Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.15singletonON1001005312e-71
Suva_14.2822.250ON31327589.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.15
         (100 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.15 Chr16 complement(25865..26167) [303 bp, 100 aa] {ON} ...   209   2e-71
Suva_14.282 Chr14 complement(514704..515645) [942 bp, 313 aa] {O...    27   9.8  

>Skud_16.15 Chr16 complement(25865..26167) [303 bp, 100 aa] {ON} 
           (NOVEL)
          Length = 100

 Score =  209 bits (531), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%)

Query: 1   MKRKKGSTGKGQSSNAHSGNRGSHSEDRPRGGVCSSIKVLMTKNRSNNQFNDSVPGTMDD 60
           MKRKKGSTGKGQSSNAHSGNRGSHSEDRPRGGVCSSIKVLMTKNRSNNQFNDSVPGTMDD
Sbjct: 1   MKRKKGSTGKGQSSNAHSGNRGSHSEDRPRGGVCSSIKVLMTKNRSNNQFNDSVPGTMDD 60

Query: 61  QLLYTGILMPCVAVGQEYKDASKRISFTRQASATHIDVPL 100
           QLLYTGILMPCVAVGQEYKDASKRISFTRQASATHIDVPL
Sbjct: 61  QLLYTGILMPCVAVGQEYKDASKRISFTRQASATHIDVPL 100

>Suva_14.282 Chr14 complement(514704..515645) [942 bp, 313 aa] {ON}
           YNL058C (REAL)
          Length = 313

 Score = 26.9 bits (58), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 43  KNRSNNQFNDSVPGTMDDQLLYTGILM 69
           K  S NQ  D++   +DDQ LYTG  M
Sbjct: 201 KGHSRNQSRDTINSFIDDQSLYTGNYM 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,806,496
Number of extensions: 420652
Number of successful extensions: 1169
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1167
Number of HSP's successfully gapped: 15
Length of query: 100
Length of database: 53,481,399
Length adjustment: 71
Effective length of query: 29
Effective length of database: 45,340,113
Effective search space: 1314863277
Effective search space used: 1314863277
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)