Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.166.13ON48848826090.0
Smik_6.4706.13ON48848825390.0
YPL262W (FUM1)6.13ON48848825280.0
Suva_16.436.13ON48848825140.0
SAKL0E00946g6.13ON49349520790.0
KLTH0C11462g6.13ON49246020780.0
Kwal_56.223626.13ON49349220510.0
Kpol_1045.766.13ON48548720490.0
TDEL0G045806.13ON48446120470.0
KNAG0E027506.13ON49847620410.0
Ecym_30166.13ON48946420330.0
Kpol_1032.46.13ON46746020300.0
KLLA0D00902g6.13ON49249220280.0
ACR013C6.13ON48847320220.0
NCAS0D026206.13ON49346120150.0
TPHA0J002706.13ON49646120140.0
CAGL0A01045g6.13ON48346020070.0
KAFR0B065206.13ON49548819980.0
ZYRO0C07964g6.13ON50546019610.0
TBLA0G010006.13ON46545919030.0
NDAI0I024706.13ON47546318920.0
TBLA0A071306.13ON50045918250.0
AEL019W1.354ON4692451251e-06
SAKL0D09746g1.354ON4642751171e-05
KLLA0A08404g1.354ON4612431161e-05
NDAI0G059401.354ON4622431152e-05
Ecym_27491.354ON4702741152e-05
KNAG0I015601.354ON4622821142e-05
NCAS0A090101.354ON4622381124e-05
Skud_8.701.354ON4632391116e-05
Ecym_24524.197ON4821941116e-05
Kpol_1018.1251.354ON4602431091e-04
TDEL0D022201.354ON4652421091e-04
CAGL0I08987g1.354ON4612751081e-04
KLLA0B13189g4.197ON4821921081e-04
TPHA0A021901.354ON4632451081e-04
SAKL0B04972g4.197ON4821891062e-04
Suva_15.2011.354ON4632391053e-04
ZYRO0G00748g1.354ON4622411053e-04
Smik_8.831.354ON4632381036e-04
KAFR0A009501.354ON4642411027e-04
Kwal_47.180664.197ON4821891019e-04
Kpol_1042.164.197ON4821891010.001
NDAI0J019504.197ON4821911010.001
YHR018C (ARG4)1.354ON4632391010.001
TBLA0F034801.354ON4662371000.001
NCAS0J012004.197ON4821891000.001
TDEL0E017604.197ON482189990.001
CAGL0B02794g4.197ON482189990.001
Skud_12.4434.197ON482192990.001
KNAG0B058404.197ON482189990.002
KLTH0A03344g4.197ON482189990.002
YLR359W (ADE13)4.197ON482192980.002
Suva_10.4594.197ON482192970.003
Smik_12.4464.197ON482192970.003
TPHA0B010404.197ON482189970.003
Kwal_27.127821.354ON465261940.007
TBLA0A083204.197ON482189930.008
KLTH0G19338g1.354ON465256910.014
ABL006C4.197ON482197910.017
ZYRO0B07964g4.197ON482189900.020
KAFR0A062304.197ON482189870.050
Suva_4.4946.148ON85092714.5
NDAI0G057601.321ON448108695.7
ZYRO0C12606g3.438ON113072697.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.16
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...  1009   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   982   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   978   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   972   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   805   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   805   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   794   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   793   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   793   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   790   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   787   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   786   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   785   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   783   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   780   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   780   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   777   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   774   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   759   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   737   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   733   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   707   0.0  
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    53   1e-06
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    50   1e-05
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    49   1e-05
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    49   2e-05
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    49   2e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    49   2e-05
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    48   4e-05
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    47   6e-05
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    47   6e-05
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    47   1e-04
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    47   1e-04
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    46   1e-04
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    46   1e-04
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    46   1e-04
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    45   2e-04
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    45   3e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    45   3e-04
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    44   6e-04
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    44   7e-04
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    44   9e-04
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    44   0.001
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    44   0.001
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    44   0.001
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    43   0.001
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    43   0.001
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    43   0.001
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    43   0.001
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    43   0.001
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    43   0.002
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    43   0.002
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    42   0.002
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    42   0.003
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    42   0.003
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    42   0.003
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    41   0.007
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    40   0.008
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    40   0.014
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    40   0.017
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    39   0.020
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    38   0.050
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    32   4.5  
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    31   5.7  
ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} simil...    31   7.0  

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/488 (100%), Positives = 488/488 (100%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300
           AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420
           VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PENMLGPK
Sbjct: 481 PENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/488 (96%), Positives = 480/488 (98%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLR +N +CKA +QSSYK N+RRMNSTFR ETDAFGEINVPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAA+VNESLGGLDPKISKAIQ+AADEV SGKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           IQNELIPEL NLKNALEAKSKEF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300
           AHSLKTLSFLAQGGTAVGTGLNTKPGFD+KIAEQIS ETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420
           VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITD+AYSFRVHCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PENMLGPK
Sbjct: 481 PENMLGPK 488

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/488 (95%), Positives = 482/488 (98%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLRF+N +CK  ++SSYK+N+RRMNS+FR ETDAFGEI+VPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAA+VNESLGGLDPKISKAIQQAADEV SGKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSK+VHPNNHCNQSQSSNDTFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           IQNELIPELTNLKNALEAKSKEF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300
           AHSLKTLSFLAQGGTAVGTGLNTKPGFD+KIAEQIS ETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420
           VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITD+AYSFRVHCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PE+MLGPK
Sbjct: 481 PEHMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/488 (95%), Positives = 479/488 (98%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLRFSN +CKA+LQSSYKVN+RRMNSTFR ETDAFGEINVPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120
           GARERMPLPLVHAFGVLKKSAA+VNESLGGLDPK+SKAIQQAADEV +GKLDDHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIEILGGKIGSK+VHPNN CNQSQSSNDTFPTVMHIAASLQ
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQ 180

Query: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I+ ELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV
Sbjct: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300
           AH+LKTLSFLAQGGTAVGTGLNTKPGFD+KIAEQIS ETGLKFQTAPNKFEALAAHDAIV
Sbjct: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           ECSGALNTLACSLFKIAQDIRYLGSGPRCGY+ELMLPENEPGSSIMPGKVNPTQNEALTQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420
           VCVQVMGNNAAITF GSQGQFELNVFKPVMIANLLNSIRLI D++ SFR+HCVEGIKANE
Sbjct: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
           PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 481 PENMLGPK 488
           PENMLGPK
Sbjct: 481 PENMLGPK 488

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/495 (78%), Positives = 435/495 (87%), Gaps = 10/495 (2%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNST-------FRIETDAFGEINVPADKYWGAQTQRS 53
           MLR +    + +L SS   ++R ++++       +RIETDAFGEI VPADKYWGAQTQRS
Sbjct: 1   MLRITAAANRNLLPSS---SIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRS 57

Query: 54  FQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDD 113
           F+NFKIGGARERMP  +V AFGVLKKSAA+VNESLG LDP+ISK IQ+AADEV  GKL D
Sbjct: 58  FENFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMD 117

Query: 114 HFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVM 173
           HFPLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ GSK+VHPNNHCNQ+QSSNDTFP+VM
Sbjct: 118 HFPLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVM 177

Query: 174 HIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQV 233
           HIAA  +I + L+PELT L+++ + KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+
Sbjct: 178 HIAAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQL 237

Query: 234 ENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEAL 293
            NGI RV  SL  L FLAQGGTAVGTGLNTK GF  KIAEQ+S ETG+ F+TAPNKFEAL
Sbjct: 238 TNGIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEAL 297

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
           AAHDA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPT
Sbjct: 298 AAHDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357

Query: 354 QNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCV 413
           QNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+S+RL+ D++YSFRVHCV
Sbjct: 358 QNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCV 417

Query: 414 EGIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEK 473
           +GIKANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+LGVL EK
Sbjct: 418 DGIKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEK 477

Query: 474 EFDEWVVPENMLGPK 488
           EFDEWV+PE M+GPK
Sbjct: 478 EFDEWVIPEKMIGPK 492

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/460 (83%), Positives = 418/460 (90%)

Query: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88
           R+ETDAFGEINVPADKYWGAQTQRS +NFKIGGARERMP P+V AFG+LKKSAA+VNESL
Sbjct: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92

Query: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LDPKISK IQQAADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GGK+
Sbjct: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152

Query: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208
           G+K +HPNNHCNQ+QSSNDTFP+VMHIAA  +I + L+PELT L+++   KSKEFE IVK
Sbjct: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  SL  L FLAQGGTAVGTGLNTK GF 
Sbjct: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272

Query: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
            KIAEQ+S ETG+ F+TAPNKFEALAAHDAIVECSGALNTLACSLFKIA DIRYLGSGPR
Sbjct: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332

Query: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388
           CGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKP
Sbjct: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392

Query: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           VMI+NLL+S+RL+ D+ YSFRVHCV+GI+AN  +I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPENM+GPK
Sbjct: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/492 (77%), Positives = 426/492 (86%), Gaps = 4/492 (0%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNST----FRIETDAFGEINVPADKYWGAQTQRSFQN 56
           M + +       L S  K  L   +S+    +R+ETDAFGEI VP DK WGAQTQRS +N
Sbjct: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60

Query: 57  FKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFP 116
           FKIGG RERMP P+V AFG+LKKSAA+VNESLG LDPK+SK IQ AADEV SGKL DHFP
Sbjct: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120

Query: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIA 176
           LVVFQTGSGTQSNMNANEVISNRAI+++GG++GSK +HPNNHCNQ+QSSNDTFP+VMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 177 ASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236
           A  ++ + L+PEL  L++A   K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NG
Sbjct: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 237 IQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAH 296
           I RV HSL  L FLAQGGTAVGTGLNTK GF  KIAEQ+S ETG+ F+TAPNKFEALAAH
Sbjct: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNE 356
           DA+VECSGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 357 ALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGI 416
           A+TQVCVQVMGNNAAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ D+ YSFRVHCVEGI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420

Query: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476
           +ANE +I +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVL+  EFD
Sbjct: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480

Query: 477 EWVVPENMLGPK 488
           EWVVPENM+GPK
Sbjct: 481 EWVVPENMVGPK 492

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/487 (78%), Positives = 427/487 (87%), Gaps = 4/487 (0%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           MLR +       +Q+ Y  NL+     FR+ETD FGEI VPA+KYWGAQT+RSF+NFKIG
Sbjct: 1   MLRSAIRPNTVRVQTRYISNLK----GFRVETDGFGEIKVPANKYWGAQTERSFENFKIG 56

Query: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120
           G+RERMP  +V AFGVLKK AA+VN  LGGLDP  SK IQQAADEV +GKL+DHFPLVVF
Sbjct: 57  GSRERMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVF 116

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIE+ GG +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  Q
Sbjct: 117 QTGSGTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQ 176

Query: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I   L+PELT+L++AL AKS EFEHIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 177 ISQHLLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERI 236

Query: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300
             + + L FLAQGGTAVGTGLNTK G+  +IA +IS ETGL F+TAPNKFEALAAHDAIV
Sbjct: 237 ERAQQNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIV 296

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 297 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 356

Query: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420
           VCVQVMGNNAA+TFAG+ GQFELNVFKPV+I+NLL+S++L+ D++ SFRVHCVEGIKANE
Sbjct: 357 VCVQVMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANE 416

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
            +I ELL +SLMLVTALNPKIGYDAA+KVAKNAHKKGITLKESALELGVLTEKEFDEWVV
Sbjct: 417 AKISELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 476

Query: 481 PENMLGP 487
           PE MLGP
Sbjct: 477 PEKMLGP 483

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/461 (81%), Positives = 418/461 (90%)

Query: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87
           FR+ETDAFGEI V AD+YWGAQTQRS +NF+IGG RERMP P+V AFGVLKKSAAVVNES
Sbjct: 23  FRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNES 82

Query: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
           LG LDPK+++ I+QAADEV  GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 83  LGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 142

Query: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207
           +GSK++HPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL +L+++L+AKSKEF  IV
Sbjct: 143 LGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIV 202

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQV NGI RV  SL  L +LAQGGTAVGTGLNTK GF
Sbjct: 203 KIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGF 262

Query: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
             KIAEQ+S ETGL F+TAPNKFEALAAHDA+VE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 263 AEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGP 322

Query: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 323 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFK 382

Query: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           PVMI+NLL+S+RL+ D++YSFRVHCV+GI AN  RI +L+ +SLMLVTALNPKIGYDAAS
Sbjct: 383 PVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAAS 442

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           KVAKNAHKKGITLK+SAL+LGVLTE EFDEWVVPENM+GPK
Sbjct: 443 KVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/476 (79%), Positives = 421/476 (88%), Gaps = 7/476 (1%)

Query: 20  NLRR-------MNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVH 72
           NLRR        N  FR+ETD+FGEINVPAD+YWGAQTQRSFQNFKIGG RE++P P+V 
Sbjct: 22  NLRRNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVR 81

Query: 73  AFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNA 132
           AFG+LKKSAA VNE+LG LD  I+  I+ AADEV  GKL DHFPLVVFQTGSGTQSNMNA
Sbjct: 82  AFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNA 141

Query: 133 NEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNL 192
           NEVISNRAIE+LGG++GSK+VHPNNH NQSQSSNDTFPTVMHIAA+ +I N+LIPEL NL
Sbjct: 142 NEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNL 201

Query: 193 KNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQ 252
           K+AL+ K +EF  IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV  SL  L FLAQ
Sbjct: 202 KDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQ 261

Query: 253 GGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACS 312
           GGTAVGTGLNTK GFD  +AE++S ETGL F+TAPNKFEALAAHDAIVE SGALNTLACS
Sbjct: 262 GGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACS 321

Query: 313 LFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 372
           LFKIAQDIRYLGSGPRCGY EL+LP NEPGSSIMPGKVNPTQNEA+TQVCVQVMGNN+ I
Sbjct: 322 LFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTI 381

Query: 373 TFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLM 432
           TFAGSQGQFELNV+KP+MI+NLL+SIRL+TD++ SFR+HC+  +KAN+ +I E L KSLM
Sbjct: 382 TFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLM 441

Query: 433 LVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           LVTALNPKIGYDAA+KVAKNAH K ITLKESALELGVLTEKEFDEWV+PENM+ PK
Sbjct: 442 LVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPK 497

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/464 (79%), Positives = 416/464 (89%)

Query: 24  MNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAV 83
           +N  FRIETDAFGEI VPA+KYWGAQTQRS +NFKIGG RERMP P++ AFG+LKKSAA+
Sbjct: 24  LNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAI 83

Query: 84  VNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 143
           VNESLG LDPKISK IQQAADEV  GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+
Sbjct: 84  VNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIEL 143

Query: 144 LGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEF 203
           +GG++G+K++HPNNHCNQ+QSSNDTFP+VMHIAA  +I N L+PELT L+++ + K++EF
Sbjct: 144 IGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEF 203

Query: 204 EHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNT 263
            HIVKIGRTHLQDATPLTLGQEF GY QQ+ NGI RV  SL  L FLAQGGTAVGTGLNT
Sbjct: 204 SHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNT 263

Query: 264 KPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYL 323
           K GF  KIAEQ+S ET ++F+TAPNKFEALAAHDA+VECSGALNT+ACSLFKIA DIRYL
Sbjct: 264 KVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYL 323

Query: 324 GSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFEL 383
           GSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFAG+ GQFEL
Sbjct: 324 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFEL 383

Query: 384 NVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGY 443
           NVFKPVMI+NLLNSIRL+ D++YSFRVHCV+GIKANE +I ++L +SLMLVTALNPKIGY
Sbjct: 384 NVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGY 443

Query: 444 DAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           D+A KVAKNAHKK ITLKESALELGVL+E+EF EWVVPE M+GP
Sbjct: 444 DSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/460 (81%), Positives = 416/460 (90%)

Query: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87
           FR+ETD FGEI VPADKYWGAQTQRS++NFKIGG RERMP P+V AFGVLKKSAA+VNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
            G LD  ISK IQQAADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207
           +GSKE+HPNNHCN +QSSNDTFPTVMHIAA  +I + LIP++T LK+AL  KSKEFEHIV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNTK GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
             +IAEQ+S ETG++F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           PVMI+NLL+SIRL+ D+ +SF +HCVEGI+ANE +I++LL +SLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           KVAKNAHKKGITLKESALELGVLTE EFDEWVVPE MLGP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/492 (77%), Positives = 428/492 (86%), Gaps = 5/492 (1%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNS----TFRIETDAFGEINVPADKYWGAQTQRSFQN 56
           MLR S    + + Q+     + R+ S    ++R+ETDAFGEI VP+DKYWGAQTQRS QN
Sbjct: 1   MLRNS-IVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQN 59

Query: 57  FKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFP 116
           FKIGG RERMP P+V AFGVLKKSAAVVNE LG LDP+I+K I+QAADEV  GKL +HFP
Sbjct: 60  FKIGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFP 119

Query: 117 LVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIA 176
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GSK++HPNNHCNQ+QSSNDTFP+VMHIA
Sbjct: 120 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 179

Query: 177 ASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 236
           A  +I + L+PEL  LK AL+ KS EF+HIVKIGRTHLQDATPLTLGQEFSGYVQQVENG
Sbjct: 180 AVTEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENG 239

Query: 237 IQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAH 296
           I RV  SL  L FLAQGGTAVGTGLNTK GF   IAEQ+S ETG+ F+TAPNKFEALAAH
Sbjct: 240 IARVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAH 299

Query: 297 DAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNE 356
           DA+VE SGALNTLA SLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNE
Sbjct: 300 DAVVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 359

Query: 357 ALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGI 416
           A+TQVCVQVMGN+AAITFAG+ GQFELNVFKPVMI+NLL+SIRL+ D++ SFR+HCVEGI
Sbjct: 360 AMTQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGI 419

Query: 417 KANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFD 476
           KANE RI +LL +SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+ +EFD
Sbjct: 420 KANEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFD 479

Query: 477 EWVVPENMLGPK 488
           +WV+PE M+GPK
Sbjct: 480 QWVIPEKMIGPK 491

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/473 (78%), Positives = 417/473 (88%), Gaps = 6/473 (1%)

Query: 22  RRMNST------FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75
           RR+ ST      FR+ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 15  RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 74

Query: 76  VLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEV 135
           VLKKSAAVVNE LG L+P I+KAIQQAADEV  G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 75  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 134

Query: 136 ISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNA 195
           ISNRAIE+LGG++GSK+VHPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL  L+ +
Sbjct: 135 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 194

Query: 196 LEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGT 255
            + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H+ ++L FLAQGGT
Sbjct: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254

Query: 256 AVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315
           AVGTGLNT+ GF  +IA Q+S ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314

Query: 316 IAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFA 375
           IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFA
Sbjct: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374

Query: 376 GSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVT 435
           G+ GQFELNVFKPVMIANLL+S+RL+ D+A SFRVHCV+GI+ NE RI +LL +SLMLVT
Sbjct: 375 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 434

Query: 436 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 435 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/461 (79%), Positives = 415/461 (90%)

Query: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87
           +RIETD+FGEI VPADKYWGAQTQRSFQNFKIGG+RER+P P++ AFG+LKKSAA+VNES
Sbjct: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91

Query: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
           LG LDPK++  I++AADEV  GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAIE++GGK
Sbjct: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151

Query: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207
           +GSK++HPNNHCNQSQSSNDTFP+VMHIAA L+I N LIPELT LK+AL+ K+KEF  IV
Sbjct: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+  SL  L FLAQGGTAVGTGLNTK GF
Sbjct: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271

Query: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
           D  IAE++S ETG++F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQDIRYLGSGP
Sbjct: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331

Query: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+ AGSQGQFELNV+K
Sbjct: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391

Query: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           P+MIANLLNSIRL+TD+  SFR+HC++ +KAN+ +I+E L KSLMLVTALNPKIGYDAAS
Sbjct: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPENM+GPK
Sbjct: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/461 (79%), Positives = 412/461 (89%)

Query: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87
           FRIETD FGEI VPA+KYWGAQT+RSF+NF+IGG RERMP P+V AFGVLKKSAA+VNE 
Sbjct: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
            G LDP+ISK IQ+AADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG 
Sbjct: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207
           +GSK+VHPNNH NQ+QSSND+FPTVMHIAA  +I + LIPE+ NL++ALE+KSK+F HIV
Sbjct: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ HSL  L FLAQGGTAVGTGLNT+ GF
Sbjct: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
             KIAEQIS ETG+ F+TAPNKFEALAAHDAIVE SGA+ T+A SLFKIAQDIRYLGSGP
Sbjct: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  I FAG+QGQFELNVFK
Sbjct: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           PVMI+NLL+SIRL+ D + SFR+HCVEGIKANE RI +L+ KSLMLVTALNPKIGYD A+
Sbjct: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           KVAKNAHKKGITLKESA++LG LTE EFDEWVVPE M+GPK
Sbjct: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/460 (80%), Positives = 413/460 (89%)

Query: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87
           +R+ETD FGEI VPADKYWGAQTQRSFQNFKIGGARERMP P+V AFGVLKKSAA+VNE 
Sbjct: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81

Query: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147
           LG LD +I+  IQQAADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141

Query: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207
           +GSK++HPNNHCNQ+QSSNDTFP+VMHIAA  +I N L+PE+T LK+AL  K++EF+ IV
Sbjct: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201

Query: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ ++L  L +LAQGGTAVGTGLNTK GF
Sbjct: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261

Query: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327
           D  IAEQIS ETG+ F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321

Query: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAA+TFAG+ GQFELNVFK
Sbjct: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381

Query: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447
           PVMI+NLL+SIRL+ D+ +SFRVHCVEGI+AN  +I+  L  SLMLVTALNPKIGYDAAS
Sbjct: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441

Query: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           K+AKNA KK ITLKESALEL  LT +EFDEWV+PENM+GP
Sbjct: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/488 (75%), Positives = 424/488 (86%), Gaps = 7/488 (1%)

Query: 1   MLRFSNFNCKAVLQSSYKVNLRRMNSTFRIETDAFGEINVPADKYWGAQTQRSFQNFKIG 60
           +++ +++  +    SS K       S+FR ETD+FGEINVP DKYWGAQTQRS QNFKIG
Sbjct: 14  LVKLTSYTSRFYTMSSIK-------SSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIG 66

Query: 61  GARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVF 120
           G RE++P+P++ AFG+LKKSAA+VNE LG LD +++K I  AADEV+ GKL+DHFPLVVF
Sbjct: 67  GEREKIPIPIIEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVF 126

Query: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180
           QTGSGTQSNMNANEVISNRAIE++GGK+GSK VHPNNH NQSQSSNDTFPTVMHIAA L+
Sbjct: 127 QTGSGTQSNMNANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLE 186

Query: 181 IQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240
           I  +L+PEL +LKN+L+ KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+
Sbjct: 187 ITRKLLPELNSLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRI 246

Query: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIV 300
             +L  L FLAQGGTAVGTGLNTK GFD  IAEQIS ETG+ F+TAPNKFEALAAHDAIV
Sbjct: 247 ETALYHLKFLAQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIV 306

Query: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360
           E SGALNTLACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 307 EVSGALNTLACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 366

Query: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANE 420
           VC+QVMGN++ ITFAGSQGQFELNV+KP++I+NLL+SIRL+TD++YSFRVHC++G+KAN 
Sbjct: 367 VCIQVMGNHSTITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANR 426

Query: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480
             I E L KSLMLVTALNP IGYD ASK+AKNAH K ITLKESALELG+LTE++F EWV+
Sbjct: 427 ENITENLNKSLMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVI 486

Query: 481 PENMLGPK 488
           PE M+GPK
Sbjct: 487 PEKMIGPK 494

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/460 (78%), Positives = 408/460 (88%)

Query: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88
           R+ETDAFGEI VPADKYWGAQTQRSF+NF+IGG RERMP  +VHAFG+LKK+ A VNE+ 
Sbjct: 45  RVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEAN 104

Query: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LDPK++ AI+QAADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIE+LGGK+
Sbjct: 105 GQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKL 164

Query: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208
           GSK VHPNNH N SQSSNDTFPTVMHIAA L I  +L+P LT LK++L+ KS+EF  IVK
Sbjct: 165 GSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVK 224

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGYVQQV NGI+RV  +L +L  LAQGGTAVGTGLNTK G+ 
Sbjct: 225 IGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWA 284

Query: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
             +A +++ ETG+ FQTAPNKFEALAAHDA+VE SGALNTLA SLFKIAQDIRYLGSGPR
Sbjct: 285 ENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPR 344

Query: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388
           CGY EL LPENEPGSSIMPGKVNPTQNEALTQVCVQV GN++AITFAG+ GQFELNVFKP
Sbjct: 345 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKP 404

Query: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           VMI+NLL+SI L++D++YSFRVHCV+GI+AN   I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 405 VMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASK 464

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           VAKNAHK GITLKESAL+L +LT +EFD WVVPE+M+GPK
Sbjct: 465 VAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/459 (74%), Positives = 405/459 (88%)

Query: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88
           RIE D FGE+ VPA+KYWGAQTQR+  NF IGG RERMP PL+ A+G+LKKS A+VNESL
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LDPKISKAIQ+AADEV  G L++HFPLVVFQTGSGTQ+NMN NEVISNRAIEILGG++
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208
           GSK VHPNNH NQSQS+ND+FPT MHI+A  ++  +L+PEL  L++AL+ KS EF  IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGYVQQVENGI RV +SL  L F+AQGGTAVGTG+NTK  FD
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
           I +A+QIS ETG++F+TAPNKFEALA+HDAIVECSGALNTLACSLFKI+QDIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388
           CGY EL LPENEPGSSIMPGKVNPTQNEA+ Q C+QVMGNN+AITFAG+ GQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           +MI+NLLNSIRL+TDS  SFR+HC+ GI+ANE +I++LL +SLMLVTALNPKIGYDAA+ 
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           +AK+AHK G+TLKE+AL+  +LT ++FDEW+VPE+M+ P
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/463 (75%), Positives = 414/463 (89%)

Query: 26  STFRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVN 85
           S+FR+ETD+FGEI VP++KYWGAQTQRSFQNFKIGG RE++PLP++ AFG+LKKSAA+VN
Sbjct: 12  SSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVN 71

Query: 86  ESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILG 145
           +SLG LDP I+  I +A+DEV  GKL+DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G
Sbjct: 72  QSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIG 131

Query: 146 GKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEH 205
            ++GSK++HPNNH NQSQSSNDTFP+VMHIAA L++ N LIP+LT LKN+L+ K+KE+ +
Sbjct: 132 AELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYAN 191

Query: 206 IVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKP 265
           IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+R+  SL  L FLAQGGTAVGTGLNTK 
Sbjct: 192 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKV 251

Query: 266 GFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGS 325
           GFD  IA+++S ETG+ F+TAPNKFEALAAHDAIV  S A+ T+A SLFKIAQDIRYLGS
Sbjct: 252 GFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGS 311

Query: 326 GPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNV 385
           GPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQV +Q+MGNN  I  AGSQGQFELNV
Sbjct: 312 GPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNV 371

Query: 386 FKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDA 445
           +KP+MIANLLNSIRL++D+ +SF++HCV+G+KAN  +I+E L KSLMLVTALNPKIGYDA
Sbjct: 372 YKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDA 431

Query: 446 ASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488
           ASK+AKNAH K ITLKESALELG+LTE+EFD+WV+PENM+GPK
Sbjct: 432 ASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/459 (72%), Positives = 389/459 (84%)

Query: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88
           R ETD+FGEI VPA+KYWGAQTQRSF NFKIGG RERMP P++ AFG  KK+AA+VN SL
Sbjct: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100

Query: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148
           G LD  +  AI QAA+EV+ G L++HFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG +
Sbjct: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160

Query: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208
           GSK+VHPNNH NQSQSSNDTFPTVMHIAA  +I N L+P L  L+  L++K+KEFE I+K
Sbjct: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220

Query: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268
           IGRTHLQDATPLTLGQEFSGY QQ+ N I+R+  +L  L ++AQGGTAVGTGLNTK GF 
Sbjct: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280

Query: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328
            + A Q+S++T L F T+PNKFE+LAAHDAIV    +LNTLACSLFKI+QDIRYL SGPR
Sbjct: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340

Query: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388
           CGY EL +PENEPGSSIMPGKVNPTQNEA+ Q CVQVMGNN+ I+FAG+ GQFELN +KP
Sbjct: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400

Query: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448
           +MIANLL+S RL++D+ +SF +HC  GI+AN+ +I  LL +SLMLVT+LNPKIGYDAASK
Sbjct: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460

Query: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487
           VAKNAH KGITLK+SALEL +L+ K+FDEWV PENMLGP
Sbjct: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 98/245 (40%), Gaps = 19/245 (7%)

Query: 131 NANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELT 190
            ANE    R  EI+G  I  K VH        +S ND   T M +     +Q+++ P L 
Sbjct: 90  TANE---RRLGEIIGRHISGK-VHTG------RSRNDQVATDMRLYCREMLQDKVEPALF 139

Query: 191 NLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFL 250
            L   L  +++E   ++  G THLQ A P+      S Y        +R+    + ++ L
Sbjct: 140 ELIKVLLHRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLK---EVIARL 196

Query: 251 AQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLA 310
            Q     G       G D    E ++ E G       N   A++  D +VE     +   
Sbjct: 197 NQSPLGAGALAGHPYGID---REYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFM 252

Query: 311 CSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNA 370
             + ++A+D+  + S    G+ +L       GSS+MP K NP   E L     +V G  A
Sbjct: 253 NHISRLAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

Query: 371 AITFA 375
               +
Sbjct: 311 GFLMS 315

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 104/275 (37%), Gaps = 30/275 (10%)

Query: 94  KISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEV 153
           K+   ++Q   E  +G+   H            +    ANE    R  EI+G +I  K V
Sbjct: 63  KVHHGLEQIEKEWAAGEFARH---------PSDEDIHTANE---RRLGEIIGREISGK-V 109

Query: 154 HPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTH 213
           H        +S ND   T M I     +   L+P L      L  ++KE   ++  G TH
Sbjct: 110 HTG------RSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEIDVLMPGYTH 163

Query: 214 LQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAE 273
           LQ A P+      S Y         R+   ++ L+    G  A+        G    I  
Sbjct: 164 LQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA-------GHPYGIDR 216

Query: 274 QISSETGLKFQ-TAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYH 332
           +  +  GL FQ    N   A++  D +VE           + + ++D+  + S    G+ 
Sbjct: 217 EFLAR-GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-IIYSTAEFGFI 274

Query: 333 ELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 367
           +L       GSS+MP K NP   E L     +V G
Sbjct: 275 KLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 97/243 (39%), Gaps = 21/243 (8%)

Query: 131 NANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELT 190
            ANE    R  EI+G  I  K VH        +S ND   T M I     +   ++P L+
Sbjct: 89  TANE---RRLGEIIGRGIAGK-VHTG------RSRNDQVATDMRIYCRDILNGTVLPALS 138

Query: 191 NLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFL 250
           +L   +  +++E   ++  G THLQ A P+      S Y        +R+   ++ L+  
Sbjct: 139 SLIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVS 198

Query: 251 AQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQ-TAPNKFEALAAHDAIVECSGALNTL 309
             G  A+        G    I  +  +  GL F     N   A+A  D +VE     +  
Sbjct: 199 PLGAGALA-------GHPYGIDREFLA-AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLF 250

Query: 310 ACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNN 369
              + + A+D+  + S    G+ +L       GSS+MP K NP   E L     +V G  
Sbjct: 251 MNHISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQL 308

Query: 370 AAI 372
           A  
Sbjct: 309 AGF 311

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 97/243 (39%), Gaps = 21/243 (8%)

Query: 131 NANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELT 190
            ANE    R  EI+G  I  K VH        +S ND   T + I     +  +L P +T
Sbjct: 90  TANE---RRLGEIIGRDIAGK-VHTG------RSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 191 NLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFL 250
           +L   L  +++E   I+  G THLQ A P+      S Y       ++R+   L+  +  
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 251 AQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQ-TAPNKFEALAAHDAIVECSGALNTL 309
             G  A+        G    I  +  +E GL F     N   A++  D +VE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 310 ACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNN 369
              + + A+D+  + S    G+ +L       GSS+MP K N    E L     +V G+ 
Sbjct: 252 MNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 370 AAI 372
           A  
Sbjct: 310 AGF 312

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 107/274 (39%), Gaps = 30/274 (10%)

Query: 95  ISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVH 154
           I K + +   E +SGK ++H            +    ANE    R  E++G  +  K VH
Sbjct: 63  IHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGELIGTAVAGK-VH 109

Query: 155 PNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHL 214
                   +S ND   T M I     +  +++P +++    L  +++E   ++  G THL
Sbjct: 110 TG------RSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREEVDVLMPGYTHL 163

Query: 215 QDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIK-IAE 273
           Q A P+      S Y         R+   ++ L+   Q     G       G D K +AE
Sbjct: 164 QRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAGHPYGIDRKYLAE 220

Query: 274 QISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHE 333
           Q+            N   A++  D ++E     +     + + A+D+  + S    G+  
Sbjct: 221 QLGFNG-----IIGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIN 274

Query: 334 LMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 367
           L       GSS+MP K NP   E L     +V G
Sbjct: 275 LA-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 109/282 (38%), Gaps = 27/282 (9%)

Query: 92  DPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSK 151
           D ++SK I    D++ S   DD F           +    ANE    R  EI+G  I  K
Sbjct: 57  DDELSK-IHAGLDQIKSEWDDDKFV-----RHPSDEDIHTANE---RRLGEIIGRHIAGK 107

Query: 152 EVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGR 211
            VH        +S ND   T M I     +  +L+P + +L   L  +++     +  G 
Sbjct: 108 -VHTG------RSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGY 160

Query: 212 THLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKI 271
           THLQ A P+      S Y        +R+   L+ L+    G  A+        G    I
Sbjct: 161 THLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA-------GHPYGI 213

Query: 272 AEQISSETGLKF-QTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCG 330
             +  +E GL F     N   A++  D +VE           + + A+D+  + S    G
Sbjct: 214 DREFLAE-GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFG 271

Query: 331 YHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAI 372
           + +L       GSS+MP K N    E L     +V G+ A  
Sbjct: 272 FVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 132 ANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTN 191
           ANE    R  EI+G  I  K VH        +S ND   T + I     +  +L P LT+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLA 251
           L   L  + +E   I+  G THLQ A P+      S Y       + R+   L   +   
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSP 200

Query: 252 QGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQ-TAPNKFEALAAHDAIVECSGALNTLA 310
            G  A+        G    I  +  +E GL+F     N   A++  D +VE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 311 CSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 368
             + + A+D+  + S    G+ +L       GSS+MP K N    E L     +V G+
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 94/239 (39%), Gaps = 21/239 (8%)

Query: 131 NANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELT 190
            ANE    R  EI+G  I  K VH        +S ND   T + I     + + L P L 
Sbjct: 90  TANE---RRLGEIIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNDNLFPALK 139

Query: 191 NLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFL 250
            L + L  ++K   +I+  G THLQ A P+      S Y        +R+   L  L+  
Sbjct: 140 GLVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQS 199

Query: 251 AQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTA-PNKFEALAAHDAIVECSGALNTL 309
             G  A+        G    I  +  +E GL F +   N   A++  D IVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSMVAVSDRDFIVELMFWGTLF 251

Query: 310 ACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 368
              + + A+D+  +      G+ +L       GSS+MP K N    E L     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 87/194 (44%), Gaps = 35/194 (18%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           LIP+L N+ N L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQ-----ISSETGLKFQTAPNKF 290
             + F    GT        A+  G + K    D ++AE      I   TG   QT   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTG---QTYSRKV 244

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLP--ENEPGSSIMPG 348
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 349 KVNPTQNEALTQVC 362
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 95/243 (39%), Gaps = 21/243 (8%)

Query: 131 NANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELT 190
            ANE    R  E++G  I  K VH        +S ND   T + I     IQ++L+P L 
Sbjct: 88  TANE---RRLGELIGTDISGK-VHTG------RSRNDQCVTDLRIYCRDIIQDKLLPSLK 137

Query: 191 NLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFL 250
           +L   L  + +    I+  G THLQ A P+      S Y        +R+   L  L+  
Sbjct: 138 SLIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVS 197

Query: 251 AQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQ-TAPNKFEALAAHDAIVECSGALNTL 309
             G  A+        G    I  +  +  GL F     N   A++  D +VE        
Sbjct: 198 PLGAGALA-------GHPYGIDREFLA-NGLGFNGVIGNSLVAVSDRDFVVELLFWGTLF 249

Query: 310 ACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNN 369
              + + A+D+  + S    G+  L       GSS+MP K N    E L     +V GN 
Sbjct: 250 MNHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNL 307

Query: 370 AAI 372
           + +
Sbjct: 308 SGL 310

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 93/242 (38%), Gaps = 21/242 (8%)

Query: 132 ANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTN 191
           ANE    R  EI+G  I  K VH        +S ND   T + I     + ++L P+L  
Sbjct: 91  ANE---RRLGEIIGRNIAGK-VHT------GRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLA 251
           L + +  + KE   ++  G THLQ A P+      S Y        +R+   +  ++   
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN--- 197

Query: 252 QGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQ-TAPNKFEALAAHDAIVECSGALNTLA 310
           Q     G       G D +         GL F     N   A++  D IVE         
Sbjct: 198 QSPLGAGALAGHPYGIDREFL-----AAGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 311 CSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNA 370
             + + A+D+  + S    G+ +L       GSS+MP K N    E L     +V G+ A
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 310

Query: 371 AI 372
             
Sbjct: 311 GF 312

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 106/275 (38%), Gaps = 30/275 (10%)

Query: 94  KISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEV 153
           KI   ++   +E   GK   H            +S+ + +     R  E++G  I  K V
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-V 109

Query: 154 HPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTH 213
           H        +S ND   T M I     +  ++ P + +L N L  ++++   I+  G TH
Sbjct: 110 HTG------RSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTH 163

Query: 214 LQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAE 273
           LQ A P+      S Y       ++R+    + L+    G  A+        G    I  
Sbjct: 164 LQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA-------GHPYGIDR 216

Query: 274 QISSETGLKFQ-TAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYH 332
           Q  +E GL F     N   A++  D +VE           + + ++D+  + S    G+ 
Sbjct: 217 QFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFI 274

Query: 333 ELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 367
           +L       GSS+MP K N    E L     +V G
Sbjct: 275 KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 31/192 (16%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           LIP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGTAVGT---------GLNTK-PGFDIKIAEQI--SSETGLKFQTAPNKFEA 292
             +      GT  GT         G + K    D ++AE +  S+   +  QT   K + 
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKID- 245

Query: 293 LAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLP--ENEPGSSIMPGKV 350
                  ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K 
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKR 293

Query: 351 NPTQNEALTQVC 362
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 93/245 (37%), Gaps = 35/245 (14%)

Query: 132 ANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTN 191
           ANE    R  EI+G KI  K VH        +S ND   T + I     + ++L+  L  
Sbjct: 91  ANE---RRLGEIIGTKISGK-VHTG------RSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLA 251
           L N L  +++E    +  G THLQ A P+      S Y        +R+    + L+   
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 252 QGGTAVG--------TGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECS 303
            G  A+           L  K GFD  I                N   A++  D +VE  
Sbjct: 201 LGAGALAGHPYGIDREYLAEKLGFDSVIG---------------NSLVAVSDRDFVVEIL 245

Query: 304 GALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCV 363
                    + + A+D+  + S    G+ +L       GSS+MP K N    E L     
Sbjct: 246 FWSTLFMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSG 303

Query: 364 QVMGN 368
           +V GN
Sbjct: 304 RVFGN 308

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           LIP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 93/239 (38%), Gaps = 21/239 (8%)

Query: 131 NANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELT 190
            ANE    R  E++G  I  K VH        +S ND   T + I     + + L P + 
Sbjct: 90  TANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 191 NLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFL 250
            L + L  +++    I+  G THLQ A P+      S Y        +R+   L  L+  
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQS 199

Query: 251 AQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTA-PNKFEALAAHDAIVECSGALNTL 309
             G  A+        G    I  +  +E GL F +   N   A++  D IVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 310 ACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 368
              + + A+D+  +      G+ +L       GSS+MP K N    E L     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 95/241 (39%), Gaps = 19/241 (7%)

Query: 132 ANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTN 191
           ANE    R  EI+G  I  K VH        +S ND   T M I     +  +L+P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLA 251
           L + +  ++++    +  G THLQ A P+      S Y       ++R+   L+  +   
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN--- 197

Query: 252 QGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLAC 311
           Q     G       G D    E ++ E G +     N   A++  D +VE          
Sbjct: 198 QSPLGAGALAGHPYGID---REFLAEELGFQ-GVIGNSLVAVSDRDFVVELMFWGTLFMN 253

Query: 312 SLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAA 371
            + + A+D+  + S    G+ +L       GSS+MP K N    E L     +V G+ A 
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

Query: 372 I 372
            
Sbjct: 312 F 312

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 132 ANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTN 191
           ANE    R  E++G  I  K VH        +S ND   T + I     +   L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLA 251
           L + L  +++    I+  G THLQ A P+      S Y        +R+   L  L+   
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 252 QGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTA-PNKFEALAAHDAIVECSGALNTLA 310
            G  A+        G    I  +  +E GL F +   N   A++  D IVE         
Sbjct: 201 LGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 311 CSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 368
             + + A+D+  +      G+ +L       GSS+MP K N    E L     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 94/241 (39%), Gaps = 19/241 (7%)

Query: 132 ANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTN 191
           ANE    R  EI+G  I  K VH        +S ND   T M I     + N L+  L  
Sbjct: 92  ANE---RRLGEIIGTGIAGK-VHTG------RSRNDQVATDMRIYCRDILTNNLLTYLKE 141

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLA 251
           L + +  ++ E   I+  G THLQ A P+      S Y        +R+   L  L+   
Sbjct: 142 LISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSP 201

Query: 252 QGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLAC 311
            G  A+        G D +   Q    +G+      N   A++  D +VE     +    
Sbjct: 202 LGAGALA---GHPYGIDREFLAQDLGFSGV----IGNSLVAVSDRDFVVEIMFWGSLFMN 254

Query: 312 SLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAA 371
            + + ++D+  + S    G+ +L       GSS+MP K N    E L     +V G+ A 
Sbjct: 255 HISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 312

Query: 372 I 372
            
Sbjct: 313 F 313

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 80/189 (42%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           LIP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGTAVGTGL---------NTKPGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT    G          +     D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   T+G+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLP--ENEPGSSIMPGKVN 351
                 ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRN 294

Query: 352 PTQNEALTQVC 362
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 92/239 (38%), Gaps = 21/239 (8%)

Query: 131 NANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELT 190
            ANE    R  E++G  I  K VH        +S ND   T + I     + + L P L 
Sbjct: 90  TANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 191 NLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFL 250
            L   L  +++    ++  G THLQ A P+      S Y        +R+   L  L+  
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 251 AQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTA-PNKFEALAAHDAIVECSGALNTL 309
             G  A+        G    I  +  +E GL F +   N   A++  D IVE        
Sbjct: 200 PLGAGALA-------GHPYGIDREFLAE-GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 310 ACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGN 368
              + + A+D+  +      G+ +L       GSS+MP K N    E L     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 93/237 (39%), Gaps = 21/237 (8%)

Query: 132 ANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTN 191
           ANE    R  EI+G  I  K VH        +S ND   T + I     +  +L+P + +
Sbjct: 91  ANE---RRLGEIIGTHIAGK-VHTG------RSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 192 LKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLA 251
           L   +  +++    I+  G THLQ A P+      S Y        +R+   L+ L+   
Sbjct: 141 LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 252 QGGTAVGTGLNTKPGFDIKIAEQ-ISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLA 310
            G  A+        G    I  Q +S E G       N   A++  D IV+         
Sbjct: 201 LGAGAIA-------GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFM 252

Query: 311 CSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMG 367
             + + ++D+  + S    G+ +L       GSS+MP K N    E L     +V G
Sbjct: 253 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAE-----QISSETGLKFQTAPNKF 290
             +      GT        A+  G + K    D ++ E     ++   TG   QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDKVYPVTG---QTYSRKI 244

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKV 350
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 351 NPTQNEALTQVC 362
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ + L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           LIP+L N+ N L   + +++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAE-----QISSETGLKFQTAPNKF 290
             +      GT        A+  G + K    D ++ E     ++   TG   QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTG---QTYSRKI 244

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKV 350
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 351 NPTQNEALTQVC 362
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAE-----QISSETGLKFQTAPNKF 290
             +      GT        A+  G + K    D ++ E     ++   TG   QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTG---QTYSRKI 244

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKV 350
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 351 NPTQNEALTQVC 362
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAE-----QISSETGLKFQTAPNKF 290
             +      GT        A+  G + K    D ++ E     ++   TG   QT   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTG---QTYSRKI 244

Query: 291 EALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKV 350
           +        ++    L++ A +  K+A DIR L +       E    + + GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKR 293

Query: 351 NPTQNEALTQVC 362
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ + L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             L      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 99/261 (37%), Gaps = 30/261 (11%)

Query: 120 FQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASL 179
           F    G +    ANE    R  EI+G  I  K VH        +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-VHTG------RSRNDQVATDMRIYCRE 130

Query: 180 QIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQR 239
            + N L   L +L  A+  +S++    +  G THLQ A P+      + Y        +R
Sbjct: 131 ALDN-LAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 240 VAHSLKTLSFLAQGGTAVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAI 299
           +    + L+    G  A+        G    I  +  +E         N  +A++  D +
Sbjct: 190 LKQIRERLNVSPLGCGALA-------GHPYGIDREFLAERLGFSDVIGNSLQAVSDRDFV 242

Query: 300 VECSGALNTLACSLF-----KIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQ 354
           VE         CSLF     + ++D+  + S     + +L       GSS+MP K NP  
Sbjct: 243 VEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDS 295

Query: 355 NEALTQVCVQVMGNNAAITFA 375
            E L     +V G+ A    +
Sbjct: 296 LELLRGKSGRVFGSLAGFMMS 316

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 101/256 (39%), Gaps = 34/256 (13%)

Query: 120 FQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASL 179
           F    G +    ANE    R  EI+G  I  K VH        +S ND   T M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-VHTG------RSRNDQVATDMRIYCRE 130

Query: 180 QIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQR 239
            + N +   L +L  A+  ++++    +  G THLQ A P+      + Y        +R
Sbjct: 131 ALDN-MAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 240 VAHSLKTLSFLAQGGTAVGTG-LNTKP-GFDIKIAEQISSETGLKFQTAPNKFEALAAHD 297
           +    + L+      + +G G L   P G D    E I+   G       N  +A++  D
Sbjct: 190 LKQIRERLNV-----SPLGCGALAGHPYGID---REHIAERLGFD-GVIGNSLQAVSDRD 240

Query: 298 AIVECSGALNTLACSLF-----KIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNP 352
            +VE         CSLF     + ++D+  + S     + +L       GSS+MP K NP
Sbjct: 241 FVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNP 293

Query: 353 TQNEALTQVCVQVMGN 368
              E L     +V G+
Sbjct: 294 DSLELLRGKSGRVFGS 309

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 80/197 (40%), Gaps = 41/197 (20%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ N L   + E++ +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 245 KTLSFLAQGGT-------------------AVGTGLNTKPGFDIKIAEQISSETGLKFQT 285
             +      GT                   A+   +    GFDI     +   TG   QT
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDI-----VYPVTG---QT 239

Query: 286 APNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSI 345
              K +        ++  G+ ++   +  K+A DIR L +       E    + + GSS 
Sbjct: 240 YSRKID--------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSA 288

Query: 346 MPGKVNPTQNEALTQVC 362
           M  K NP + E   +VC
Sbjct: 289 MAYKRNPMRCE---RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 79/189 (41%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           +IP+L N+ + L   +  ++ +  +G TH Q A   TLG+  + ++Q +   ++    + 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  ET      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L + A +  K+A DIR L +       E    + + GSS M  K NP 
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 185 LIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSL 244
           LIP+L N+ N L   +   + +  +G TH Q A   TLG+  + ++Q++   ++    + 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 245 KTLSFLAQGGT--------AVGTGLNTK-PGFDIKIAEQISSETGLKF--QTAPNKFEAL 293
             +      GT        A+  G + K    D ++ E +  +T      QT   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 294 AAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPT 353
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 354 QNEALTQVC 362
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 80  SAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNR 139
           S A+ ++ L   DP  +K + + +D+  SG     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 140 AIEILGGKIGSKEVH------PNNHCNQSQSS 165
            +E   G+  + ++       PN H N+++SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 53/108 (49%), Gaps = 5/108 (4%)

Query: 57  FKIGGARERMPLPLVHAFGVLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFP 116
           F I  A++ + +PLV+ +   +  A+++N  +    P   K ++Q    +T+G  +    
Sbjct: 75  FAIKEAQKALEIPLVNQYSPTRGRASLLNSLIKLYSPFYGKELKQENITITTGANEGILS 134

Query: 117 LVVFQTGSGTQSNMNA---NEVISNRAIEILGGKIGSKEVHPNNHCNQ 161
            ++    +G +  +     ++ ISN  IE++GGK+    ++P    +Q
Sbjct: 135 CLMGLLNAGDEVIVFEPFFDQYISN--IELMGGKVVYVPINPPKDLDQ 180

>ZYRO0C12606g Chr3 (995841..999233) [3393 bp, 1130 aa] {ON} similar
           to uniprot|P48361 Saccharomyces cerevisiae YGR097W ASK10
           Component of the RNA polymerase II
          Length = 1130

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 172 VMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQ 231
           V  +  S +I   L+P + +L+  L++K KE + +    RT++ +   +T GQ  + Y+ 
Sbjct: 278 VQQLKISKEINMNLLPRIEDLRRDLQSKIKEIKELSGDFRTNINEHVAIT-GQLLNRYIS 336

Query: 232 QVENGIQRVAHS 243
            V+     VA S
Sbjct: 337 SVKYMTTNVADS 348

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,221,112
Number of extensions: 1990392
Number of successful extensions: 5950
Number of sequences better than 10.0: 77
Number of HSP's gapped: 6129
Number of HSP's successfully gapped: 77
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)