 61

Query: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKT-VEEESIRDNFVIIYELLDEVM 119
             +D Y++ ++T+ ++N     + L+   + ++ +L    ++  I +    I    DE++
Sbjct: 62  PFDDFYII-LITNRQSNIVQDLSTLNLFSQTINAFLNNQFDQYEIYNKAFEILSSFDEIV 120

Query: 120 DYG 122
             G
Sbjct: 121 SMG 123

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 57/150 (38%), Gaps = 51/150 (34%)

Query: 164 VSWR-PEGIIHKKNEAFLDIVESINMLMTQKGQVLR---SEIIGDVKVNSKLSGMPDLKL 219
           V WR      H+ NE +LD++E+ +++  +K   +R     I G + V S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDKGIFSKYLDDDSNTPPPTSAATSDNIXXXXXXXXXXXXXXXXXXXVNIELEDLKFH 279
            +N  G       +D   P                                        H
Sbjct: 259 KLNTMG-------NDIGIPS--------------------------------------LH 273

Query: 280 QCVRLSK--FENEKIITFIPPDGKFDLMNY 307
           +CV ++     +   ITFIPPDGKF L+ Y
Sbjct: 274 ECVEINDGGVFSPSNITFIPPDGKFRLLEY 303

>YLR170C Chr12 complement(500579..501049) [471 bp, 156 aa] {ON}
           APS1Small subunit of the clathrin-associated adaptor
           complex AP-1, which is involved in protein sorting at
           the trans-Golgi network; homolog of the sigma subunit of
           the mammalian clathrin AP-1 complex
          Length = 156

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 30  DKFPTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLV 89
           D  PT+L+   +  N+I     +N  + ++ ++  LY +  +T    N       +H+ V
Sbjct: 36  DLTPTILARKPKMCNIIE----YNDHKVVYKRYASLYFIVGMTPDVDNELLTLEIIHRFV 91

Query: 90  EVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           E +  Y   V E  I  NF  +Y++L+E++
Sbjct: 92  ETMDTYFGNVCELDIIFNFSKVYDILNEMI 121

>TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 14/117 (11%)

Query: 10  HNGKPLLSRRYRDDIPLSAIDKF-------PTLLSDLEEQSNLIPPCLNHNGLEYLFIQH 62
             GK  L + Y   IPL+  +K         T+LS   +  N++     ++  + ++ ++
Sbjct: 12  RQGKIRLMKWY---IPLTQKEKAKILRNLTTTILSRKPKMCNIVE----YSDHKVVYRRY 64

Query: 63  NDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
             LY +  +T+   N   I   +H+ VE +  Y   V E  I  NF   Y++LDE++
Sbjct: 65  ASLYFICGITAEVDNELLILEVIHRYVEAMDSYFGNVCELDIIFNFSKAYDILDEMI 121

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 12/131 (9%)

Query: 12  GKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLE-----YLFIQHNDLY 66
           GKPLLSR++++      I+    LLS+   Q  +     +H  +E     Y++   +D Y
Sbjct: 13  GKPLLSRQFKELTKERVIE----LLSNF--QGLVSKSSSDHTYVEDEHVRYVYRPFDDYY 66

Query: 67  LVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIPQI 126
           L+ +VT+ ++N     + L+   + ++ YL + +EE I  N   I    DE++  G  + 
Sbjct: 67  LI-LVTNRQSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMGNKEN 125

Query: 127 CETKMLKQYIT 137
                +  Y+ 
Sbjct: 126 LTVSQVNTYLA 136

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 12/102 (11%)

Query: 44  NLIPPCLNH-----NGLEY-----LFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLS 93
           NL+P  L+      N LEY      + ++  LY +  +T    N       +HK VE + 
Sbjct: 36  NLVPLILSRKAKMCNILEYSDHKVAYRRYASLYFICGITPDVDNELLTLEIIHKYVETMD 95

Query: 94  DYLKTVEEESIRDNFVIIYELLDEVM--DYGIPQICETKMLK 133
            Y   V E  I  NF   Y++L+E++  D  + +  +T +LK
Sbjct: 96  QYFGNVCELDIIYNFTKAYDILNEMIMCDGSLAETSKTVVLK 137

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 270 NIELEDLKFHQCVRLSKF----ENEKIITFIPPDGKFDLMNYRLS 310
             +L     H CV L        +   + FIPPDGKF LM Y ++
Sbjct: 279 GCDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 30  DKFPTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLV 89
           D  P +LS   +  N++     ++  + ++ ++  LY +  +T    N       +H+ V
Sbjct: 36  DLTPLVLSRKAKMCNIVE----YSDHKVVYRRYASLYFICGITPEYDNELLTLELIHRYV 91

Query: 90  EVLSDYLKTVEEESIRDNFVIIYELLDEVM--DYGIPQICETKMLKQ 134
           E +  Y   V E  I  NF   YE+L+E++  D  I +  + ++L+Q
Sbjct: 92  ETMDSYFGNVCELDIIFNFSRAYEILNEMIMCDGSIAESGKAEVLQQ 138

>Smik_12.232 Chr12 complement(447707..448177) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 30  DKFPTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLV 89
           D  PT+L+   +  N+I     ++  + ++ ++  L+ +  VTS   N       +H+ V
Sbjct: 36  DLTPTILARKPKMCNIIE----YSDHKVVYKRYASLFFIVGVTSDVDNELLTLEVIHRFV 91

Query: 90  EVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
           E +  Y   V E  I  NF  +Y++L+E++
Sbjct: 92  ETMDTYFGNVCELDIIFNFNKVYDILNEMI 121

>ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 4/87 (4%)

Query: 33  PTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVL 92
           P +LS   +  N++     ++  + ++ ++  LY +  +T    N       +H+ VE +
Sbjct: 39  PLILSRKPKMCNIV----EYSDHKVVYRRYASLYFICGITPEADNELLTLEIIHRYVETM 94

Query: 93  SDYLKTVEEESIRDNFVIIYELLDEVM 119
             Y   V E  I  NF   Y +LDE++
Sbjct: 95  DTYFGNVCELDIIFNFGKAYAILDEML 121

>ZYRO0D07128g Chr4 (618590..620119) [1530 bp, 509 aa] {ON} highly
           similar to uniprot|P04046 YMR300C Saccharomyces
           cerevisiae ADE4 Phosphoribosylpyrophosphate
           amidotransferase
          Length = 509

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 61/131 (46%), Gaps = 5/131 (3%)

Query: 328 NSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFKYSHGSLKYVPE---KSAILWK 384
           ++R+++  K   +IK++   +++++++PVPD A T   + +    K   E   K+  + +
Sbjct: 280 HTRLQMGTKLAEKIKKQIDTSDIDVVMPVPDTARTCALQLASSLDKPYREGFVKNRYVGR 339

Query: 385 LRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNAEILKGPVQIKFQIPYFTTSGIQVR 444
               P  KE   S    L  ++++ EG +++   +  I++G    +  +     SG    
Sbjct: 340 TFIMPNQKERVSSVRRKLNPMTSEFEG-KSVLIVDDSIVRGTTSFEI-VNMAKESGATKV 397

Query: 445 YLKINEPKLQY 455
           Y     P ++Y
Sbjct: 398 YFASAAPAIRY 408

>Skud_12.236 Chr12 complement(447306..447776) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 28  AIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHK 87
           A D  PT+L+   +  N+I     ++  + ++ ++  L+ +  VT    N       +H+
Sbjct: 34  AKDLTPTILARKPKMCNIIE----YSDHKVVYKRYASLFFIVGVTPDIDNELLTLEIIHR 89

Query: 88  LVEVLSDYLKTVEEESIRDNFVIIYELLDEVM 119
            VE +  Y   V E  I  NF  +Y++L+E++
Sbjct: 90  FVETMDTYFGNVCELDIIFNFNKVYDILNEMI 121

>ZYRO0G05984g Chr7 (470636..471751) [1116 bp, 371 aa] {ON} similar
           to uniprot|P53912 Saccharomyces cerevisiae YNL134C
          Length = 371

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 5/126 (3%)

Query: 296 IPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQI-KRKSTATNVEIII 354
           +PP  +  ++   L+  + P  W  +  ++   S I   C A  Q+ K  +   NV    
Sbjct: 25  LPPLKEGQVLVKTLAAAVNPTDWKHIEYKLGPQSSIS-GCDAAGQVVKLGANVKNVAEGD 83

Query: 355 PVPDDADTPTFKY-SHGSL-KYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGH 412
            V   A   + K+  +G+  +YV   S +LWKL+S    +  S   EL    +SN IEG 
Sbjct: 84  VVAGFAHGASVKHPENGAFAEYVAIDSELLWKLQSSSDSRVLSGKQELPSGPVSN-IEGL 142

Query: 413 RAIPKS 418
              P S
Sbjct: 143 VTFPIS 148

>TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa]
           {ON} Anc_5.21 YMR300C
          Length = 511

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 329 SRIEIHCKAKAQIKRKSTATNVEIIIPVPDDADTPTFK 366
           +RIE+  K    IK K +   ++++IPVPD A T   +
Sbjct: 281 TRIEMGTKLAENIKSKMSPDEIDVVIPVPDTARTCALQ 318

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 164 VSWRPEGIIHKKNEAFLDIVESINMLMTQKG----QVLRSEIIGDVKVNSKLSGMPDLKL 219
           V WR   + +  NE ++D+VE++ + + Q       V    I G + +   L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDKG 225
            ++  G
Sbjct: 255 NLHSAG 260

>Kwal_14.2607 s14 complement(831030..831500) [471 bp, 156 aa] {ON}
           YLR170C (APS1) - clathrin-associated protein complex,
           small subunit [contig 224] FULL
          Length = 156

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 11/84 (13%)

Query: 53  NGLEY-----LFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDN 107
           N LEY     ++ ++  LY +  ++    N       +H+ VE +  Y   V E  I  N
Sbjct: 50  NILEYQDHKVVYKRYASLYFICGISPDVDNELLTLEVIHRYVEAMDSYFNNVCELDIIFN 109

Query: 108 FVIIYELLDEVMDYGIPQICETKM 131
           F   YE+L+EV+      IC+  M
Sbjct: 110 FNKAYEILNEVL------ICDGAM 127

>Suva_10.268 Chr10 complement(472748..473218) [471 bp, 156 aa] {ON}
           YLR170C (REAL)
          Length = 156

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 33  PTLLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYLVAIVTSLRANAAAIFTFLHKLVEVL 92
           PT+L+   +  N+I     ++  + ++ ++  L+ +  VT    N       +H+ VE +
Sbjct: 39  PTILARKPKMCNIIE----YSDHKVVYKRYASLFFIVGVTPDVDNELLTLEVIHRFVETM 94

Query: 93  SDYLKTVEEESIRDNFVIIYELLDEVM 119
             Y   V E  I  NF  +Y++L+E++
Sbjct: 95  DTYFGNVCELDIIFNFNKVYDILNEMV 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,612,722
Number of extensions: 2079093
Number of successful extensions: 5900
Number of sequences better than 10.0: 122
Number of HSP's gapped: 5836
Number of HSP's successfully gapped: 218
Length of query: 476
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 363
Effective length of database: 40,524,141
Effective search space: 14710263183
Effective search space used: 14710263183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)