Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.17singletonON59592913e-36
YPL261CsingletonOFF102611113e-08
Smik_6.468singletonON2624812e-04
NDAI0H016605.541ON98737730.023
Skud_16.1068.704ON87135601.4
Kwal_56.248222.2ON105663582.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.17
         (59 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.17 Chr16 complement(28178..28243,28247..28342,28346..283...   116   3e-36
YPL261C Chr16 complement(48996..49304) [309 bp, 102 aa] {OFF} Du...    47   3e-08
Smik_6.468 Chr6 (771911..771916,771920..771991) [78 bp, 26 aa] {...    36   2e-04
NDAI0H01660 Chr8 complement(400912..403875) [2964 bp, 987 aa] {O...    33   0.023
Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {...    28   1.4  
Kwal_56.24822 s56 complement(1158142..1161312) [3171 bp, 1056 aa...    27   2.9  

>Skud_16.17 Chr16
          complement(28178..28243,28247..28342,28346..28360) [177
          bp, 59 aa] {ON} YPL261C (REAL)
          Length = 59

 Score =  116 bits (291), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%)

Query: 1  NSYSLCTFNDVKYWKSPRRLNSSFPLLLAILEPIFAASSPKICSSFLFVIISREFPFLK 59
          NSYSLCTFNDVKYWKSPRRLNSSFPLLLAILEPIFAASSPKICSSFLFVIISREFPFLK
Sbjct: 1  NSYSLCTFNDVKYWKSPRRLNSSFPLLLAILEPIFAASSPKICSSFLFVIISREFPFLK 59

>YPL261C Chr16 complement(48996..49304) [309 bp, 102 aa] {OFF}
          Dubious open reading frame unlikely to encode a
          protein; partially overlaps the uncharacterized ORF
          YPL260W
          Length = 102

 Score = 47.4 bits (111), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 5/61 (8%)

Query: 1  NSYSL-CTFNDVKYWKSPRRLNSSFPLLLAILEPIFAASSPK-ICSSFLFVIISREFPFL 58
          +SYSL   F   K W+SPRR +SSFPLLL + +PIFAA   K ICSS    ++S    FL
Sbjct: 5  DSYSLLIQFQRFKNWESPRRFSSSFPLLLFVFKPIFAAKLLKEICSS---GVLSYSLSFL 61

Query: 59 K 59
          K
Sbjct: 62 K 62

>Smik_6.468 Chr6 (771911..771916,771920..771991) [78 bp, 26 aa]
          {ON} YPL261C (REAL)
          Length = 26

 Score = 35.8 bits (81), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 15 KSPRRLNSSFPLLLAILEPIFAAS 38
          KS RR N SFPL+L +L+PIFAA 
Sbjct: 3  KSSRRFNDSFPLMLIVLKPIFAAQ 26

>NDAI0H01660 Chr8 complement(400912..403875) [2964 bp, 987 aa] {ON}
           Anc_5.541 YDR430C
          Length = 987

 Score = 32.7 bits (73), Expect = 0.023,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 2   SYSLCTFNDVKYWKSPRRLNSSFPLLLAILEPIFAAS 38
           +Y L   ND+ Y ++ R LN S PL L    P+FA S
Sbjct: 554 NYRLTDTNDITYIRAKRSLNDSIPLELYPYLPLFAES 590

>Skud_16.106 Chr16 complement(192440..195055) [2616 bp, 871 aa] {ON}
           YPL174C (REAL)
          Length = 871

 Score = 27.7 bits (60), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 12  KYWKSPRRLNSSFPLLLAILEPIFAASSPKICSSF 46
           K+ K    L+    L+L IL PIF    PK+ ++F
Sbjct: 490 KFLKENEFLDKDVTLILRILHPIFETIIPKLLAAF 524

>Kwal_56.24822 s56 complement(1158142..1161312) [3171 bp, 1056 aa]
           {ON} YDL240W (LRG1) - Protein similar to LIM-domain
           proteins and to rho/rac GTPase-activating family of
           proteins [contig 160] FULL
          Length = 1056

 Score = 26.9 bits (58), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 1   NSYSLCTFND---VKYWKSPRRLNSSFPLLLAILEPIFAASSPK-ICSSFLFVIISREFP 56
           +SYS+   +D    KY K PR L++   + L +L  + +AS  K +  S L  +I+    
Sbjct: 339 DSYSVTDSSDYSATKYAKFPRNLSTKVMIYLQLLRKLSSASKEKDVNVSSLMSVITGVAH 398

Query: 57  FLK 59
           FLK
Sbjct: 399 FLK 401

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,514,695
Number of extensions: 195642
Number of successful extensions: 516
Number of sequences better than 10.0: 6
Number of HSP's gapped: 516
Number of HSP's successfully gapped: 6
Length of query: 59
Length of database: 53,481,399
Length adjustment: 32
Effective length of query: 27
Effective length of database: 49,812,087
Effective search space: 1344926349
Effective search space used: 1344926349
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)