Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.187.125ON55051826570.0
Smik_6.4677.125ON54851924960.0
YPL260W7.125ON55151824790.0
Suva_16.447.125ON54951824370.0
NCAS0E021307.125ON52651719960.0
NDAI0E036707.125ON52251518960.0
TDEL0H028707.125ON58752418940.0
SAKL0F05390g7.125ON59552018760.0
CAGL0H09108g7.125ON53251118430.0
KNAG0L009407.125ON54953018380.0
KLLA0D14355g7.125ON58851318020.0
KLTH0F12540g7.125ON59551017890.0
ZYRO0C05192g7.125ON58852817820.0
Kwal_55.208327.125ON57551217560.0
Ecym_83527.125ON57951817020.0
TBLA0A009307.125ON58652016820.0
KAFR0L004607.125ON51150516310.0
Kpol_322.77.125ON53449815760.0
TPHA0C016107.125ON55151315480.0
ADL019W7.125ON52546914100.0
Kpol_1062.587.125ON4914404533e-49
YLR457C (NBP1)7.531ON319113830.13
TPHA0F026206.70ON91899830.20
SAKL0B02288g8.68ON122886733.2
KLLA0A04884g4.105ON105984723.5
Smik_15.893.149ON45184714.2
TBLA0E043708.254ON67647715.1
YBR042C (CST26)3.244ON39748697.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.18
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...  1028   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   966   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   959   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   943   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   773   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   734   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   734   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   727   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   714   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   712   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   698   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   693   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   691   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   681   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   660   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   652   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   632   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   611   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   600   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   547   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   179   3e-49
YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}...    37   0.13 
TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {O...    37   0.20 
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    33   3.2  
KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} simil...    32   3.5  
Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W...    32   4.2  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...    32   5.1  
YBR042C Chr2 complement(320416..321609) [1194 bp, 397 aa] {ON}  ...    31   7.8  

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/518 (97%), Positives = 506/518 (97%)

Query: 1   MFSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 60
           MFSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL
Sbjct: 1   MFSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 60

Query: 61  DDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 120
           DDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 61  DDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 120

Query: 121 TVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNERK 180
           TVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNERK
Sbjct: 121 TVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNERK 180

Query: 181 QNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXXX 240
           QNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLV       
Sbjct: 181 QNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTM 240

Query: 241 XXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKF 300
                NINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKF
Sbjct: 241 SKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKF 300

Query: 301 KSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLEN 360
           KSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLEN
Sbjct: 301 KSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLEN 360

Query: 361 LMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL 420
           LMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL
Sbjct: 361 LMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL 420

Query: 421 LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFY 480
           LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFY
Sbjct: 421 LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFY 480

Query: 481 DSDGNIPEGQGILNALLAECFDIMHELKVEAEERALNP 518
           DSDGNIPEGQGILNALLAECFDIMHELKVEAEERALNP
Sbjct: 481 DSDGNIPEGQGILNALLAECFDIMHELKVEAEERALNP 518

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/519 (91%), Positives = 493/519 (94%), Gaps = 1/519 (0%)

Query: 1   MFSSAGQ-HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 59
           MF+SAGQ HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 60  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119
           LDDIRKNSH+TPAKSAATLIH+TELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNER 179
           STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSS  Y ED ND R+REIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNER 180

Query: 180 KQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXX 239
           K+NKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLS+VMEKLFRIRRGLLSLV      
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKKT 240

Query: 240 XXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 299
                 NINSLL+E ND QAN+N LMDDKHLVSQEYVHEKLSVLK+EL+ELESNRDDSGK
Sbjct: 241 MSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGK 300

Query: 300 FKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLE 359
           FKSLETH+V   GQSVLNGLLDDCHDLI+DLSHQTNGGL+LDP+LQP YEQLIDIKTTLE
Sbjct: 301 FKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLE 360

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 419
           NLMITRRWTLRETDLFSYQKKLNEID+KRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 420 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIF 479
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 480

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERALNP 518
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEERA NP
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQNP 519

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/518 (91%), Positives = 488/518 (94%), Gaps = 1/518 (0%)

Query: 1   MFSSAGQ-HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 59
           MF+SAGQ HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFASAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 60  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119
           LDDIRKNSH+TPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNER 179
           STVESLLEHLNESNVFTHHDLSPIKERL+EISKIVEQKNSSP Y+ED ND R+REIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNER 180

Query: 180 KQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXX 239
           K+NKIEEDLLLRAKLKHCKDEYD LE KLEEIDPSLSTVMEKLFRIRRGLLSLV      
Sbjct: 181 KKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT 240

Query: 240 XXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 299
                 N NSLLQE NDLQ N+  L DDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK
Sbjct: 241 MSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 300

Query: 300 FKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLE 359
           FKSLE+H+V EKGQSVLNGLLDDCHDL++DLSHQ NGGL LDP+LQP YEQLIDIKTTLE
Sbjct: 301 FKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLE 360

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 419
           NLMITRRWTLRETDLFSYQKKLNEID+KRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK
Sbjct: 361 NLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 420

Query: 420 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIF 479
           LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT GIF
Sbjct: 421 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIF 480

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERALN 517
           YDSDGNIPEGQGILNALLAECFDI+HELKVEAEE+A N
Sbjct: 481 YDSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQN 518

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/518 (89%), Positives = 489/518 (94%), Gaps = 2/518 (0%)

Query: 1   MFSSAGQ-HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 59
           MFSSAGQ HPQIVPKEEESILNYLLEVRS+LAKLKQNRTQYLNSKDVQTTYQHVLTKVRE
Sbjct: 1   MFSSAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRE 60

Query: 60  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119
           LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYASL
Sbjct: 61  LDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASL 120

Query: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNER 179
           STVESLLEHLNESNVFTHHDLSPIKERL+EI KIVE KN+ P Y+ED ND ++REIDNER
Sbjct: 121 STVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVE-KNTGPNYDEDGNDDQLREIDNER 179

Query: 180 KQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXX 239
            +N+IEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLF+IRRGLLSLV      
Sbjct: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239

Query: 240 XXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGK 299
                 NI+SLLQ+HNDL+ N+NDLMDDKHLVSQEYV+EKL+ LKNEL+ELESNRD+SGK
Sbjct: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299

Query: 300 FKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLE 359
           FKSLE+H+V E GQSVLNGLLDDCHDL++DLSHQTNGGL LDP LQP YEQLIDIKTTLE
Sbjct: 300 FKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLE 359

Query: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYK 419
           NLMITRRWTLRETDLFSYQKKLNEIDSKR+ GKFPTK+QDSKGQSILLYLLRRCYAIIYK
Sbjct: 360 NLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYK 419

Query: 420 LLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIF 479
           LLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRT+GIF
Sbjct: 420 LLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIF 479

Query: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERALN 517
           YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERA N
Sbjct: 480 YDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQN 517

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/517 (75%), Positives = 438/517 (84%), Gaps = 18/517 (3%)

Query: 1   MFSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 60
           M+ S   HPQ VPKEEE ILNYLL+VRS L+KLKQNRTQYLNSKDVQ TYQ+VLTKVREL
Sbjct: 3   MYPSNTTHPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVREL 62

Query: 61  DDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 120
           D+IRKNSHDTP+KSA TLIHS ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 63  DEIRKNSHDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 122

Query: 121 TVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDAND---ARIREIDN 177
           TV+SLLEHL+ESN+FTHHDLSPIK+RL+EISKIVE K+   + +E  ND     +++ID 
Sbjct: 123 TVQSLLEHLSESNIFTHHDLSPIKDRLNEISKIVE-KSCGKLPDEQLNDDEEQNLKDIDT 181

Query: 178 ERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXX 237
           ER +NKIE+DLLLRAKL+HC DEY  +ESKLEEIDPSL++ MEKLF+IRRGLLSL     
Sbjct: 182 ERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTK 241

Query: 238 XXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDS 297
                   N  SL  E           +++KHLVSQEYV++KL  L+ E+  LE+NRD+S
Sbjct: 242 KNM-----NQGSLTSEKE---------LENKHLVSQEYVNKKLHALEAEVQALEANRDES 287

Query: 298 GKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTT 357
           GKFKSLET+EV E GQ+VLNGLLDDC DLI+DLSHQTNG L LDP LQP YE LIDIKTT
Sbjct: 288 GKFKSLETNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTT 347

Query: 358 LENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAII 417
           LENLMITRRWTLRETDLF+YQK+L EID+ R+ G+FPTK  DSKGQ ILLYLLRRCYAII
Sbjct: 348 LENLMITRRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAII 407

Query: 418 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNG 477
           YKLLESSEPVSE+LQPIHNQLSTVRRCL+ELKRMGGV+N+RELYPYQMKLASLDNLR +G
Sbjct: 408 YKLLESSEPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDG 467

Query: 478 IFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514
            FYDS+GNIPEGQG LNALLA CFDIMHELKVEAEER
Sbjct: 468 KFYDSEGNIPEGQGTLNALLAACFDIMHELKVEAEER 504

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/515 (71%), Positives = 425/515 (82%), Gaps = 22/515 (4%)

Query: 2   FSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 61
           + S   HPQ+VPKEEE IL YLL+VR+ L  LK+NRTQYLNS+ VQ TYQ VLTKVRELD
Sbjct: 8   YPSNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELD 67

Query: 62  DIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 121
           +IRKN+H TP+ SA TLIHS ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 68  EIRKNNHATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 127

Query: 122 VESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIR----EIDN 177
           V+SLLEHLNESN+FTHHDL PIKERLD+ISKIVE+  S  +  ++  D +      E + 
Sbjct: 128 VQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETEL 187

Query: 178 ERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXX 237
           E+ QNKIE+DLLLRAKL+HC DEY  +ESKLEEIDPSL++++EKLF+IRRGLLSLV    
Sbjct: 188 EQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAK 247

Query: 238 XXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDS 297
                     NSLL +           +D+KHL+S EY+++KL  L+ E  +LESNRD+ 
Sbjct: 248 K---------NSLLSQKE---------LDEKHLISPEYLNKKLLELEKEFKDLESNRDEF 289

Query: 298 GKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTT 357
           GKFKSLET E+ E GQ+VL GL DDC+DLI+DLSHQTNG L LDP LQP YEQLI+IKTT
Sbjct: 290 GKFKSLETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTT 349

Query: 358 LENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAII 417
           LE LMITRRWTLRETDLF+YQKKL EID+ R+ GKFP+KS DSKGQ I+LYLLRRCYAII
Sbjct: 350 LEKLMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAII 409

Query: 418 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNG 477
           YKLLE SEPVSE+LQPIHNQLSTVRRCLL++KR+GGV+NERELYPYQMKLASLDNLR +G
Sbjct: 410 YKLLECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDG 469

Query: 478 IFYDSDGNIPEGQGILNALLAECFDIMHELKVEAE 512
           IFYDSDGNIPEGQG LNALLA CFDI+HE+KVEAE
Sbjct: 470 IFYDSDGNIPEGQGTLNALLAACFDIVHEMKVEAE 504

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/524 (71%), Positives = 428/524 (81%), Gaps = 38/524 (7%)

Query: 3   SSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 62
           +S  QHPQ VPKEEESILNYLL VR+ L +LKQNR QYLNSK+VQ  YQ VLTKVRELD 
Sbjct: 9   ASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQ 68

Query: 63  IRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV 122
           IRK++HDTP+ SA TLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV
Sbjct: 69  IRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV 128

Query: 123 ESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREID------ 176
           + LLEHLNESNVFT HDL PI+ERL EISKIVE  NSS  Y+ + +   + +ID      
Sbjct: 129 QRLLEHLNESNVFTQHDLRPIRERLLEISKIVE--NSS--YKNEVSGDNLEDIDEKLPEA 184

Query: 177 -----NERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLS 231
                 ER +NKIEEDLLLRAKL+HC DEY + ESK+EEIDP L+T+MEKLF IRRGLLS
Sbjct: 185 DRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLS 244

Query: 232 LVXXXXXXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELE 291
           L                                  +K  +SQE+VHE++  L+++L+ELE
Sbjct: 245 LAASSKRSNPSL-----------------------EKSPLSQEHVHEQVEKLESQLTELE 281

Query: 292 SNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQL 351
           S+RD++GKFKSLET +V +KGQ+VLNGLLDDCHDLISDLSHQ NGG+ LD  LQP YEQL
Sbjct: 282 SHRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQL 341

Query: 352 IDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLR 411
           IDIKT+LENL++TRRWTLRETDLF++QK+L+EIDS R++GKFPT S  SKGQSILLYLLR
Sbjct: 342 IDIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLR 401

Query: 412 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 471
           RC+AIIYKLLESSEPVSE+LQPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLASLD
Sbjct: 402 RCFAIIYKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLD 461

Query: 472 NLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERA 515
           +LRT+G FYDSDGNIPEGQG LNALLAECFDI+HELK+EA+ERA
Sbjct: 462 DLRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERA 505

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/520 (70%), Positives = 421/520 (80%), Gaps = 34/520 (6%)

Query: 5   AGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIR 64
           +  HPQ VPKEEE ILNY L+VRS L+KLKQNR+Q+LNSKDV  TYQ VLTKVRELDD R
Sbjct: 2   SSNHPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTR 61

Query: 65  KNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVES 124
           K+SH+TPA SA TLIHS +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ 
Sbjct: 62  KSSHNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 121

Query: 125 LLEHLNESNVFTHHDLSPIKERLDEISKIVEQ------------KNSSPMYEEDANDARI 172
           LLEHLNESNVFTHHDL PIKERLDE+S+IVE+            K   P  +ED  D  +
Sbjct: 122 LLEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIEL 181

Query: 173 REIDNERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSL 232
           ++ D E+ +NK+EEDLLLRAKLKHC  EY  +ESKLEEIDP+L ++MEKLF+IRRGLLSL
Sbjct: 182 KKADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSL 241

Query: 233 VXXXXXXXXXXXXNINSLLQEHNDLQANDNDLMDDK---HLVSQEYVHEKLSVLKNELSE 289
                                     A   + ++DK   H VS  +V+ KL+ L+ ELSE
Sbjct: 242 AASTKR-------------------NARSKESLEDKKRTHTVSPNFVNSKLNELQVELSE 282

Query: 290 LESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYE 349
           LES+RD SGKFKSLET +V E+GQSVLNGLLDDCHDLI+DLSHQT+ G++LD  LQP Y+
Sbjct: 283 LESHRDPSGKFKSLETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYD 342

Query: 350 QLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYL 409
            LIDIKTTLENL++TRRWTLRETDLF+YQK+L EID+ R++GKFPT+S DSKGQSILLYL
Sbjct: 343 NLIDIKTTLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYL 402

Query: 410 LRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLAS 469
           LRRCYAIIYKLLESSEPVSEALQ IHNQLSTVRRCLLELKRMGGVNN+RELYPYQMKLAS
Sbjct: 403 LRRCYAIIYKLLESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLAS 462

Query: 470 LDNLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509
           LDN+R +G FYD+DGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 463 LDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHELKI 502

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/511 (71%), Positives = 418/511 (81%), Gaps = 18/511 (3%)

Query: 1   MFSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVREL 60
           M  S   HPQ VPKEEE ILNYLLEVRS L+KLK+NRTQYLNSKDV  TYQ VLT+VREL
Sbjct: 6   MSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVREL 65

Query: 61  DDIRKNSHDTPAK--SAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 118
           D IRK+S D   +   A TLIH T++HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 66  DGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 125

Query: 119 LSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNE 178
           LSTV+ LLEHL ESNVFTHHDL PIKERLDEISKIVE+   S   +E A     +EID E
Sbjct: 126 LSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPEDEVA---EFKEIDTE 182

Query: 179 RKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXX 238
           R +N+IE+DLLL+AKL+HC DEY+ LESKLEEI P LS +ME+LF++RRGLLSL      
Sbjct: 183 RNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSK- 241

Query: 239 XXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSG 298
                     ++  E+    A    L D KH++SQEY+   L   K E++++E+ RD++G
Sbjct: 242 ---------KNIPDENYKEPAK---LDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENG 289

Query: 299 KFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTL 358
           +F S  T +  ++GQ++LNGLLDDC+DLI+DLSHQTNGGL LDP+LQP YE+LIDIKTTL
Sbjct: 290 QFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTL 349

Query: 359 ENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIY 418
           ENLMITRRWTLRETDLF+YQK+L EID+ R++GKFPTKS DSKGQSI+LYLLRRCYAIIY
Sbjct: 350 ENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIY 409

Query: 419 KLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGI 478
           KLLESSEPVSE+LQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR +G 
Sbjct: 410 KLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGK 469

Query: 479 FYDSDGNIPEGQGILNALLAECFDIMHELKV 509
           FYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 470 FYDSDGNIPEGQGILNALLAGCFDILHELKV 500

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/530 (68%), Positives = 431/530 (81%), Gaps = 30/530 (5%)

Query: 2   FSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 61
           F ++ Q  Q VPKEEE ILNY L+VR++L++LK+NRTQYLNS +VQ TYQ VLTKVRELD
Sbjct: 5   FQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELD 64

Query: 62  DIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 121
            IRK +HD  A +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 65  AIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 124

Query: 122 VESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDA--NDAR--IREIDN 177
           VESLL+HL E+ ++THHDL PIK+RL+EISKIVE+  +     +DA  ND    I++ID 
Sbjct: 125 VESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDA 184

Query: 178 ERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXX 237
           ER +NK+E++LLL+AKLKHC D Y+ +ESKLE+IDP+L++VMEKLF+IRRGLLSLV    
Sbjct: 185 ERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSR 244

Query: 238 XXXXXXXXNINSLLQEHN-------DLQAN-----DNDLMDD--KHLVSQEYVHEKLSVL 283
                   N++S + E +         Q+N      N+L  +  K+ +S + V EK  VL
Sbjct: 245 --------NMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVL 296

Query: 284 KNELSELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGG----LA 339
           +N+L  LE++RD+ GKFKSLET +V E GQ VLNGLLDDC+DL+SDLSHQ   G    L+
Sbjct: 297 RNDLKNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLS 356

Query: 340 LDPHLQPTYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQD 399
           +DP LQP YE+L++IKTTLENLMITRRWTLRETDLFSYQKKLNEID+ R+NG+FPT++ D
Sbjct: 357 MDPSLQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETAD 416

Query: 400 SKGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERE 459
           S+GQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERE
Sbjct: 417 SRGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERE 476

Query: 460 LYPYQMKLASLDNLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509
           LYPYQMKLASLDNLR +GIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 477 LYPYQMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/513 (68%), Positives = 415/513 (80%), Gaps = 14/513 (2%)

Query: 4   SAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDI 63
           S   HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++
Sbjct: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61

Query: 64  RKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 123
           RKNSH TP+ SA TLIHS+ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+
Sbjct: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121

Query: 124 SLLEHLNESNVFTHHDLSPIKERLDEISKIVEQK---NSSPMYEEDANDARIREI----D 176
           SLLEHLNESNV+THHDL PIKERL+E+S IVEQ    ++S     +A+   I E     D
Sbjct: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKD 181

Query: 177 NERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXX 236
            E  +NKIEEDLLLRAKLKHC DEY+ +ESKLEEI P L + ME LF+IRRGLLSL    
Sbjct: 182 EELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASST 241

Query: 237 XXXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDD 296
                       ++L       + +++  + K+++  + + EKL  L+ +L +LES+RD 
Sbjct: 242 KRPHQKQLVPDPAVL-------SVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDI 294

Query: 297 SGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKT 356
           +GKFKSLET +V EKGQ+VLNGLLDDCHDL++DLSHQ +GG++LD  LQP Y+QL+DIKT
Sbjct: 295 NGKFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKT 354

Query: 357 TLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAI 416
           TLENL++TRRWTLRETDLF+YQKKL EID+ R+NGKFPT   DSKGQSILLYLLRRCYAI
Sbjct: 355 TLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAI 414

Query: 417 IYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTN 476
           IYKLLESSEPVSE+LQ +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R +
Sbjct: 415 IYKLLESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVD 474

Query: 477 GIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509
           G FYD+DGNIPEGQG LNALLAECFDI+HELK+
Sbjct: 475 GKFYDTDGNIPEGQGTLNALLAECFDIIHELKI 507

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/510 (69%), Positives = 415/510 (81%), Gaps = 22/510 (4%)

Query: 7   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 66
           +HPQ VP EEES L Y LEVR+ L++LKQNR+QYLNSKDV +TYQ VLTKVRELD IRK+
Sbjct: 3   KHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKS 62

Query: 67  SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 126
           SH  PA SA TLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 63  SHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 127 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARI--REIDNERKQNKI 184
           EHL+ESNVFTHHDL PIKERLDEIS+IV Q  SS +   + +D RI   +I +E+ +NKI
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVSQ--SSYLDGTEISDGRIDFAKIQDEKDRNKI 180

Query: 185 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXXXXXXX 244
           EEDLLLRAKL+HC  EY+ +ESKLEEIDP L + MEKLF++RRGLLSL            
Sbjct: 181 EEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKR------ 234

Query: 245 XNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLE 304
              N++ ++   ++  D+       L+ QE + ++L  L+ EL+E+ES+RD SGKF SLE
Sbjct: 235 ---NAMSKQ--GVKTPDS-------LLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLE 282

Query: 305 THEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMIT 364
           T E+  KGQ+VLNGLLDDCHDLI+DLSH  N  ++LD  LQP Y+ LIDIKTTLENL++T
Sbjct: 283 TGEIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVT 342

Query: 365 RRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 424
           RRWTLRETDLFSYQK+L+EID  R+ GKFPT++ D+KGQ+ILLYLLRRCYAIIYKLLE S
Sbjct: 343 RRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECS 402

Query: 425 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDG 484
           EPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R +G FYD DG
Sbjct: 403 EPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDG 462

Query: 485 NIPEGQGILNALLAECFDIMHELKVEAEER 514
           NIPEGQG LNALLAECFDI+HELK+EAEER
Sbjct: 463 NIPEGQGTLNALLAECFDILHELKIEAEER 492

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/528 (64%), Positives = 414/528 (78%), Gaps = 38/528 (7%)

Query: 4   SAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDI 63
           ++ QHPQ VP+EEE +LNY LE+R+ L++LKQNRT+YL+SK VQ TY+ VLT+VRELDD+
Sbjct: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70

Query: 64  RKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 123
           RK++H+TP+ SA TLIH+ ELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+
Sbjct: 71  RKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQ 130

Query: 124 SLLEHLNESNVFTHHDLSPIKERLDEISKIVEQ----------------KNSSPMYEEDA 167
            LLEHLNESNVFT HDL PIKERL EI KIVE+                KN+  + E D 
Sbjct: 131 RLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEAD- 189

Query: 168 NDARIREIDNERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRR 227
                R +  E ++NKIEEDLLLRAKL+HC DEY + E+K+E +DPSLS +M+KLF+IRR
Sbjct: 190 -----RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRR 244

Query: 228 GLLSLVXXXXXXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNEL 287
            LLSL                          A+    +++KH+++ E V+ ++ +L+ EL
Sbjct: 245 ELLSLAASAKKTTS----------------SASAEKELENKHVLAPESVNTRVELLQKEL 288

Query: 288 SELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPT 347
           +E+ES RD++GKFKS E+ +  EKGQ+VLNGLL DC+DL+ DLSHQ NGG+ LDP LQP 
Sbjct: 289 NEIESYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPI 348

Query: 348 YEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILL 407
           Y +LIDIKTTLENL+ITRRWTLRETDLF+YQK+L EIDS R+N KFPT S D+KGQ+ILL
Sbjct: 349 YAKLIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILL 408

Query: 408 YLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKL 467
           YLLRRCYAIIYKLLESSEPVSE+LQP+HNQLSTVRRCLL L+RMGG+NN RELYPYQMKL
Sbjct: 409 YLLRRCYAIIYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKL 468

Query: 468 ASLDNLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERA 515
           ASLD LR +G FYD DGNIPEGQ  LNALLAECFDI+HE+K+EAEE+ 
Sbjct: 469 ASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKT 516

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 77/153 (50%), Gaps = 11/153 (7%)

Query: 280 LSVLKNELSELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLA 339
           L   + EL E++S R +S KF    T     KGQ++L  LL  C+ +I  L   +     
Sbjct: 375 LFTYQKELGEIDSLRVNS-KFP---TDSGDNKGQTILLYLLRRCYAIIYKLLESSE---P 427

Query: 340 LDPHLQPTYEQLIDIKTTLENLMITRRWTLRET-DLFSYQKKLNEIDSKRINGKF-PTKS 397
           +   LQP + QL  ++  L  L + R   +  + +L+ YQ KL  +D  R++GKF     
Sbjct: 428 VSESLQPLHNQLSTVRRCL--LSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDG 485

Query: 398 QDSKGQSILLYLLRRCYAIIYKLLESSEPVSEA 430
              +GQ+ L  LL  C+ II+++   +E  +E+
Sbjct: 486 NIPEGQATLNALLAECFDIIHEMKIEAEEKTES 518

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/512 (68%), Positives = 407/512 (79%), Gaps = 25/512 (4%)

Query: 7   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 66
           +HPQ VP EEE+ L Y LEVR+ L++LKQNR+QYLNSK+V + YQ VLTKVRELD+IRK 
Sbjct: 3   KHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRKR 62

Query: 67  SHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 126
           SH  P  SA TLIH+ ELHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL
Sbjct: 63  SHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLL 122

Query: 127 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDA--NDARI--REIDNERKQN 182
           EHL+ESNVFTHHDL PIKERLDEIS+IV Q   S  ++E    N+  I   +I +E+ +N
Sbjct: 123 EHLDESNVFTHHDLRPIKERLDEISEIVTQ---SSFFKEGGEINNGSIDFTKISDEKDRN 179

Query: 183 KIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXXXXX 242
           KIEEDLLLRAKLKHC  EY  +ESKLEEIDP L   MEKLF +RRGLLSL          
Sbjct: 180 KIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKR---- 235

Query: 243 XXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKS 302
                N++L++ +  +A ++ L       SQE V EKL  L+ +L+++ES R+ SG F S
Sbjct: 236 -----NAMLKDGH--KAPESPL-------SQESVKEKLHSLEAKLTQIESQRNASGYFVS 281

Query: 303 LETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLM 362
            +T E+ E+GQSVLNGLLDDCHDLI+DLSH  N  + LD  LQP Y+ LI+IKTTLENL+
Sbjct: 282 ADTGEIVERGQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLL 341

Query: 363 ITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLE 422
           +TRRWTLRETDLF+YQK+L+EID  R+ GKFPT+S D+KGQ+ILLYLLRRCYAIIYKLLE
Sbjct: 342 VTRRWTLRETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLE 401

Query: 423 SSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDS 482
            SEPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R +G FYD 
Sbjct: 402 CSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDE 461

Query: 483 DGNIPEGQGILNALLAECFDIMHELKVEAEER 514
           DGNIPEGQG LNALLAECFDI+HELK+EAE R
Sbjct: 462 DGNIPEGQGTLNALLAECFDILHELKIEAEYR 493

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/518 (65%), Positives = 412/518 (79%), Gaps = 22/518 (4%)

Query: 2   FSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 61
            SSA Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD
Sbjct: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60

Query: 62  DIRKNSHDTPAK--SAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119
            IRK +H++        TLIHS +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDAND--ARIREIDN 177
           STV+SLL+HLNESNV+TH+DL PIKERLDEIS+IVE KNS      D  D  A   ++++
Sbjct: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVE-KNSYWNIPTDGGDGNAFADDLED 179

Query: 178 ERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXX 237
           +RK+N IEE+LLLRAKL++C   Y+ +E+KLE I   L   ME+LF+IRRGLLSL     
Sbjct: 180 KRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAK 239

Query: 238 XXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDS 297
                     + + QE  D   ND++L     ++S E ++E+L  L+ EL+++ S+R++S
Sbjct: 240 ----------SRVEQEEQD--ENDDELC----ILSHEKINERLKALETELADVRSHRNES 283

Query: 298 GKFKSL-ETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKT 356
           GKF S+ + ++V EKGQ VLNGLLDDCHDLI DLSHQT+ GL LDPH+QP Y+ L+ IKT
Sbjct: 284 GKFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKT 343

Query: 357 TLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAI 416
            LENL++TRRWTLRETDLF+YQKKL E+DS R+NGKFP++S DSKGQ+ILLYLLRRCYAI
Sbjct: 344 ILENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAI 403

Query: 417 IYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTN 476
           IYKLLESSEPVSE+L+ IHNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R +
Sbjct: 404 IYKLLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVD 463

Query: 477 GIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514
           G FYD DGNIPEGQG LNALLAECFDI+HE+K+EAE R
Sbjct: 464 GKFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVR 501

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 79/155 (50%), Gaps = 11/155 (7%)

Query: 280 LSVLKNELSELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLA 339
           L   + +L+EL+S R + GKF S  +     KGQ++L  LL  C+ +I  L   +     
Sbjct: 361 LFTYQKKLAELDSLRVN-GKFPSESS---DSKGQAILLYLLRRCYAIIYKLLESSE---P 413

Query: 340 LDPHLQPTYEQLIDIKTTLENLMITRRWTL-RETDLFSYQKKLNEIDSKRINGKFPTKSQ 398
           +   L+  + QL  ++  L  L + R   +  E +L+ YQ KL  +D+ R++GKF     
Sbjct: 414 VSESLERIHNQLSTVRHCL--LELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDG 471

Query: 399 D-SKGQSILLYLLRRCYAIIYKLLESSEPVSEALQ 432
           +  +GQ  L  LL  C+ I++++   +E   EA Q
Sbjct: 472 NIPEGQGTLNALLAECFDILHEMKIEAEVREEAAQ 506

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/520 (63%), Positives = 410/520 (78%), Gaps = 26/520 (5%)

Query: 2   FSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 61
            +S   HPQIVP EEE ILN+LLEVR+ LAKLKQNRTQ+LN+K VQ TYQ VLTKVRELD
Sbjct: 8   LASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELD 67

Query: 62  DIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 121
           +IRKNS  TPAK+A TLIH ++LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLST
Sbjct: 68  EIRKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLST 127

Query: 122 VESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQK-------NSSPMYEEDANDARIRE 174
           V+ LLEHLNES +FT HDL PIKERLDEI +IVE+        N S +      +  + E
Sbjct: 128 VQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHELIE 187

Query: 175 IDNERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVX 234
           I+NER +N+IEEDLL+RAKL+ C ++++ +ES+LE+I+P+LS++++KL+ IRRGLLSL  
Sbjct: 188 IENERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLAS 247

Query: 235 XXXXXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLK--NELSELES 292
                        ++L +  N+  A+ N  + DK        H++L +LK   +L E+ES
Sbjct: 248 PTN----------DTLSKSDNNHIASTNHNVSDKS-------HKELVLLKMKKQLVEIES 290

Query: 293 NRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLI 352
            RD++G +KSLET++V  +GQ ++N L+DDC+DLI+DLSH  NG +  DP+LQ  Y+ LI
Sbjct: 291 QRDENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLI 350

Query: 353 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRR 412
           DIKT L NLM+TRRWTLRETDLFSYQKKL EIDS R+NGKF + + D+KGQSI+LYLLRR
Sbjct: 351 DIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRR 410

Query: 413 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 472
           CYAIIYKLLESSEP+SE+LQ IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD 
Sbjct: 411 CYAIIYKLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDE 470

Query: 473 LRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAE 512
           LR +G FYD++G+IPEGQGILNA+LAECFD++HELK +AE
Sbjct: 471 LRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 81/156 (51%), Gaps = 17/156 (10%)

Query: 286 ELSELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQ 345
           +L+E++S R + GKFKS  +     KGQS++  LL  C+ +I  L   +     +   LQ
Sbjct: 378 KLAEIDSLRVN-GKFKSATSDA---KGQSIILYLLRRCYAIIYKLLESSE---PISESLQ 430

Query: 346 PTYEQLIDIKTTLENLMITRRWTLRETD---LFSYQKKLNEIDSKRINGKFPTKSQD-SK 401
             + QL    +T+   ++T +     TD   L+ YQ KL  +D  RI+GKF   + D  +
Sbjct: 431 SIHTQL----STVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPE 486

Query: 402 GQSILLYLLRRCYAIIYKLLESSEPV--SEALQPIH 435
           GQ IL  +L  C+ ++++L   +E    SE   PI+
Sbjct: 487 GQGILNAMLAECFDMVHELKCDAEAYSSSENATPIN 522

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/505 (64%), Positives = 389/505 (77%), Gaps = 37/505 (7%)

Query: 10  QIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHD 69
           Q VPKEEE  L+YLL+VR +L+ LKQNR+Q+LNSKD+Q TYQ VLTKVRELD+IR+  H 
Sbjct: 10  QAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHG 69

Query: 70  TPAKS-AATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEH 128
              ++   T +HS ELHNRVD+VLDDVFQLLSLCF+T GLKNSAPATYASLSTV+SLLEH
Sbjct: 70  NSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLEH 129

Query: 129 LNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEE----DANDARIREIDNERKQNKI 184
           L ES ++THHDL PIKERLDEI+KIV+Q   S  Y++    D +D  +  IDNER +NKI
Sbjct: 130 LIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRIDNERNKNKI 189

Query: 185 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXXXXXXX 244
           E++LLL+AKL HC  EY+ +ES+LEE+DPS ++++EKLF+IRR L+SLV           
Sbjct: 190 EQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVE---------- 239

Query: 245 XNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLE 304
                               +   +   Q+ + +KL  L+ +L+E+E+NRD  G F S+E
Sbjct: 240 --------------------ISKSNTGVQDQIDKKLKHLQLQLNEIENNRDPDGNFVSIE 279

Query: 305 THEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMIT 364
           +     KG +VLNGL DDCHDLISDL+H T     LDP LQ  Y+ LID+K +LENLM+T
Sbjct: 280 SGNPIIKGSNVLNGLSDDCHDLISDLTHHTKT--FLDPDLQNVYDNLIDVKGSLENLMVT 337

Query: 365 RRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 424
           RRWTLRETDLFSY KKLNEID+ R++GKFPTKS  +KGQ+ILLYLLRRCY +IYKLLESS
Sbjct: 338 RRWTLRETDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESS 397

Query: 425 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDG 484
           EPVSEALQPIHNQLSTVRRCLL+LKRMGGVNNERELYPYQMKLASLDNLR +G FYDS G
Sbjct: 398 EPVSEALQPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKG 457

Query: 485 NIPEGQGILNALLAECFDIMHELKV 509
           NIPEGQGILNALLA CFDI+HELK+
Sbjct: 458 NIPEGQGILNALLAGCFDILHELKI 482

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/498 (65%), Positives = 382/498 (76%), Gaps = 24/498 (4%)

Query: 12  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHDTP 71
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79

Query: 72  AKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEHLNE 131
           A  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139

Query: 132 SNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNERKQNKIEEDLLLR 191
           SN+FT+HDL PIK+RLDEIS IVE  NS   Y+ D  +    E + +R +NKIEEDLLLR
Sbjct: 140 SNIFTNHDLRPIKDRLDEISTIVEN-NSYRNYDFDLTNP-ADETEEKRNKNKIEEDLLLR 197

Query: 192 AKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXXXXXXXXNINSLL 251
           AKLKHC DEY+ + SKLEEI P LS++MEKL+ IRR LLSL                   
Sbjct: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDTRE-------- 249

Query: 252 QEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLETHEVTEK 311
                         D     S +   E LS L+ EL ELES+RD++G FKSLET EV  K
Sbjct: 250 --------------DFSQFNSSKESQEALSSLEQELEELESHRDENGNFKSLETGEVVLK 295

Query: 312 GQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMITRRWTLRE 371
           GQ+VL GL+D+CHDLI+D ++  NG   +DP L+P Y++LI+IKT L NLMITRRWTLR+
Sbjct: 296 GQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRD 355

Query: 372 TDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEAL 431
           TDLF YQKKL  ID+KR+NGKFPTKS D+KGQ+ILLYLLRRCYAIIYKLLESS PVSE+L
Sbjct: 356 TDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESL 415

Query: 432 QPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDGNIPEGQG 491
           Q IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR +G F+D++G IPEGQG
Sbjct: 416 QSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQG 475

Query: 492 ILNALLAECFDIMHELKV 509
            LNALLAECFDIMHEL++
Sbjct: 476 TLNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/513 (61%), Positives = 383/513 (74%), Gaps = 30/513 (5%)

Query: 12  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS---- 67
           VP+ E  IL YL++VR  L +LK NR++YLNSK+V+  +Q VLTKVRELDDIRK+     
Sbjct: 17  VPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKDD 76

Query: 68  --HDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESL 125
              D+  +   TL+ +  LHN+VDS++DDVFQLLSLCFLTVGLKNSAPATY SLSTV+ L
Sbjct: 77  GQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQKL 136

Query: 126 LEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDN-ERKQNKI 184
           LEHL+ESN+FT+HDL PIKERLDEISKIV Q NS   YE + ++    ++D+ E KQN I
Sbjct: 137 LEHLDESNIFTNHDLRPIKERLDEISKIV-QNNSYKNYEFNEDEINPNQVDDDEIKQNLI 195

Query: 185 EEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXXXXXXX 244
           EEDLLLRAKLK C DE+  + SKLEEIDP L+++MEKL+ IRR LLSL            
Sbjct: 196 EEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPTHKIDTTEN 255

Query: 245 XNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLE 304
            +I            N+N           E   + L  L +EL+ELE++RD+ G FKSLE
Sbjct: 256 ISI-----------FNNN-----------EESRKMLKHLSDELTELETHRDEDGNFKSLE 293

Query: 305 THEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMIT 364
           T+EV  KGQ+ L GL+D+CHDLI+D ++ +     LD +LQP Y  LI+IKT L NLMIT
Sbjct: 294 TNEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMIT 353

Query: 365 RRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESS 424
           RRWTLRETDLF YQK+L EID +R+NGKFP++S ++KGQSILLYLLRRCYAIIYKLLESS
Sbjct: 354 RRWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESS 413

Query: 425 EPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDG 484
           EPVSE+LQPIHNQLST RRCLL LKRMGGVN+ RELYPYQ+KLASLD LR +G FYDS G
Sbjct: 414 EPVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSG 473

Query: 485 NIPEGQGILNALLAECFDIMHELKVEAEERALN 517
            IPEGQG LNALLAECFD++HEL++E+EE   N
Sbjct: 474 EIPEGQGTLNALLAECFDMLHELEIESEESVDN 506

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/469 (60%), Positives = 347/469 (73%), Gaps = 22/469 (4%)

Query: 48  TTYQHVLTKVRELDDIRKNSHDTPAKSAA-TLIHSTELHNRVDSVLDDVFQLLSLCFLTV 106
            TYQ VLTKVR LD +RK  H     +   TLIHS  LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61

Query: 107 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEED 166
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERLDEI +IVE+ +   M E++
Sbjct: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVEDE 121

Query: 167 ANDARIREIDNERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIR 226
           A    + E+  E++ NK+EEDLL+RAKL+HC D Y  ++SK   I P L  + +KLF IR
Sbjct: 122 AP---LDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIR 178

Query: 227 RGLLSLVXXXXXXXXXXXXNINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNE 286
           R LLSL                       D  A +          S   +  +L  L++ 
Sbjct: 179 RELLSLAASA-----------------KTDRAAGEGSTERSTTPASPNTLASRLKDLESM 221

Query: 287 LSELESNRDDSGKFKSLETHE-VTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQ 345
           + E+ES+RDDSGKF S +  + V +KGQS LNGLLDDC +L  DLSHQT+G L LDP LQ
Sbjct: 222 ILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQ 281

Query: 346 PTYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSI 405
           P YE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+D+ R+N K P+ S  SKGQ++
Sbjct: 282 PIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQAL 341

Query: 406 LLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQM 465
           +LYLLRRCYA IYKLLESSEPVSE+LQ IHNQLSTVRRCL ELKRMGGV++ER+LYPYQM
Sbjct: 342 ILYLLRRCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQM 401

Query: 466 KLASLDNLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514
           KLASLDN+R +G FYD+DGNIPEGQG LNALLAECFDI+HE+K+EAE R
Sbjct: 402 KLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVR 450

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  179 bits (453), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 133/440 (30%), Positives = 224/440 (50%), Gaps = 65/440 (14%)

Query: 114 ATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNS-------------- 159
           + Y+S+  ++ LL  LN+SN+FT +DLSP+K RLDEI  I+E   S              
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 160 -----------------------SPMYEEDANDARIREIDNERKQNKIEEDLLLRAKLKH 196
                                  +P    D  + ++++ D+   +  I ++L        
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQEL------DD 186

Query: 197 CKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVXXXXXXXXXXXXNINSLLQEHND 256
           C   ++ +E K + ID +LS++++K+  +R+ LL +V                +L++ N 
Sbjct: 187 CYKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCF----VLKDPNH 242

Query: 257 LQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLETHEVTEKGQSVL 316
           +    N   D K       +   L V+K + +E +  +    K      +E    GQ +L
Sbjct: 243 MS---NSTFDKK----LNEIQRNLDVIKEKNTEYDEGQSQRNK------NEGNINGQRIL 289

Query: 317 NGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMITRRWTLRETDLFS 376
           NGL+D C ++I D+       +  D      +E+ + +K  LE +++T R +L+  DLF+
Sbjct: 290 NGLVDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFN 348

Query: 377 YQKKLNEIDSKRINGKFPTKSQDS-KGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIH 435
             K+L++++ + I        +DS + +SI+++ LRRC+ IIYK+LESSEPV   L+P++
Sbjct: 349 LHKELSKLEKRTIRH---YNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLY 405

Query: 436 NQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDGNIPEGQGILNA 495
           NQLST+ R LL+LK  GGV    +L P ++KL ++ + R N  F D  GNIP GQ  LNA
Sbjct: 406 NQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNA 465

Query: 496 LLAECFDIMHELKVEAEERA 515
           LL EC +++  L+++ E R 
Sbjct: 466 LLHECMELLKILEIDFEGRT 485

>YLR457C Chr12 complement(1055812..1056771) [960 bp, 319 aa] {ON}
           NBP1Spindle pole body (SPB) component, required for the
           insertion of the duplication plaque into the nuclear
           membrane during SPB duplication; essential for bipolar
           spindle formation; component of the Mps2p-Bbp1p complex
          Length = 319

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 21/113 (18%)

Query: 414 YAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNL 473
           Y I+  LL+SS         IH   +  RR +  L R        E+ P ++ L+     
Sbjct: 210 YRILEDLLDSSN--------IHPSYTKSRRTMSNLAREND-----EIKPLKIDLSPSPIR 256

Query: 474 RTNGIF-------YDSDGNIPEGQGILNALLAECFDIMHELK-VEAEERALNP 518
           RTN +F       Y+ DGNIPE Q +   +   C    +  +  E E+  L+P
Sbjct: 257 RTNSLFTSSPMKTYNRDGNIPEMQPLQENISPACPTPPYRSRETEKEDETLSP 309

>TPHA0F02620 Chr6 complement(577529..580285) [2757 bp, 918 aa] {ON}
           Anc_6.70 YLR273C
          Length = 918

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 287 LSELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDP---- 342
           L + E N D+  KF   E ++ +++G S L+ L+++ +    DL  ++N      P    
Sbjct: 172 LRQFEINNDNDSKFPFFENNDDSDEGDSELDHLINNSYLFSKDLFFKSNKNYTFSPKPMN 231

Query: 343 ---HLQPTYEQLIDIKTTLENLMITRRWTLRETDLFSYQ 378
              ++       ID  T+L   + T+ W L ++++ S++
Sbjct: 232 QNQNIDDAINDFIDC-TSLHRAVTTKNWKLLKSNVSSFE 269

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 51  QHVLTKVRELDDIRKNSHDT--PAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGL 108
           ++V T  R    +R   HD   P K    +  ST L    DSV+ D F +   C   +  
Sbjct: 521 ENVATLKRLFPGVRGLVHDLCHPKKDKYAVAVSTVLGKNFDSVIVDNFSVAQECISYLKR 580

Query: 109 KNSAPATYASLSTVESLLEHLNESNV 134
           + S  A++  L T++++  +L  SN 
Sbjct: 581 QRSGVASFIPLDTIDAITANLPVSNT 606

>KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 1059

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 39/84 (46%), Gaps = 18/84 (21%)

Query: 71  PAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGL------KNSAPATYASLSTVES 124
           PA ++  L+  T+L +            LSL FLT+         N  PA    ++T   
Sbjct: 99  PAAASNLLVTITKLMSN-----------LSLIFLTINSDAIGADSNKIPAWRNPVNTCIK 147

Query: 125 LLEHLNESNVFTHH-DLSPIKERL 147
           LL+H NESN+F    D S I ERL
Sbjct: 148 LLQHCNESNLFEWRTDNSEIAERL 171

>Smik_15.89 Chr15 (163208..164563) [1356 bp, 451 aa] {ON} YOL069W
           (REAL)
          Length = 451

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 271 VSQEYVHEKLSVLKNELSELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDL 330
           +S++ + + L  L  ++ ELESNRD   K  + +  E++E G   LN LL +    + DL
Sbjct: 218 ISKQSIFKDLEALSFQIVELESNRDKLIKISNTDIRELSE-GIKELNNLLTERKKTLHDL 276

Query: 331 SHQTNGGLALDPHLQPTYEQLIDI 354
           S Q     A     +    +L D+
Sbjct: 277 STQQKNLQATVTTFETIISELYDV 300

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 99  LSLCFLTVGLKNS------APATYASLSTVESLLEHLNESNVFTHHD 139
           +S+C +T+ + N       AP TY  L ++  L+ HL  S  F H D
Sbjct: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54

>YBR042C Chr2 complement(320416..321609) [1194 bp, 397 aa] {ON}
           CST26Protein required for incorporation of stearic acid
           into phosphatidylinositol; affects chromosome stability
           when overexpressed
          Length = 397

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 270 LVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLETHEVTEKGQSVLN 317
            +S+++  +K++ L N L+ L+SN   +G         +TE+G+S+ N
Sbjct: 159 FMSRKWAQDKIT-LSNSLAGLDSNARGAGSLAGKSPERITEEGESIWN 205

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,419,648
Number of extensions: 2555326
Number of successful extensions: 11580
Number of sequences better than 10.0: 361
Number of HSP's gapped: 11918
Number of HSP's successfully gapped: 444
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)