Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.146.10ON65259527140.0
YPL263C (KEL3)6.10ON65159625790.0
Suva_16.426.10ON65459825640.0
Smik_6.4716.10ON65159625500.0
NCAS0D021906.10ON64560315400.0
Kpol_1045.776.10ON65061015360.0
TPHA0M002006.10ON63460115210.0
ZYRO0F00484g6.10ON64360114930.0
ACR016W6.10ON64060514920.0
SAKL0E00880g6.10ON63660114880.0
TBLA0G011106.10ON63860314850.0
CAGL0A01067g6.10ON64160314800.0
KLLA0D00836g6.10ON64060414800.0
NDAI0I027506.10ON66361614770.0
TDEL0G046106.10ON63360114640.0
KAFR0B065006.10ON63660114420.0
Kwal_56.223506.10ON65860014040.0
KLTH0C11528g6.10ON64260213990.0
KNAG0E027806.10ON65060213960.0
Kpol_1050.695.88ON10842591541e-09
NCAS0F005205.88ON10862601531e-09
KLTH0C01474g5.88ON10562771522e-09
Kwal_14.10195.88ON9782651451e-08
Smik_8.2425.88ON11682631441e-08
KNAG0K005605.88ON11042591432e-08
KAFR0B043205.88ON9862591432e-08
TPHA0H010805.88ON8282671432e-08
YHR158C (KEL1)5.88ON11642521395e-08
CAGL0F07997g5.88ON9362651386e-08
Skud_8.2225.88ON11692511371e-07
Smik_16.685.88ON8942921342e-07
YGR238C (KEL2)5.88ON8822601342e-07
Suva_15.3575.88ON11722541342e-07
SAKL0H02618g5.88ON10852061324e-07
KLLA0E15511g5.88ON9052591298e-07
Skud_7.5725.88ON8831941299e-07
Suva_7.5305.88ON8942521272e-06
Ecym_20615.88ON13622061272e-06
Kpol_1010.625.88ON9732551253e-06
CAGL0I02090g5.88ON11362591226e-06
ZYRO0B08228g5.88ON12932181218e-06
NDAI0D026005.88ON11671491201e-05
TDEL0G011205.88ON10092161154e-05
ADL149W5.88ON12112061146e-05
TPHA0A051705.88ON10162601137e-05
TBLA0C065305.88ON11722541111e-04
SAKL0C13530g3.15ON697112920.018
YOL141W (PPM2)3.15ON69577860.10
Smik_15.133.15ON71977830.24
Suva_8.1755.440ON45394820.25
KAFR0C049107.9ON87871820.30
ADR414C7.9ON78472800.59
TBLA0D021208.157ON1479200800.61
Smik_1.97.9ON87457780.92
Suva_15.193.15ON70880771.1
Suva_1.107.9ON89258771.2
Skud_15.133.15ON69581761.5
SAKL0D14740g7.9ON84090761.6
ZYRO0C00550g7.9ON84859752.0
KAFR0I029103.15ON691110742.4
CAGL0I00704g2.375ON27676723.8
YAL056W (GPB2)7.9ON88057724.1
TBLA0A043207.9ON83859724.5
KLLA0F00374g7.9ON79551724.7
NDAI0A088607.9ON85689725.0
KNAG0E041807.9ON81928716.2
KNAG0A011803.15ON67675707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.14
         (652 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...  1050   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   998   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   992   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   986   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   597   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   596   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   590   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   579   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   579   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   577   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   576   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   574   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   574   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   573   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   568   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   560   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   545   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   543   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   542   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    64   1e-09
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    64   1e-09
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    63   2e-09
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    60   1e-08
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    60   1e-08
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    60   2e-08
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    60   2e-08
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    60   2e-08
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    58   5e-08
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    58   6e-08
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    57   1e-07
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    56   2e-07
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    56   2e-07
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    56   2e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    55   4e-07
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    54   8e-07
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    54   9e-07
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    54   2e-06
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    54   2e-06
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    53   3e-06
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    52   6e-06
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    51   8e-06
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    51   1e-05
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    49   4e-05
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    49   6e-05
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    48   7e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    47   1e-04
SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]...    40   0.018
YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}  PPM2AdoMet-...    38   0.10 
Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W (...    37   0.24 
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...    36   0.25 
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    36   0.30 
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    35   0.59 
TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8....    35   0.61 
Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)     35   0.92 
Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W (...    34   1.1  
Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)    34   1.2  
Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W (...    34   1.5  
SAKL0D14740g Chr4 complement(1212855..1215377) [2523 bp, 840 aa]...    34   1.6  
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    33   2.0  
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    33   2.4  
CAGL0I00704g Chr9 complement(51136..51966) [831 bp, 276 aa] {ON}...    32   3.8  
YAL056W Chr1 (39259..41901) [2643 bp, 880 aa] {ON}  GPB2Multiste...    32   4.1  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    32   4.5  
KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON...    32   4.7  
NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa] ...    32   5.0  
KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {O...    32   6.2  
KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15 Y...    32   7.7  

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/595 (87%), Positives = 519/595 (87%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY
Sbjct: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 238 KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297
           KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD
Sbjct: 238 KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXXXXX 417
           LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNL         
Sbjct: 358 LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDDNT 417

Query: 418 XXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEK 477
                                    ITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEK
Sbjct: 418 TTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEK 477

Query: 478 DYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXXXXX 537
           DYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLG                         
Sbjct: 478 DYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDDGEDNDEE 537

Query: 538 XXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSIS 597
              VALL              QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSIS
Sbjct: 538 EQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSIS 597

Query: 598 NNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR 652
           NNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR
Sbjct: 598 NNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR 652

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/596 (82%), Positives = 505/596 (84%), Gaps = 3/596 (0%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F+KKQ ELEHVDIT+VE+ SCRTHPLMFANPQHNK ELFIFGGEFTDPETKLTHFYNDLY
Sbjct: 58  FSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVS+NAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
            ERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS Y
Sbjct: 178 VERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTY 237

Query: 238 KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297
           KWTKLETN+KP+ARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD
Sbjct: 238 KWTKLETNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXXXXX 417
           LELNKWSKLRIKPQRQTN+KN+P TSKRKSNKDQEKELQDLLNSILAKSNL         
Sbjct: 358 LELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDNDD 417

Query: 418 XXXXX-XXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWELGE 476
                                     ITISNQLPHPRFNAATCVV DSLFIYSGVWELGE
Sbjct: 418 NSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE 477

Query: 477 KDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXXXX 536
           KDYPINSFYSIDLNKLDGV VYWEDLS IEEAKRLG                        
Sbjct: 478 KDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLG--DRDSDEDEFEYEDDEEDEDDGE 535

Query: 537 XXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSI 596
                  L              QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSI
Sbjct: 536 EEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSI 595

Query: 597 SNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR 652
           SNN++LKGK LKTKSFE+CEDRWWERRDQVTLEEERLEDTGGIIERDTTTK SKRR
Sbjct: 596 SNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDTTTKPSKRR 651

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  992 bits (2564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/598 (81%), Positives = 502/598 (83%), Gaps = 4/598 (0%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           FTKKQTELEHVDITAVER SCR HPLMFANPQHNK ELFIFGGEFTDPETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVS+NAPLPRSS AVAVH SGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
            E+KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLG+GQTSYLNDLWCFDISNY
Sbjct: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237

Query: 238 KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297
           KWTKLETNTKP+ARSGHCF+PTDNSAILMGGYCK IAKNNKNLMKGKILND+WKL LTPD
Sbjct: 238 KWTKLETNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESL+S+FYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNL---XXXXXX 414
           LELNKWSKLRIKPQR TNN+NAP TSKRKSNKDQEKELQDLLNSILAKSNL         
Sbjct: 358 LELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEEDDNDD 417

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                       ITISNQLPHPRFNAATCVVDDSLFIYSGVWEL
Sbjct: 418 STATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 477

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GEKDYPINSFYSIDLNKLDGV VYWEDLST+EEAKRLG                      
Sbjct: 478 GEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLG-DRDSDEEEFEYEDEDDDEDDD 536

Query: 535 XXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594
                   LL              QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW
Sbjct: 537 EEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 596

Query: 595 SISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR 652
           SISNN++LKGK LKTKSFE+CEDRWWERRDQVTLEEERLEDTGGIIERD T K SKRR
Sbjct: 597 SISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDATAKPSKRR 654

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/596 (82%), Positives = 503/596 (84%), Gaps = 3/596 (0%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           FTKKQTELEHVDITAVER SCRTHPLMFANPQHNK ELFIFGGEFTD ETKLTHFYNDLY
Sbjct: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SYSIKNNSWKKYVS+NAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
            ERKF KLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY
Sbjct: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 238 KWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPD 297
           KW+K+ETN+KP+ARSGHCFIPTDNSAILMGGYCK IAKNNKNLMKGKILNDAWKLNLTPD
Sbjct: 238 KWSKIETNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPD 297

Query: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357
           PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH
Sbjct: 298 PKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFH 357

Query: 358 LELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXXXXX 417
           LELNKWSKLRIK QRQT+N+N+P TSKRKSNKDQEKELQDLLNSILAKSNL         
Sbjct: 358 LELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDENDD 417

Query: 418 -XXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWELGE 476
                                     ITISNQLPHPRFNAATCVV DSLFIYSGVWELGE
Sbjct: 418 YTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGE 477

Query: 477 KDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXXXX 536
           KDYPINSFYSIDLNKLDGV VYWE+LS IEEAKRLG                        
Sbjct: 478 KDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLG--DRDSDEEEFEYEDEEDDEDQSE 535

Query: 537 XXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSI 596
                 LL              QAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSI
Sbjct: 536 EEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSI 595

Query: 597 SNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGIIERDTTTKISKRR 652
           SNN++LKGK LKTKSFE+CEDRWWERRDQVTLEEERLEDTGGIIERD TTK SKRR
Sbjct: 596 SNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGGIIERDVTTKPSKRR 651

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/603 (50%), Positives = 391/603 (64%), Gaps = 21/603 (3%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F  +Q + EHV++ ++ + + R +  M   P H+K+EL IFGGEFT+PET +THFYN+L 
Sbjct: 56  FKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELI 115

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS  N  W+K  S+N+P+PRSSAA+  HPSGIALLHGGEFSSPKQ+ FYHYSDTWL D 
Sbjct: 116 TYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDT 175

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++TK++       P  RSGHRI  WKNYFIL GGF+DLG+  TSY ND WCFDI+ Y
Sbjct: 176 HTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGHS-TSYFNDCWCFDITTY 231

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  P+ARSGH +IPT+   IL GGYCK+  K  K L KGKILND W L +
Sbjct: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKV--KAGKGLQKGKILNDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESLES+FYNDL+
Sbjct: 290 KSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIFYNDLF 348

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            +++E N+W  L ++  ++   K    +S  KS+K++EKELQDLLN IL K+NL      
Sbjct: 349 SYNVESNRWFSLSLRKAQKF--KKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDD 406

Query: 415 XXXXXXXXXXXXXXXXX--XXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVW 472
                                         +T+ +QLPHPRFNAAT VVDDSLFIY G+W
Sbjct: 407 DEISTGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIW 466

Query: 473 ELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXX 532
           E+GEKDY I+S YSIDLNKLDGV+ YWEDL  IE+AK +G                    
Sbjct: 467 EMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEE 526

Query: 533 XXXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 592
                     L+                +MEIPD R WLPHPKPFE+LRAFY+REGA FL
Sbjct: 527 EIEDKK----LVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFL 582

Query: 593 TWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLED---TGGIIERDTTTKIS 649
            W+ISNNK ++GKHLK KSF++CEDRWWERRDQV +EE++LE+    G +IE+DT+   S
Sbjct: 583 EWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTS 642

Query: 650 KRR 652
           KRR
Sbjct: 643 KRR 645

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/610 (50%), Positives = 390/610 (63%), Gaps = 29/610 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   E ++I +VER S R +P M  NP H K EL +FGGE T+ +T  T F+NDLY
Sbjct: 55  FKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDLY 114

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           SY+ +N+ W++Y SKN+P+PRSSAA+A HPSG+AL+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 115 SYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWLLDC 174

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           + +++TK+E   + + PSARSGHRI  WKNYF+L GGFRDLG   T+YLND W FDI+NY
Sbjct: 175 STKEWTKVE---QKNGPSARSGHRISIWKNYFMLHGGFRDLGTS-TTYLNDCWLFDITNY 230

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  P+ARSGH FIPT   A+L GGYCK+  K  K L KGKIL D W L +
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKV--KAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FYNDL+
Sbjct: 289 KADPTAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSMFYNDLF 347

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            + +E+N+W  L+++PQR+       +    KS+KD+EKELQDLLN IL K+NL      
Sbjct: 348 SYQIEINRWFALQLRPQRK-----KVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDK 402

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXI---------TISNQLPHPRFNAATCVVDDSL 465
                                       +          +  QLPHPRFNA   VV+D+L
Sbjct: 403 DQEDEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTL 462

Query: 466 FIYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXX 525
           FIY GVWELGEKDY I+SFYSIDLN+ DGV V WEDLS IE AK  G             
Sbjct: 463 FIYGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGD 522

Query: 526 XXXXXXXXXXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYL 585
                          +                   +MEIPD   WLPHPKPFE+LR FY+
Sbjct: 523 SDDEDDGEEEIMDQKLVAEEEEEEEEEEEEEQVD-EMEIPDPCPWLPHPKPFESLRVFYV 581

Query: 586 REGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGI---IER 642
           R GA FL W+ISNN+D +GKHLK KSF++C+DRWW+RRDQV +EE+++E+ GGI   IE+
Sbjct: 582 RTGATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEK 641

Query: 643 DTTTKISKRR 652
           D T+K +KRR
Sbjct: 642 D-TSKSTKRR 650

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/601 (51%), Positives = 389/601 (64%), Gaps = 28/601 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E +++ +V++ + R +  M ANP H K+EL +FGGE T  E  +THFYNDLY
Sbjct: 56  FKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDLY 115

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +++  N+ WKK  S+N+P+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 116 TFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDC 175

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             R++TK+E   + + PSARSGHRI  WKNYFIL GGFRDLG+  TSYLND W FDI++Y
Sbjct: 176 TTREWTKVE---QKNGPSARSGHRITVWKNYFILHGGFRDLGS-TTSYLNDSWLFDITSY 231

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  P+ARSGH  IPT   A+L GGYCK+  K  K L KGKIL D W L +
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKV--KAGKGLQKGKILGDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             DP   +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEESL+S+FYNDL+
Sbjct: 290 KADPSAVRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVYDFEETEESLDSIFYNDLF 348

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            + +E N+W  L+++ QR+       +    KS+K++E ELQ++LN IL K+NL      
Sbjct: 349 SYQIESNRWYALQLRSQRK-----KVVRLNNKSSKEKELELQNILNEILEKANL---KDD 400

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                         + NQLPH RFNA+T VVDD+LFIY GVWEL
Sbjct: 401 DEDANELSNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWEL 460

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GEKDY I+S YSIDLNKLDGV VYWE+L  IE+AK LG                      
Sbjct: 461 GEKDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELG------AINSDEEDEEDEDDED 514

Query: 535 XXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594
                 V                    MEIPD R WLPHPK FE+LR FY+R GA+FL W
Sbjct: 515 DDEEETVDQKLVAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEW 574

Query: 595 SISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKISKR 651
           +ISNNK  +GKHLKTKSFE+C+DRWWERRDQV +EE++LE+ GG   +IE+D TTK +KR
Sbjct: 575 AISNNKHTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKD-TTKSTKR 633

Query: 652 R 652
           R
Sbjct: 634 R 634

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/601 (48%), Positives = 385/601 (64%), Gaps = 21/601 (3%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E V + +V++ S R +P + +NP H K+EL +FGGE+T+     THFYN+L+
Sbjct: 57  FKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELF 116

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +++  N+ W+K  S+NAP+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 117 TFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDC 176

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++TKL+   + + P++RSGHR+  WKN+FI++GGFRDLG   T+YLND W FDI+ +
Sbjct: 177 TTKEWTKLD---QKNGPASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTH 232

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KWT++E    +  P+ARSGH FIP    AIL GGYCK+  K  K L KGKIL D W L +
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKV--KAGKGLQKGKILTDCWYLKM 290

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
              P   +WE+ K    QPSPRVG S  +  + + V FGGVYD +ETEESL+S FYNDL+
Sbjct: 291 NSTPSAIRWERRKKQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFYNDLF 349

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            F ++ N+W  L ++PQR+   K +     + S KDQEKELQD LN IL ++ L      
Sbjct: 350 TFQIKTNRWYSLSLRPQRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYDQDED 404

Query: 415 XXXXXXXXXX-XXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWE 473
                                         TIS QLPHPRFN +  VV+D+LFIY G+WE
Sbjct: 405 KEDDKAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWE 464

Query: 474 LGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 533
           LG+KDY I+SFY IDLNK+DGV VYWE+L+ IE+AK+L                      
Sbjct: 465 LGDKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDD 524

Query: 534 XXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLT 593
                  V  L              + +MEIPD R WLPHPK FE+LRAFY+R G  FL 
Sbjct: 525 EEEVRDQV--LVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLE 582

Query: 594 WSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKISK 650
           W+ISNN+D +GKHLK KSF++C+DRWWERRDQV +EE+++E+ GG   I+ER+   K  +
Sbjct: 583 WAISNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKR 642

Query: 651 R 651
           R
Sbjct: 643 R 643

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/605 (48%), Positives = 386/605 (63%), Gaps = 29/605 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F ++Q E E V++  VER   R+   + ANP HNKREL +FGGE+T+  T +THFYNDL+
Sbjct: 55  FKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLF 114

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            YS+  + WKKY S+N+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWLFDC
Sbjct: 115 IYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDC 174

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           A  ++TK+E   + + PS+RSGHR+  WKNY IL GGFRDLG   T+YLND W FDI+ Y
Sbjct: 175 ATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGT-STTYLNDCWLFDITTY 230

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW +L+    +  P+ARSGH  +PT   AIL GGYCK+  K  K L KGKIL D W L +
Sbjct: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKV--KAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE L+S+FYNDL+
Sbjct: 289 KSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            +H+E N+W  + ++ QR +  K+AP     KSN+D++KEL+D+LN+IL K+NL      
Sbjct: 348 TYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKKANL-DDDDG 401

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                         I  +LPHPRFNA+T +VDD+LFI+ GVWE 
Sbjct: 402 DEDGKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQ 461

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GEKDY I+SFYSID+NK+DGV VYWED++ +E AK LG                      
Sbjct: 462 GEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEE 521

Query: 535 XXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594
                 VA                +   EIPD R WLPHPK FE+LRAFY+R GA+FL W
Sbjct: 522 HSDRKLVA-----EEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEW 576

Query: 595 SISNN----KDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTK 647
           +I+N      D KGKHLK  SF++C++RWWERR+QV +EE++LE+ GG   +IE+D  TK
Sbjct: 577 AITNKHNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKD-FTK 635

Query: 648 ISKRR 652
            +KRR
Sbjct: 636 PTKRR 640

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/601 (49%), Positives = 384/601 (63%), Gaps = 25/601 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F ++Q + E V ++ V+R + R +  M ANP H KREL +FGGE T+     T FYNDL+
Sbjct: 55  FKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYNDLF 114

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+  + W+K  S+N+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 115 TYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDC 174

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++TK+E   + + P+ARSGHR+  WKNYFIL GGFRDLG   T+YL+D W FDI+ Y
Sbjct: 175 NTKEWTKIE---QKNGPTARSGHRLTVWKNYFILHGGFRDLGT-MTTYLSDCWLFDITTY 230

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW +++    +  P+ARSGH  +PT + A+L GGYCK+  K  K L KGKIL D W L +
Sbjct: 231 KWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKV--KAGKGLQKGKILTDCWYLKM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESLES+FYNDL+
Sbjct: 289 KSDIGAIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLESMFYNDLF 347

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            F +E N+W    ++PQR    K A  TSK   NKD  KEL+D+LN IL K+NL      
Sbjct: 348 TFQIETNRWYSASLRPQR----KAAKATSKNNRNKD--KELEDILNQILEKANLNDDENE 401

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                         I  QLPHPRFNA+T VVDD+LFI+ GVWE+
Sbjct: 402 KETIGDVLKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEI 461

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GEKDY I+SFY+IDLN+LDG+ +YWEDL  IE AK LG                      
Sbjct: 462 GEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEE 521

Query: 535 XXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594
                 VA                + + EIPD R WLPHPKPFETLR FY+R GA+FL W
Sbjct: 522 ITDQKLVA-----EDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEW 576

Query: 595 SISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGGI---IERDTTTKISKR 651
           +IS+N+D +GKHLK KSF++C+DRWWERRDQV +EE++LE+ GGI   +E+D T+K  KR
Sbjct: 577 AISSNRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKD-TSKSKKR 635

Query: 652 R 652
           R
Sbjct: 636 R 636

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/603 (50%), Positives = 388/603 (64%), Gaps = 28/603 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E ++I  V + + R +  M +NP H K EL +FGGE T   +  T FYNDL+
Sbjct: 56  FKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFYNDLF 112

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +Y+ +N+ WKKY S+N+P+PRSS+A+  HP+GIALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 113 TYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDC 172

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           A ++++K+E     + PSARSGHR+  WKN+ IL GGFRDLG   T+YL DLW FD++ Y
Sbjct: 173 ATKEWSKVE---NKNGPSARSGHRMTVWKNFIILHGGFRDLGTS-TTYLKDLWLFDVTKY 228

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KWT++E    +  P+ARSGH  IPT + A+L GGYCK+  K  K L KGKIL+D W L +
Sbjct: 229 KWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKV--KAGKGLQKGKILSDCWYLKM 286

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGV+D +ETEESL+S+FYNDL+
Sbjct: 287 KSDVSGIRWERRKKQGFQPSPRVGCSM-VHHKGRGILFGGVFDFEETEESLDSLFYNDLF 345

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            + +E+N+W  L ++ QR+   K  P     K+ KD+EKELQD+LNSIL K+NL      
Sbjct: 346 TYQIEINRWFSLSMRSQRKKTIKIGP-----KTTKDKEKELQDILNSILKKNNLTDDDSE 400

Query: 415 X--XXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVW 472
                                           + NQLPH RFNA T VV+D+L+I+ G W
Sbjct: 401 DPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSW 460

Query: 473 ELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXX 532
           ELGEKDY I+SFYSIDLNKLDGV VYWED+  IE AK LG                    
Sbjct: 461 ELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGE 520

Query: 533 XXXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 592
                   VA                + +MEIPD R WLPHPKPFETLRAFY+R GA FL
Sbjct: 521 EEIVDQKLVA----EEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFL 576

Query: 593 TWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKIS 649
            W+ISNN+D KGKHLK KSFE+ EDRWWERRDQV +EE+++E+ GG   I+ERD TT+++
Sbjct: 577 EWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERD-TTQVN 635

Query: 650 KRR 652
           KRR
Sbjct: 636 KRR 638

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/603 (49%), Positives = 389/603 (64%), Gaps = 22/603 (3%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQ--HNKRELFIFGGEFTDPETKLTHFYND 115
           F K+Q + E V + +V++++ R +P M  NP    +K+EL +FGGEFT+P+T  T FYND
Sbjct: 53  FKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYND 112

Query: 116 LYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF 175
           L++++ +NN WK+Y S+NAP+PRSSAA+A HPSGIALLHGGEFSSPKQ+ FYHYSDTW+ 
Sbjct: 113 LHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWIL 172

Query: 176 DCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIS 235
           DC  +++ K++       PSARSGHRI  WKN+FIL GGFRDLG   T+YL+D W FDI+
Sbjct: 173 DCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGT-STTYLSDCWLFDIT 228

Query: 236 NYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKL 292
            YKW ++E    +  P+ARSGH FIPT   AIL GGYCK+ A N K   KGKIL+D W L
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSDCWYL 287

Query: 293 NLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
            +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESLES F+ND
Sbjct: 288 KMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESNFFND 346

Query: 353 LYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXX 412
           L+ +H+E N+W  L I+ ++  NN  A  +   K++K+QEKEL+ LL+SIL K+NL    
Sbjct: 347 LFSYHIESNRWYSLSIRSRKSNNNAVAKKSG--KNSKEQEKELKMLLDSILEKANLQDKS 404

Query: 413 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVW 472
                                          TI  QLPHPRFNA T V+DD+LFI+ G+W
Sbjct: 405 DDDEDDEEINTALAKVDLEDEEEEQLAVQH-TILTQLPHPRFNATTTVIDDTLFIFGGIW 463

Query: 473 ELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXX 532
           ELG+K++ I+S YSIDLNKLDGV +YWEDL  IE AK LG                    
Sbjct: 464 ELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDE 523

Query: 533 XXXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 592
                                     + ++E PD R WLPHPKPFETLRAFY+REGA FL
Sbjct: 524 EDDNEKDEGD----DEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFL 579

Query: 593 TWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKIS 649
            W+ISNNK+ KGKHLK  SF++C++RWWERRDQ+ +EE++LE+ GG   IIERD +   S
Sbjct: 580 EWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSAS-S 638

Query: 650 KRR 652
           KRR
Sbjct: 639 KRR 641

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/604 (48%), Positives = 387/604 (64%), Gaps = 26/604 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F ++Q   E +++  V+R   R +P MF NP H KREL +FGGE T  ET  THFYNDL+
Sbjct: 54  FKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDLF 113

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            YS+  ++WK+Y S+N+P+PRSSAAVA HP+G+AL+HGGEFSSPKQ+ FYHYSD+WLFDC
Sbjct: 114 VYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDC 173

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           + +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLNDLW FDI+NY
Sbjct: 174 SSKEWTKVE---QKNGPSARSGHRMAIWKNFIILHGGFRDLGTS-TTYLNDLWVFDITNY 229

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  P+ARSGH  I T   A+L GGY K+  K  K L KGKIL+D W L +
Sbjct: 230 KWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKV--KAGKGLQKGKILSDCWYLKM 287

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K   +QPSPRVG S  +  + + V FGGVYD +ETEESL S+FYN+LY
Sbjct: 288 KSDLGSIRWERRKKQGSQPSPRVGCSM-VHHKGRGVLFGGVYDFEETEESLRSIFYNELY 346

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXX-- 412
            + +E N+W  + ++PQR+  N       + KSN++++KEL+D+LN IL K+NL      
Sbjct: 347 TYQIENNRWYAMSLRPQRKKKN-----FVQSKSNRNKDKELEDILNQILDKANLRDAEDD 401

Query: 413 -XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGV 471
                                              + LPH RFNAAT VVDD+LFI+ G 
Sbjct: 402 DESKVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGT 461

Query: 472 WELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXX 531
            E+GEKDYPI+SFYSID+NKLDGV VYWE+L  +E A++LG                   
Sbjct: 462 VEIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDG 521

Query: 532 XXXXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 591
                     + L              + + EIPD R WLPHPK FETLRAFY+R G  F
Sbjct: 522 EEEIVD----SKLEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTF 577

Query: 592 LTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKI 648
           L  +IS+N+D KGKHLKTKSFE+C+DRWWERR+QV +EE++LE+ GG   +IE+D T+K 
Sbjct: 578 LELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKD-TSKT 636

Query: 649 SKRR 652
            +RR
Sbjct: 637 QRRR 640

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/616 (48%), Positives = 386/616 (62%), Gaps = 30/616 (4%)

Query: 58  FTKKQTELEHVDITAVER-----LSCRTHPLMF-ANPQHNKR--ELFIFGGEFTDPETKL 109
           F  +Q + E +++  + +     +S R++  M  A   HNK+  EL +FGGE+T PET +
Sbjct: 57  FKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGM 116

Query: 110 THFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHY 169
           THFYNDL SY+     W+K  S+N+P+PRSSAA+  HPSGIA+LHGGEFSSPKQ+ FYHY
Sbjct: 117 THFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHY 176

Query: 170 SDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDL 229
           SDTW+ D + +++TK++      SP ARSGHRI+ WKNYF+LFGGF+D+GN QT+Y ND+
Sbjct: 177 SDTWILDTSTKEWTKVDI---KKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDV 233

Query: 230 WCFDISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKIL 286
           WCFDI NYKWT++E    +  P+ RSGH +IP +   IL GGY K+ +K      KGKIL
Sbjct: 234 WCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKIL 293

Query: 287 NDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLE 346
           ND W L +  D    +WE+ K    QPSPRVG S   + + + + FGGVYD  ETEESLE
Sbjct: 294 NDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETEESLE 352

Query: 347 SVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKS 406
           S+FYNDL+ +++E N+W  L ++ + Q  NK+    S  K++K++EKELQDLLN IL K+
Sbjct: 353 SLFYNDLFSYNVETNRWFALNLR-KNQKGNKSLK-RSNNKNSKEKEKELQDLLNQILEKN 410

Query: 407 NLXXXXXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXXITISNQLPHPRFNAATC 459
           NL                                         +TI NQLPHPR+N A  
Sbjct: 411 NLKDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMT 470

Query: 460 VVDDSLFIYSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXX 519
           VVDD LFIY G WELGEKDY INSFYSIDLN++DGV  YWEDL  IE+AK LG       
Sbjct: 471 VVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEE 530

Query: 520 XXXXXXXXXXXXXXXXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFET 579
                                  +                 +MEIPD R WLPHPKPFE+
Sbjct: 531 DDEDDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDV---QEMEIPDLRPWLPHPKPFES 587

Query: 580 LRAFYLREGANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLED---T 636
           LRAFY+REG  FL W+ISNNK ++GKHLK KSFE+CEDRWWERRDQ+ +EE++LE+    
Sbjct: 588 LRAFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVV 647

Query: 637 GGIIERDTTTKISKRR 652
           G +IE+DT+   SKRR
Sbjct: 648 GDVIEKDTSKGASKRR 663

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/601 (50%), Positives = 375/601 (62%), Gaps = 29/601 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q + E V +  +ER S R +P M ANP H K EL +FGGE T   T  THF+NDL 
Sbjct: 56  FKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLV 115

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            +S  N  WK+  S+N+P+PRSSAA+  HPSG+ALLHGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 116 VFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDC 175

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           A +++TK+E   + + PSARSGHR+  WKN+ IL GGFRDLG   T+YLND W FDI+ Y
Sbjct: 176 ATKEWTKIE---QKNGPSARSGHRMAVWKNFIILHGGFRDLGTS-TTYLNDCWLFDITTY 231

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  P+ARSGH  I     AIL GGYCK+  K  K L KGKIL D W L +
Sbjct: 232 KWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKV--KAGKGLQKGKILTDCWYLKM 289

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
           + +    +W++ K    QPSPRVG S  +  + + V FGGVYD +ETEESLES FYND++
Sbjct: 290 SSNTSAIRWDRKKRQGFQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            + + +N+W  L ++PQR+   K   L +  +S KDQEKEL+DLLN IL  + L      
Sbjct: 349 TYQINMNRWYSLSLRPQRK---KQVKLNN--RSTKDQEKELEDLLNKILRNAQLDDQGEE 403

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                         I N+LPHPRFNAAT VVDD+LFI+ GVWE 
Sbjct: 404 EEIDAAEESTAVEEDSDESESLDKEH---VIMNELPHPRFNAATAVVDDTLFIFGGVWEF 460

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GEKDY I+SFY IDLNK DGV VYWEDL+ +E AK                         
Sbjct: 461 GEKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKD-------EDDSDEDEGEEDDDDEE 513

Query: 535 XXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594
                 V                 + +MEIPD R WLPHPK FE+LR+FY+R GA FL W
Sbjct: 514 DSEEEQVDQKLVAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEW 573

Query: 595 SISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKISKR 651
           +ISNN+ +KGKHLKTKSFEICE RWWERRDQV LEE++LE+ GG   IIERD TTK  KR
Sbjct: 574 AISNNRHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERD-TTKTKKR 632

Query: 652 R 652
           R
Sbjct: 633 R 633

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/601 (49%), Positives = 383/601 (63%), Gaps = 25/601 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   E ++I +VE+ S R +  + ++    K+EL +FGGE T  E + T FYNDLY
Sbjct: 55  FKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKFYNDLY 112

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           ++S  NN WK+  S+N+P+PRSSAA+A HPSGIALL+GGEFSSPKQS FYHYSDTW+ D 
Sbjct: 113 TFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWILDL 172

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++TK+E  G+   P  RSGHRI  WKNYFILFGGF+DLG+  T+Y ND+W FDI+ Y
Sbjct: 173 TTKEWTKIE--GK-VKPVGRSGHRITTWKNYFILFGGFKDLGH-STTYYNDVWLFDITTY 228

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +T P+ARSGH  IPT    I+ GGYCKI AK  K L KGK+L+  W L +
Sbjct: 229 KWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAK--KGLQKGKLLSGCWNLKM 286

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D +  +WE+ +    QPSPRVG S   + + + + FGGVYD  ETEESLES+FYNDL+
Sbjct: 287 KADVEAIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFDETEESLESIFYNDLF 345

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            +++E N+W  + +K  +++N      ++K KS+K++E+ELQDLLN IL K+NL      
Sbjct: 346 TYNIESNRWFNVTLK--KRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNL-----K 398

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                       I    QLPHPRFNA T V+DD L+IY G WE 
Sbjct: 399 PDDEEEEESSDIFGSDDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEF 458

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GE DY I+SFYSIDLNKLDGVNVYWEDL+ IE AK LG                      
Sbjct: 459 GEIDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELG---EQGSEDEDEDDFEEDEEDG 515

Query: 535 XXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594
                   L+                +MEIPD R WLPHPK FE+LRAFYLREG  FL W
Sbjct: 516 EEEVEDTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEW 575

Query: 595 SISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLED---TGGIIERDTTTKISKR 651
           +ISNN+  +GK LK KSFE+C+DRWWERRDQ+++EE++LE+    G ++ERDT+  +SKR
Sbjct: 576 AISNNRHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635

Query: 652 R 652
           R
Sbjct: 636 R 636

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/600 (47%), Positives = 379/600 (63%), Gaps = 28/600 (4%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   + V +T VER S R +  M ANP H KREL IFGGE T+    LT FYN+L+
Sbjct: 81  FKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELF 140

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+ ++ W+K  S+N+P+PRSSAA A H SG+AL+HGGEFSSPKQ+ FYHYSDTWL DC
Sbjct: 141 TYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWLLDC 200

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             +++TK+E   + + PSARSGHR+  WKN+FIL GGFRDLG   T+YLNDLW FDI+ Y
Sbjct: 201 TTKEWTKME---QKNGPSARSGHRMTIWKNFFILHGGFRDLGTS-TTYLNDLWIFDITTY 256

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  P+ARSGH  IPT + A+L GGYCK+  K  K L KGK L D W L +
Sbjct: 257 KWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKV--KAGKGLQKGKTLTDCWYLKM 314

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S  +  + + + FGGVYD +ETEE L S F+NDL+
Sbjct: 315 KSDVSAIRWERRKKQGFQPSPRVGCSM-VHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            + +E N+W  ++++PQ++         +  ++N+++++EL+++LN IL ++NL      
Sbjct: 374 SYQVEANRWYSVKMRPQKKKT------VAISRNNRNKDEELENILNDILQQANL----AD 423

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                         +  QLPHPRFNA T VVDD LFI+ GVWE 
Sbjct: 424 DTDDDDNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEF 483

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GE+D+ I+SFYSIDLNKLDGV VYWE+LS +E+AK LG                      
Sbjct: 484 GERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEET 543

Query: 535 XXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTW 594
                    L              + + EIPD R WLPHPKPFETLRAFY+R GA FL W
Sbjct: 544 ADQK-----LVAEDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKW 598

Query: 595 SISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKISKR 651
           +ISNN+D KGKHLK +SF++C+DRWWERR+Q+ +EE++LE+ GG   ++ERD    + +R
Sbjct: 599 AISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/602 (46%), Positives = 370/602 (61%), Gaps = 22/602 (3%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F K+Q   + V +T V+R S R++  M  NP H KREL IFGGE+T+  +  T FYN+L+
Sbjct: 55  FRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELF 114

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
           +YS+  + WKK  S+NAP+PRSSAA A HPSG+ L+HGGEFSSPKQ+ FYHYSD+WL DC
Sbjct: 115 TYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDC 174

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
           + +++TK++   + + PSARSGHR+  WKN+F++ GGFRDLG   T+YLND W FDI+ Y
Sbjct: 175 SSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWLFDITTY 230

Query: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           KW ++E    +  P+ARSGH  IPT   AI+ GGYCKI AK  K L KGKIL D W L +
Sbjct: 231 KWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAK--KGLQKGKILTDCWYLRM 288

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL 
Sbjct: 289 KSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDLL 347

Query: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXX 414
            + +E N+W  ++++PQ++       + +  KS K ++ EL  +LN IL K+NL      
Sbjct: 348 SYQVEANRWYSIKMRPQKKK------IVAASKSAKSKDDELVGILNDILQKANLADEENE 401

Query: 415 XXXXXXXXXXXXXXXXXXXXXXXXXXXXITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474
                                         ++ QLPH RFNAAT VVDD+LFI+ G WE 
Sbjct: 402 ENESDSEIEKELHRLDEEELLGHQQKQYPVVA-QLPHSRFNAATTVVDDTLFIFGGSWEY 460

Query: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXXX 534
           GE+D+ I+SFYSIDLN+ DGV V+WEDL  IE+AK  G                      
Sbjct: 461 GERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEET 520

Query: 535 XXXXXXVALL--XXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 592
                   +                 +A  EIPD R WLPHPK FETLRAFY+R GA FL
Sbjct: 521 LDEELIAEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFL 580

Query: 593 TWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKIS 649
            W+ISNN+  KGKHLK +SF++ +DRWWERR+QV +EE++LE+ GG   IIERD++    
Sbjct: 581 QWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTK 640

Query: 650 KR 651
           +R
Sbjct: 641 RR 642

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/602 (46%), Positives = 372/602 (61%), Gaps = 16/602 (2%)

Query: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117
           F  +Q + E V +  V   + R +  +  N   +K EL +FGGE T+ ET +T FYNDL+
Sbjct: 57  FKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFYNDLH 114

Query: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177
            Y+ +NN WKK+ S+N+P+PRSSAA+  H SG+ +L GGEFSSPKQ+ FYHY+DTWL D 
Sbjct: 115 VYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDN 174

Query: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
             R+++KL+F    + PSARSGHRI  WKNYFILFGGF+DL  G TSY ND+W F++ ++
Sbjct: 175 TTREWSKLDF---KNGPSARSGHRITTWKNYFILFGGFKDLNQG-TSYFNDVWLFNVVDF 230

Query: 238 KWTKLETNTK--PEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           KWTK ET  K  P+ RSGH +I ++   I+ GGYCK+ AKNNK+L KGK L D W L ++
Sbjct: 231 KWTKWETTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMS 290

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            +  + +WE+      QPSPRVG S  L + N+ + FGGVYDL+ETEE L S++YNDLY 
Sbjct: 291 QNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYS 350

Query: 356 FHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLXXXXXXX 415
           +++E N+W  L+++   Q +N N   +S    +K+QEKELQDLLN IL +++L       
Sbjct: 351 YNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNS 410

Query: 416 XXXXXXXXXXXXXXXXXXXXXXXXXXXITIS--NQLPHPRFNAATCVVDDSLFIYSGVWE 473
                                        +   NQLPH RFNA T V++D+ +IY G+WE
Sbjct: 411 YSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWE 470

Query: 474 LGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGXXXXXXXXXXXXXXXXXXXXX 533
             + DY I+SFYSIDLNKLDG+  Y+E+L  IEE KRLG                     
Sbjct: 471 FKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLG---DVQSEDDFEYEDDDDEDD 527

Query: 534 XXXXXXXVALLXXXXXXXXXXXXXXQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLT 593
                    L                 +MEIPD R WLPHPK FE+LR FY+REG  FL 
Sbjct: 528 GEAEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLE 587

Query: 594 WSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLED---TGGIIERDTTTKISK 650
           W+ISNNK  KGKHLK KSFE+C+DRWWERRDQ+ +EE++L++    G IIERD  +  + 
Sbjct: 588 WAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTA 647

Query: 651 RR 652
           RR
Sbjct: 648 RR 649

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 102/259 (39%), Gaps = 50/259 (19%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC--AER 180
           W +   +N+P PR    S+A A   + I +L G    S        Y DTW+  C     
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWIISCNPDAT 191

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT 240
           +F+       +++P  R GH      N FI+FGG     N +    +D++ F+I++YKWT
Sbjct: 192 QFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKWT 251

Query: 241 -KLETNTKPEARSGH--CFIPTDNSAI---LMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH  C + T        L GG                  ND    +L
Sbjct: 252 IPNPIGPRPLGRYGHKICILATSTVKTKLYLFGGQ-----------FDDTYFNDLAVFDL 300

Query: 295 TP---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348
           +        W++ K K F   P      V Y  +LW       +GG     +T++ L   
Sbjct: 301 SSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLW------IYGG-----DTQQGL--- 346

Query: 349 FYNDLYMFHLELNKWSKLR 367
             ND++ F    N W+K+ 
Sbjct: 347 -INDIFKFSPNTNTWTKVE 364

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 85/185 (45%), Gaps = 26/185 (14%)

Query: 92  KRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSKN-APLPRSSAAVAVH 146
           K +L++FGG+F D     T+F +    DL S+  +++ W+   SK   P P ++  +  +
Sbjct: 277 KTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTY 331

Query: 147 PSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWK 206
            S +  ++GG+      ++    +D + F      +TK+E  G  + P     H  + +K
Sbjct: 332 GSDL-WIYGGD------TQQGLINDIFKFSPNTNTWTKVETTG--TKPPPMQEHAAVVYK 382

Query: 207 NYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET--NTKPEARSGHCFIPTDNSAI 264
           N   + GG     +    YLN ++ F+  + KW       +   + RSGH     +N  +
Sbjct: 383 NIMCVVGG----KDENDMYLNSVYLFNFDSSKWYTFPDFKSGIIQGRSGHSVTLLNNDKL 438

Query: 265 L-MGG 268
           L MGG
Sbjct: 439 LIMGG 443

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 122/295 (41%), Gaps = 57/295 (19%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNA---PLPRSSAAVAVHPSGIA 151
             +FGG+ T    K     +D+Y ++I  NS+K  +       PL R    + +  +   
Sbjct: 220 FIVFGGD-THKVNKEGLMDDDIYLFNI--NSYKWTIPNPIGPRPLGRYGHKICILATSTV 276

Query: 152 ----LLHGGEFSSPKQSKFYHYSDTWLFDCAE--RKFTKLEF-GGRDSSPSARSGHRIIA 204
                L GG+F         +++D  +FD +   R+ +  EF   +   P   + H ++ 
Sbjct: 277 KTKLYLFGGQFDD------TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVT 330

Query: 205 WKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPTDNSA 263
           + +   ++GG     + Q   +ND++ F  +   WTK+ET  TKP     H  +   N  
Sbjct: 331 YGSDLWIYGG-----DTQQGLINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIM 385

Query: 264 ILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFN 322
            ++GG        ++N M    LN  +  N   D  KW      +FK+     R G+S  
Sbjct: 386 CVVGG-------KDENDM---YLNSVYLFNF--DSSKWYT--FPDFKSGIIQGRSGHSVT 431

Query: 323 LWKQNKSVAFG---------GVYDLQ--ETEESLESVFYNDLYMFHLELNKWSKL 366
           L   +K +  G         G YDL   E +E + ++ Y       L+L++ S L
Sbjct: 432 LLNNDKLLIMGGDKYDFARPGDYDLHTSEIDEGVGTILYT------LDLSRLSNL 480

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 105/260 (40%), Gaps = 58/260 (22%)

Query: 126 WKKYVSKNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFT 183
           W +   +N+P PR    A+  +  +    + GG      QS    Y DTW+  C + + +
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHD---QSV---YGDTWVLTCEDPQTS 184

Query: 184 KLEFGGR-----DSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK 238
            + F  R     +++P  R GH      N F++FGG     N      +D++ F+I++YK
Sbjct: 185 TM-FSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 239 WT-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKN----LMKGKI----LNDA 289
           WT       +P+ R GH                 IIA+        L  G+      ND 
Sbjct: 244 WTIPHPIGPRPKGRYGHKI--------------SIIARKQMQTKLYLFGGQFDDNYFNDL 289

Query: 290 WKLNLTP---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEE 343
              +L+    D   W++ K ++F   P      V Y F LW       FGG        +
Sbjct: 290 VVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLW------VFGG--------D 335

Query: 344 SLESVFYNDLYMFHLELNKW 363
           +LE +  N ++M+   +N W
Sbjct: 336 TLEGLL-NQVFMYDPAVNDW 354

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 107/253 (42%), Gaps = 36/253 (14%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPL-PRSSAAVAVHPSGIA-- 151
             IFGG+ T  + ++    +D+Y ++I +  W    +   P+ PR         S IA  
Sbjct: 214 FVIFGGD-THKKNEMGEMDDDIYLFNINSYKW----TIPHPIGPRPKGRYGHKISIIARK 268

Query: 152 ------LLHGGEFSSPKQSKFYHYSDTWLFDCAE--RKFTKLEF-GGRDSSPSARSGHRI 202
                  L GG+F         +++D  +FD +   R  +  EF   R   P   + H +
Sbjct: 269 QMQTKLYLFGGQFDD------NYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTM 322

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNS 262
           +++     +FGG  D   G    LN ++ +D +   W  +ET  + +          +++
Sbjct: 323 VSYDFKLWVFGG--DTLEG---LLNQVFMYDPAVNDWCVVETTCQDDDLENMPPPMQEHA 377

Query: 263 AILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSF 321
            ++  G   I+   ++   +   LND + LNL    K  +W +L  F +  P  R G+S 
Sbjct: 378 TLIYKGLMCIVGGKDE---QDHYLNDVYFLNL----KSLKWFRLPRFMDGIPQGRSGHSV 430

Query: 322 NLWKQNKSVAFGG 334
            L K +K +  GG
Sbjct: 431 TLLKNDKLLIMGG 443

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 93/214 (43%), Gaps = 38/214 (17%)

Query: 94  ELFIFGGEFTDPETKLTHFYNDLYSYSI----KNNSWKKYVSKNA--PLPRSSAAVAVHP 147
           +L++FGG+F D      +++NDL  + +    +++S  +++   +  P P ++  +  + 
Sbjct: 273 KLYLFGGQFDD------NYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYD 326

Query: 148 SGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSS----PSARSGHRII 203
             + +  G              +  +++D A   +  +E   +D      P     H  +
Sbjct: 327 FKLWVFGGDTLEG-------LLNQVFMYDPAVNDWCVVETTCQDDDLENMPPPMQEHATL 379

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE--TNTKPEARSGHCFIPTDN 261
            +K    + GG     + Q  YLND++  ++ + KW +L    +  P+ RSGH      N
Sbjct: 380 IYKGLMCIVGG----KDEQDHYLNDVYFLNLKSLKWFRLPRFMDGIPQGRSGHSVTLLKN 435

Query: 262 SAIL-MGG----YCKIIAKN----NKNLMKGKIL 286
             +L MGG    Y ++  ++      N+ KG +L
Sbjct: 436 DKLLIMGGDKFDYARMDPQDFHTSETNMGKGTLL 469

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 109/277 (39%), Gaps = 63/277 (22%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAER-- 180
           W +    N+P PR    ++A A   + + ++ G    S        Y DTW+    +   
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIISAHDNGS 130

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT 240
           KF+       D++P  R GH      N F++FGG     N      +D++ F+I++YKWT
Sbjct: 131 KFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 190

Query: 241 -KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNN---KNLMKGKILNDAWKLNLT- 295
                  +P  R GH                 IIA +    K  + G   +D +  +LT 
Sbjct: 191 IPRPVGPRPLGRYGHKI--------------SIIATSQMRTKLYVFGGQFDDTYFNDLTV 236

Query: 296 --------PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEES 344
                   PD   WQ+ K   F   P      + Y + LW       FGG     +T + 
Sbjct: 237 FDLSSFRRPD-SHWQFIKPNTFTPPPLTNHTMISYDYKLW------VFGG-----DTPQG 284

Query: 345 LESVFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPL 381
           L     ND++MF  ++N W     K  + T +K  PL
Sbjct: 285 L----INDVFMFDPQINDW-----KVMQTTGDKPPPL 312

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 84/194 (43%), Gaps = 22/194 (11%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPE-TKLTHFYNDLYSYSIKNNSWKKYVSKN--APLP 137
           H +        + +L++FGG+F D     LT F  DL S+   ++ W +++  N   P P
Sbjct: 205 HKISIIATSQMRTKLYVFGGQFDDTYFNDLTVF--DLSSFRRPDSHW-QFIKPNTFTPPP 261

Query: 138 RSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSAR 197
            ++  +  +   + +  G    +P+       +D ++FD     +  ++  G    P   
Sbjct: 262 LTNHTMISYDYKLWVFGG---DTPQG----LINDVFMFDPQINDWKVMQTTG--DKPPPL 312

Query: 198 SGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET--NTKPEARSGHC 255
             H  + + +   + GG     + Q  Y N ++  ++ + KW KL +  +  P+ RSGH 
Sbjct: 313 QEHAAVLYGDLMCVVGG----KDEQDVYSNSVFFLNLISLKWFKLPSYRSGIPQGRSGHS 368

Query: 256 FIPTDNSAIL-MGG 268
                N  +L MGG
Sbjct: 369 LTLLPNHKLLIMGG 382

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 103/265 (38%), Gaps = 52/265 (19%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAER-- 180
           W++    N+P PR    ++A A   + + ++ G    S        Y DTW+    E   
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT 240
           +FT       D++P  R GH      N F++FGG     N      +D++ F+I++YKWT
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 188

Query: 241 -KLETNTKPEARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH        P      + GG                  ND    +L
Sbjct: 189 IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQ-----------FDDTYFNDLAVFDL 237

Query: 295 T----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347
           +    PD   WQ+    +F   P      + Y + LW       FGG     +T + L  
Sbjct: 238 SSFRRPD-SSWQFITPNSFTPPPLTNHAMISYDYKLW------VFGG-----DTPQGL-- 283

Query: 348 VFYNDLYMFHLELNKWSKLRIKPQR 372
              +D+++F  ++N W  ++   Q+
Sbjct: 284 --IDDVFVFDPQVNDWKFIQTTGQK 306

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 84/186 (45%), Gaps = 28/186 (15%)

Query: 92  KRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSKNA--PLPRSSAAVAV 145
           K +L++FGG+F D     T+F +    DL S+   ++SW ++++ N+  P P ++ A+  
Sbjct: 214 KTKLYVFGGQFDD-----TYFNDLAVFDLSSFRRPDSSW-QFITPNSFTPPPLTNHAMIS 267

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAW 205
           +   + +  G    +P+        D ++FD     +  ++  G+   P     H  + +
Sbjct: 268 YDYKLWVFGG---DTPQGL----IDDVFVFDPQVNDWKFIQTTGQ--KPPPLQEHASVLY 318

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE--TNTKPEARSGHCFIPTDNSA 263
            +   + GG     + Q  Y N ++  ++ + KW K        P+ RSGH      N  
Sbjct: 319 GDLMCIVGG----KDEQDVYSNGVYFLNLISLKWFKFPFFRAGIPQGRSGHSLTLLPNHK 374

Query: 264 IL-MGG 268
           +L MGG
Sbjct: 375 LLIMGG 380

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 105/263 (39%), Gaps = 66/263 (25%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL---FDCAE 179
           W +   +++P PR    S+A     + I ++ G    S        Y DTW+   FD A 
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNA- 164

Query: 180 RKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKW 239
            KF+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKW
Sbjct: 165 TKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW 224

Query: 240 T-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI-----------LN 287
           T       +P  R GH                 IIA N    MK K+            N
Sbjct: 225 TVPAPVGPRPLGRYGHKI--------------SIIATNQ---MKTKLYVFGGQFDDTYFN 267

Query: 288 DAWKLNLT----PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQE 340
           D    +L+    PD   W++ K K F   P      + Y   LW       FGG      
Sbjct: 268 DLAVYDLSSFRRPD-SHWEFLKPKTFSPPPITNFTMISYDSKLW------VFGG------ 314

Query: 341 TEESLESVFYNDLYMFHLELNKW 363
             ++L+ +  ND++M+   LN W
Sbjct: 315 --DTLQGLV-NDVFMYDPALNDW 334

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 94/223 (42%), Gaps = 36/223 (16%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSKN-A 134
           H +        K +L++FGG+F D       ++NDL  Y +      ++ W+    K  +
Sbjct: 240 HKISIIATNQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKTFS 293

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSP 194
           P P ++  +  + S + +  G              +D +++D A   +  +E  G    P
Sbjct: 294 PPPITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPP 346

Query: 195 SARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEARS 252
                H  + + +   + GG     +   +YLN ++  ++ + KW KL   T   P+ RS
Sbjct: 347 VQE--HATVVYNDLMCVVGG----KDEHDAYLNSVYFLNLKSNKWFKLPVFTAGIPQGRS 400

Query: 253 GHCFIPTDNSAIL-MGG----YCKI----IAKNNKNLMKGKIL 286
           GH      N  IL MGG    Y ++    +  ++ ++ KG I+
Sbjct: 401 GHSLTLLKNDKILIMGGDKFDYARVEESDLHTSDIDMQKGTIV 443

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 113/287 (39%), Gaps = 56/287 (19%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLH 154
             +FGG+ T    K     +D+Y  +I +  W        P P     +  +   I+++ 
Sbjct: 194 FVVFGGD-THKVNKEGLMDDDIYLLNINSYKW------TVPAPVGPRPLGRYGHKISIIA 246

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCAERKFTKLEFGGRDS----------SPSARSGH 200
             +     ++K Y     + DT+  D A    +   F   DS          SP   +  
Sbjct: 247 TNQM----KTKLYVFGGQFDDTYFNDLAVYDLSS--FRRPDSHWEFLKPKTFSPPPITNF 300

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPT 259
            +I++ +   +FGG  D   G    +ND++ +D +   W  +ET   KP     H  +  
Sbjct: 301 TMISYDSKLWVFGG--DTLQG---LVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVY 355

Query: 260 DNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNF-KNQPSPRVG 318
           ++   ++GG  +  A           LN  + LNL    K  +W KL  F    P  R G
Sbjct: 356 NDLMCVVGGKDEHDA----------YLNSVYFLNL----KSNKWFKLPVFTAGIPQGRSG 401

Query: 319 YSFNLWKQNKSVAFGG-VYDLQETEESLESVFYNDLYMFHLELNKWS 364
           +S  L K +K +  GG  +D    EES       DL+   +++ K +
Sbjct: 402 HSLTLLKNDKILIMGGDKFDYARVEES-------DLHTSDIDMQKGT 441

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 106/259 (40%), Gaps = 38/259 (14%)

Query: 123 NNSWKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAE 179
           N  W +   K++P PR    +++ A     + ++ G       QS F    D W+    E
Sbjct: 194 NVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLH----DQSVF---GDVWIIKSLE 246

Query: 180 R--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
              KFT       +++P  R GH      N F++FGG     N      +DL+ F+I++Y
Sbjct: 247 NGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSY 306

Query: 238 KWT-KLETNTKPEARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWK 291
           KWT       +P  R GH        P      L GG       NN  +       D  +
Sbjct: 307 KWTIPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQFDDTYFNNLAVF------DLSQ 360

Query: 292 LNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
               PD   W++ K K+F   P P   ++   + QNK   FGG        ++L+ +  N
Sbjct: 361 FR-RPD-SHWEFLKPKSF--MPPPLTNHTMVSY-QNKLWIFGG--------DTLQGLI-N 406

Query: 352 DLYMFHLELNKWSKLRIKP 370
            ++M+  E+N W+ +   P
Sbjct: 407 KIFMYDPEVNDWTVVETFP 425

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 106/255 (41%), Gaps = 40/255 (15%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLH 154
             +FGG+ T    K     +DLY ++I +  W        P P     +  +   ++++ 
Sbjct: 278 FVVFGGD-THKVNKDGLMDDDLYLFNINSYKW------TIPNPIGPRPLGRYGHKVSII- 329

Query: 155 GGEFSSPKQSKFY----HYSDTW-----LFDCAE--RKFTKLEFGGRDS-SPSARSGHRI 202
               ++P ++K Y     + DT+     +FD ++  R  +  EF    S  P   + H +
Sbjct: 330 ---ATTPMKTKLYLFGGQFDDTYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTM 386

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHCFIP--TD 260
           ++++N   +FGG    G      +N ++ +D     WT +ET   P       F P   +
Sbjct: 387 VSYQNKLWIFGGDTLQG-----LINKIFMYDPEVNDWTVVET--FPANNDQENFPPPMQE 439

Query: 261 NSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVGY 319
           +++++ G    ++   ++   +   LN  + L +       +W KL       P  R G+
Sbjct: 440 HASVMYGDLMVVMGGKDE---QDNYLNTVYFLKI----NTLEWYKLPFLSVGIPQGRSGH 492

Query: 320 SFNLWKQNKSVAFGG 334
           S  L K NK +  GG
Sbjct: 493 SITLLKGNKLLIMGG 507

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 83/189 (43%), Gaps = 28/189 (14%)

Query: 92  KRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSKN-APLPRSSAAVAVH 146
           K +L++FGG+F D     T+F N    DL  +   ++ W+    K+  P P ++  +  +
Sbjct: 335 KTKLYLFGGQFDD-----TYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSY 389

Query: 147 PSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEF----GGRDSSPSARSGHRI 202
            + + +  G              +  +++D     +T +E       +++ P     H  
Sbjct: 390 QNKLWIFGGDTLQG-------LINKIFMYDPEVNDWTVVETFPANNDQENFPPPMQEHAS 442

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE--TNTKPEARSGHCF-IPT 259
           + + +  ++ GG  +    Q +YLN ++   I+  +W KL   +   P+ RSGH   +  
Sbjct: 443 VMYGDLMVVMGGKDE----QDNYLNTVYFLKINTLEWYKLPFLSVGIPQGRSGHSITLLK 498

Query: 260 DNSAILMGG 268
            N  ++MGG
Sbjct: 499 GNKLLIMGG 507

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 101/259 (38%), Gaps = 52/259 (20%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAER-- 180
           W +    N+P PR    ++A A     I ++ G    S        Y DTW+        
Sbjct: 134 WNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSENNAS 186

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT 240
           +F        D++P  R GH      N FI+FGG     N      +DL+ F+I+++KWT
Sbjct: 187 RFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINSHKWT 246

Query: 241 -KLETNTKPEARSGH--CFIPTDNSAI---LMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
                  +P  R GH    I T NS     L GG                  ND    +L
Sbjct: 247 IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQ-----------FDDAYFNDLVVFDL 295

Query: 295 T----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347
           +    PD  +W++ K K+F   P      V Y   LW       FGG        ++L+ 
Sbjct: 296 SSFRRPD-SRWEFVKPKSFVPPPLTNHTMVSYDNKLW------VFGG--------DTLQG 340

Query: 348 VFYNDLYMFHLELNKWSKL 366
           +  N ++M+   +N W+ +
Sbjct: 341 L-TNRVFMYDPMINDWTTI 358

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 94/225 (41%), Gaps = 36/225 (16%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSKN-A 134
           H +      ++K  L++FGG+F D       ++NDL  + +      ++ W+    K+  
Sbjct: 261 HKISIIATANSKTRLYLFGGQFDDA------YFNDLVVFDLSSFRRPDSRWEFVKPKSFV 314

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSP 194
           P P ++  +  + + + +  G          F       ++D     +T +E    + + 
Sbjct: 315 PPPLTNHTMVSYDNKLWVFGGDTLQGLTNRVF-------MYDPMINDWTTIETSSDNPNN 367

Query: 195 SA--RSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEA 250
            A     H  I +K+   +FGG     + Q +YLN ++  ++   KW KL       P+ 
Sbjct: 368 IAPPMQEHAAIVYKDLMCIFGG----KDEQDTYLNGVYFLNLRTLKWYKLPIFAPGIPQG 423

Query: 251 RSGHCFIPTDNSAIL-MGG----YCKI----IAKNNKNLMKGKIL 286
           RSGH      N  +L MGG    Y ++    +  +  N+ KG IL
Sbjct: 424 RSGHSITLLKNDKLLIMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 105/257 (40%), Gaps = 46/257 (17%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIAL-- 152
             IFGG+ T    K     +DLY ++I ++ W      N   PR         S IA   
Sbjct: 215 FIIFGGD-THKVNKDGLMDDDLYLFNINSHKW---TIPNPVGPRPLGRYGHKISIIATAN 270

Query: 153 ------LHGGEFSSPKQSKFYHYSDTWLFDCAE--RKFTKLEFGGRDS-SPSARSGHRII 203
                 L GG+F         +++D  +FD +   R  ++ EF    S  P   + H ++
Sbjct: 271 SKTRLYLFGGQFDD------AYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMV 324

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNSA 263
           ++ N   +FGG  D   G T   N ++ +D     WT +ET++             +N A
Sbjct: 325 SYDNKLWVFGG--DTLQGLT---NRVFMYDPMINDWTTIETSSDN----------PNNIA 369

Query: 264 ILMGGYCKIIAKNNKNLMKGK-----ILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRV 317
             M  +  I+ K+   +  GK      LN  + LNL    +  +W KL  F    P  R 
Sbjct: 370 PPMQEHAAIVYKDLMCIFGGKDEQDTYLNGVYFLNL----RTLKWYKLPIFAPGIPQGRS 425

Query: 318 GYSFNLWKQNKSVAFGG 334
           G+S  L K +K +  GG
Sbjct: 426 GHSITLLKNDKLLIMGG 442

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 104/267 (38%), Gaps = 47/267 (17%)

Query: 126 WKKYVSKNAPLPRSSAAVA--VHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAER--- 180
           W K   K  P PR     +  ++PS    ++GG F S        Y DTW  +  E    
Sbjct: 22  WSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKENYNE 75

Query: 181 --------KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLND-LWC 231
                       ++  G  ++P  R GH      N  I+FGG     N     ++D L+ 
Sbjct: 76  NDLERWHYSCNIIDIMG--TTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYF 133

Query: 232 FDISNYKWT-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILN--D 288
            ++   KWT       +P  R GH     +++  L GG       N+  L+K  +LN  D
Sbjct: 134 LNLDTTKWTIPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFND--LVKFDLLNFKD 191

Query: 289 AWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348
           A          +W++ K K F   P P   +S   + +NK   FGG             V
Sbjct: 192 ANS--------QWEFIKPKGFI--PPPLSNFSMCTF-ENKLYVFGG---------DTYQV 231

Query: 349 FYNDLYMFHLELNKWSKLRIKPQRQTN 375
             N+ +++  ELN+WS L    Q  TN
Sbjct: 232 LTNETFVYDPELNEWSILETFGQEDTN 258

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 101/252 (40%), Gaps = 44/252 (17%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL---FDCAE 179
           W +   +N+P PR    ++A     + I ++ G    S        Y DTW+   FD A 
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 180 RKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKW 239
           R F+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKW
Sbjct: 166 R-FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW 224

Query: 240 T-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT--- 295
           T       +P  R GH        +I+     K               ND    +L+   
Sbjct: 225 TVPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFR 278

Query: 296 -PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYN 351
            PD   W++ K + F   P      + Y   LW       FGG        ++L+ +  N
Sbjct: 279 RPD-SHWEFLKPRTFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLV-N 322

Query: 352 DLYMFHLELNKW 363
           D++M+   +N W
Sbjct: 323 DVFMYDPAINDW 334

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 28/186 (15%)

Query: 92  KRELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSKN-APLPRSSAAVAV 145
           K +L++FGG+F D       ++NDL  Y +      ++ W+    +   P P ++  +  
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMIS 304

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAW 205
           + S + +  G              +D +++D A   +  ++  G    P     H  + +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDTTGEKPPPVQE--HATVVY 355

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEARSGHCFIPTDNSA 263
            +   + GG     +   +YLN ++  ++ + KW KL   T   P+ RSGH      N  
Sbjct: 356 NDLMCVVGG----KDEHDAYLNSVYFLNLKSRKWFKLPVFTAGIPQGRSGHSLTLLKNDK 411

Query: 264 IL-MGG 268
           IL MGG
Sbjct: 412 ILIMGG 417

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 105/264 (39%), Gaps = 45/264 (17%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLH 154
             +FGG+ T    K     +D+Y  +I +  W        P P     +  +   I+++ 
Sbjct: 194 FVVFGGD-THKVNKEGLMDDDIYLLNINSYKW------TVPAPVGPRPLGRYGHKISIIA 246

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCA-------ERKFTKLEF-GGRDSSPSARSGHRI 202
             +     ++K Y     + DT+  D A        R  +  EF   R  +P   +   +
Sbjct: 247 TTQM----KTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTM 302

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPTDN 261
           I++ +   +FGG  D   G    +ND++ +D +   W  ++T   KP     H  +  ++
Sbjct: 303 ISYDSKLWVFGG--DTLQG---LVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYND 357

Query: 262 SAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNF-KNQPSPRVGYS 320
              ++GG  +  A           LN  + LNL    K  +W KL  F    P  R G+S
Sbjct: 358 LMCVVGGKDEHDA----------YLNSVYFLNL----KSRKWFKLPVFTAGIPQGRSGHS 403

Query: 321 FNLWKQNKSVAFGG-VYDLQETEE 343
             L K +K +  GG  +D    EE
Sbjct: 404 LTLLKNDKILIMGGDKFDYARVEE 427

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 97/265 (36%), Gaps = 51/265 (19%)

Query: 126 WKKYVSKNAPLPRSS--AAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCAERK 181
           W +    ++PLPR    A+    P     + GG            Y DTW+   +     
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 182 FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT- 240
           FT        ++P  R GH      N  ++FGG     N +    +DL+ F++ +++WT 
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTI 275

Query: 241 KLETNTKPEARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
                T+P  R GH        P      L GG            +     ND    +L+
Sbjct: 276 PTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQ-----------LDDNYFNDLAMYDLS 324

Query: 296 P--DP-KKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349
              +P  +WQ+ K K F   P      V Y + LW       FGG         S     
Sbjct: 325 DFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLW------VFGG---------SSRGEL 369

Query: 350 YNDLYMFHLELNKWSKLRI---KPQ 371
            N LY++  +LN+W  L     KPQ
Sbjct: 370 QNQLYVYIPDLNEWRCLETEGDKPQ 394

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 108/261 (41%), Gaps = 58/261 (22%)

Query: 95  LFIFGGEFTDPETKLTHFYN-------DLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHP 147
           L IFGG+        TH  N       DLY +++ ++ W        P P  +  +  + 
Sbjct: 243 LVIFGGD--------THKLNSEGLLDDDLYLFNVDSHRW------TIPTPIGTRPLGRYG 288

Query: 148 SGIALLHGGEFSSPKQSKFY---------HYSDTWLFDCAERK--FTKLEF-GGRDSSPS 195
             ++++     ++PK++K Y         +++D  ++D ++ +   ++ +F   +  +P 
Sbjct: 289 HQVSVI----ATTPKKAKLYLFGGQLDDNYFNDLAMYDLSDFRNPHSRWQFLKSKAFTPP 344

Query: 196 ARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET-NTKPEARSGH 254
             + H ++A+     +FGG     + +    N L+ +     +W  LET   KP+    H
Sbjct: 345 PLTNHTMVAYDYKLWVFGG-----SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEH 399

Query: 255 CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQP 313
                 N   + GG  K            +  N  + LNL    +  +W +L     N+P
Sbjct: 400 SATIYKNLMCVFGGKNK----------DDEYQNTMYFLNL----QTLKWYRLDTSHCNEP 445

Query: 314 SPRVGYSFNLWKQNKSVAFGG 334
            PR G S +L + +K +  GG
Sbjct: 446 LPRSGQSMSLMQNDKILIMGG 466

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 99/251 (39%), Gaps = 42/251 (16%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAER-- 180
           W +   +N+P PR    ++A     + I ++ G    S        Y DTW+    +   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT 240
           KF+       +++P  R GH  +   N F++FGG     N +    +D++  +I++YKWT
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 241 -KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT---- 295
                  +P  R GH        +I+     K               ND    +L+    
Sbjct: 226 VPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRR 279

Query: 296 PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYND 352
           PD   W++ K K F   P      + Y   LW       FGG        ++L+ +  ND
Sbjct: 280 PD-SHWEFLKPKAFTPPPITNFTMISYDSKLW------VFGG--------DTLQGLI-ND 323

Query: 353 LYMFHLELNKW 363
           ++M+   +N W
Sbjct: 324 VFMYDPAINDW 334

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 96/223 (43%), Gaps = 36/223 (16%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSKN-A 134
           H +        K +L++FGG+F D       ++NDL  Y +      ++ W+    K   
Sbjct: 240 HKISIIATTQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKAFT 293

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSP 194
           P P ++  +  + S + +  G              +D +++D A   +  +E  G    P
Sbjct: 294 PPPITNFTMISYDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIETTGEKPPP 346

Query: 195 SARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEARS 252
                H  + + +   + GG     +   +YLN ++  ++ ++KW KL   T   P+ RS
Sbjct: 347 VQE--HASVVYNDLMCVVGG----KDEHDAYLNSVYFLNLKSHKWFKLPVFTAGIPQGRS 400

Query: 253 GHCF-IPTDNSAILMGG----YCKI----IAKNNKNLMKGKIL 286
           GH   +  D+  ++MGG    Y ++    +  ++ +L +G I+
Sbjct: 401 GHSLTLLKDDKILIMGGDKFDYARVEEFDLHTSDIDLQRGTIV 443

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 104/266 (39%), Gaps = 49/266 (18%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLH 154
             +FGG+ T    K     +D+Y  +I +  W        P P     +  +   I+++ 
Sbjct: 194 FVVFGGD-THKVNKEGLMDDDIYLLNINSYKW------TVPAPVGPRPLGRYGHKISIIA 246

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCAERKFTKLEFGGRDS----------SPSARSGH 200
             +     ++K Y     + DT+  D A    +   F   DS          +P   +  
Sbjct: 247 TTQM----KTKLYVFGGQFDDTYFNDLAVYDLSS--FRRPDSHWEFLKPKAFTPPPITNF 300

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPT 259
            +I++ +   +FGG  D   G    +ND++ +D +   W  +ET   KP     H  +  
Sbjct: 301 TMISYDSKLWVFGG--DTLQG---LINDVFMYDPAINDWFIIETTGEKPPPVQEHASVVY 355

Query: 260 DNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNF-KNQPSPRVG 318
           ++   ++GG  +  A           LN  + LNL    K  +W KL  F    P  R G
Sbjct: 356 NDLMCVVGGKDEHDA----------YLNSVYFLNL----KSHKWFKLPVFTAGIPQGRSG 401

Query: 319 YSFNLWKQNKSVAFGG-VYDLQETEE 343
           +S  L K +K +  GG  +D    EE
Sbjct: 402 HSLTLLKDDKILIMGGDKFDYARVEE 427

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 52/129 (40%), Gaps = 19/129 (14%)

Query: 239 WTKLETNTKPEARSGH---CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    ++   N   ++GG           L    +  D W L   
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGG-----------LHDQSVYGDTWILTAL 161

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            +  K+    +   +  P PRVG++  L   N  V FGG  D  +  +  E +  +D+Y+
Sbjct: 162 DNATKFSTTTIDISEATPPPRVGHAAVLCG-NAFVVFGG--DTHKVNK--EGLMDDDIYL 216

Query: 356 FHLELNKWS 364
            ++   KW+
Sbjct: 217 LNINSYKWT 225

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 116/292 (39%), Gaps = 55/292 (18%)

Query: 91  NKRELFIFGGEFTDPETKLTHFYNDLYSYSIKNN-----SWKKYVSKNAPLPRSSAAVAV 145
           N   +F+ GG +          Y D++  +   N     S +  +  N P PR   A  +
Sbjct: 96  NDNRIFVTGGLYDQ------SVYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTM 149

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRI--I 203
             +   +  GG+     +++     D +LF+    K+T     G  S P  R GH+I  I
Sbjct: 150 CGNAYVVF-GGDTHKLNKNRLLD-DDLYLFNINSYKWTIPHPIG--SRPLGRYGHKISII 205

Query: 204 AWKNY---FILFGGFRDLGNGQTSYLNDLWCFDISNYK-----WTKLE-TNTKPEARSGH 254
           A K       LFGG  D      +Y NDL  FD+S+++     W  LE  +  P   + H
Sbjct: 206 ASKQMHTELYLFGGQID-----ETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNH 260

Query: 255 CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPS 314
             +  DN   + GG                I ND +      DP +  W K++    +P 
Sbjct: 261 TMVTFDNKLWVFGGETP-----------KTISNDTYCY----DPIQNAWSKVETTGEKPP 305

Query: 315 PRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKL 366
           P   ++  ++K    V FGG        + + + + ND+Y  +L   KW KL
Sbjct: 306 PVQEHASVVYKHLMCV-FGG--------KDIHNTYSNDVYFLNLLSLKWFKL 348

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 64/256 (25%), Positives = 100/256 (39%), Gaps = 46/256 (17%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCAER 180
           W +   K++P PR   SS+ +  + + I  + GG +          Y D W    +    
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRI-FVTGGLYDQSV------YGDVWEITANANGT 125

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT 240
            FT        ++P  R GH      N +++FGG     N      +DL+ F+I++YKWT
Sbjct: 126 SFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 241 -KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKN----LMKGKI----LNDAWK 291
                 ++P  R GH                 IIA    +    L  G+I     ND   
Sbjct: 186 IPHPIGSRPLGRYGHKI--------------SIIASKQMHTELYLFGGQIDETYFNDLAV 231

Query: 292 LNLTPDPK-KWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            +L+   +    WE L+     P P   ++   +  NK   FGG     ET +++     
Sbjct: 232 FDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTF-DNKLWVFGG-----ETPKTIS---- 281

Query: 351 NDLYMFHLELNKWSKL 366
           ND Y +    N WSK+
Sbjct: 282 NDTYCYDPIQNAWSKV 297

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 99/245 (40%), Gaps = 28/245 (11%)

Query: 96  FIFGGEFTDPETKLTHFYNDLYSYSIKNNSWK-KYVSKNAPLPRSSAAVAVHPSGIALLH 154
            +FGG+ T    K     +DLY ++I +  W   +   + PL R    +++  S    +H
Sbjct: 155 VVFGGD-THKLNKNRLLDDDLYLFNINSYKWTIPHPIGSRPLGRYGHKISIIAS--KQMH 211

Query: 155 GGEFSSPKQSKFYHYSDTWLFDCA--ERKFTKLEFGGRDSS-PSARSGHRIIAWKNYFIL 211
              +    Q    +++D  +FD +   R  +  EF    S+ P   + H ++ + N   +
Sbjct: 212 TELYLFGGQIDETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWV 271

Query: 212 FGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPTDNSAILMGGYC 270
           FGG         +  ND +C+D     W+K+ET   KP     H  +   +   + GG  
Sbjct: 272 FGG-----ETPKTISNDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG-- 324

Query: 271 KIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNLWKQNKS 329
               K+  N       ND + LNL       +W KL   K   P  R G+S  L    K 
Sbjct: 325 ----KDIHNTYS----NDVYFLNLL----SLKWFKLPCVKEGIPQERSGHSLTLMNNEKL 372

Query: 330 VAFGG 334
           V  GG
Sbjct: 373 VIMGG 377

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 67/151 (44%), Gaps = 17/151 (11%)

Query: 216 RDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHC--FIPTDNSAILMGGYCKII 273
           R++    T+  + L   +   Y W +++    P  R  H   FI T+++ I + G     
Sbjct: 50  RNISGASTNLPSPLERKNSRRYIWNRIKLKDSPFPRYRHSSSFITTNDNRIFVTG----- 104

Query: 274 AKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFG 333
                 L    +  D W++    +   +  ++++   N P PRVG++  +   N  V FG
Sbjct: 105 -----GLYDQSVYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTMCG-NAYVVFG 158

Query: 334 GVYDLQETEESLESVFYNDLYMFHLELNKWS 364
           G  D  +  ++   +  +DLY+F++   KW+
Sbjct: 159 G--DTHKLNKN--RLLDDDLYLFNINSYKWT 185

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 108/260 (41%), Gaps = 48/260 (18%)

Query: 130 VSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGG 189
           + +N P PR   A  +  +   +  GG+     ++      D +LF+    K+T  +  G
Sbjct: 134 IDQNTPPPRVGHASTICGNAYVVF-GGDTHKLNKNGLLD-DDLYLFNINSYKWTIPQPIG 191

Query: 190 RDSSPSARSGHRI--IA---WKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----W 239
           R   P  R GH+I  IA    +    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 192 R--RPLGRYGHKISIIASNPMQTKLYLFGGQVD-----ETYFNDLVVFDLSSFRRPNSHW 244

Query: 240 TKLE-TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDP 298
             LE     P   + H  +  DN   + GG                I ND ++     DP
Sbjct: 245 EFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETP-----------KTISNDTYRY----DP 289

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHL 358
            + +W K+K    +P P   ++  ++K    V  GG        +   + + ND+Y  +L
Sbjct: 290 AQSEWSKVKTTGEKPPPIQEHASVVYKHLMCV-LGG--------KDTHNAYSNDVYFLNL 340

Query: 359 ELNKWSKL-RIK---PQRQT 374
              KW KL R+K   PQ ++
Sbjct: 341 LSLKWYKLPRMKEGIPQERS 360

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 99/254 (38%), Gaps = 40/254 (15%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCAER 180
           W +   KN+P PR   SS+ +  + + I +  G    S        Y D W    +    
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 181 KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWT 240
            FT        ++P  R GH      N +++FGG     N      +DL+ F+I++YKWT
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 241 KLE-TNTKPEARSGHCFI-----PTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
             +    +P  R GH        P      L GG            +     ND    +L
Sbjct: 186 IPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQ-----------VDETYFNDLVVFDL 234

Query: 295 TPDPK-KWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353
           +   +    WE L+   + P P   ++   +  NK   FGG     ET +++     ND 
Sbjct: 235 SSFRRPNSHWEFLEPVGDLPPPLTNHTMVAY-DNKLWVFGG-----ETPKTIS----NDT 284

Query: 354 YMFHLELNKWSKLR 367
           Y +    ++WSK++
Sbjct: 285 YRYDPAQSEWSKVK 298

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 110/270 (40%), Gaps = 53/270 (19%)

Query: 96  FIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHG 155
            +FGG+ T    K     +DLY ++I +  W        P P     +  +   I+++  
Sbjct: 155 VVFGGD-THKLNKNGLLDDDLYLFNINSYKW------TIPQPIGRRPLGRYGHKISII-- 205

Query: 156 GEFSSPKQSKFY---------HYSDTWLFDCAE--RKFTKLEF-GGRDSSPSARSGHRII 203
              S+P Q+K Y         +++D  +FD +   R  +  EF       P   + H ++
Sbjct: 206 --ASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMV 263

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPTDNS 262
           A+ N   +FGG         +  ND + +D +  +W+K++T   KP     H  +   + 
Sbjct: 264 AYDNKLWVFGG-----ETPKTISNDTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYKHL 318

Query: 263 AILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSF 321
             ++GG      K+  N       ND + LNL       +W KL   K   P  R G+S 
Sbjct: 319 MCVLGG------KDTHNAYS----NDVYFLNLL----SLKWYKLPRMKEGIPQERSGHSL 364

Query: 322 NLWKQNKSVAFGG---------VYDLQETE 342
            L K  K +  GG         ++DLQ +E
Sbjct: 365 TLMKNEKLLIMGGDKTDYASPNIHDLQTSE 394

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 17/130 (13%)

Query: 237 YKW--TKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294
           Y W   KL+ +  P  R    FI T+++ I + G           L    +  D W++  
Sbjct: 71  YIWNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTG----------GLHDQSVYGDVWQIAA 120

Query: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354
             D   +  +++   +N P PRVG++  +   N  V FGG  D  +  ++   +  +DLY
Sbjct: 121 NADGTSFTSKRIDIDQNTPPPRVGHASTICG-NAYVVFGG--DTHKLNKN--GLLDDDLY 175

Query: 355 MFHLELNKWS 364
           +F++   KW+
Sbjct: 176 LFNINSYKWT 185

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 100/254 (39%), Gaps = 48/254 (18%)

Query: 126 WKKYVSKNAPLPR---SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWL---FDCAE 179
           W +   +N+P PR    ++A A   + I ++ G    S        Y DTW+   FD A 
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDA- 164

Query: 180 RKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKW 239
            KF+       +++P  R GH  +   N F++FGG     N +    +D++  ++++YKW
Sbjct: 165 TKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKW 224

Query: 240 T-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT--- 295
           T       +P  R GH        +I+     K               ND    +L+   
Sbjct: 225 TVPAPVGPRPLGRYGHKI------SIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFR 278

Query: 296 -PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349
            PD     W+ LK     P P      + Y   LW       FGG        ++L+ + 
Sbjct: 279 RPD---SHWDFLKPMTFTPPPMTNFTMISYDSKLW------VFGG--------DTLQGLI 321

Query: 350 YNDLYMFHLELNKW 363
            ND++M+    N W
Sbjct: 322 -NDVFMYDPAKNDW 334

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 80/188 (42%), Gaps = 32/188 (17%)

Query: 92  KRELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVS--------KNAPLPRSSAAV 143
           K +L++FGG+F D       ++NDL  Y +  +S+++  S           P P ++  +
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDL--SSFRRPDSHWDFLKPMTFTPPPMTNFTM 302

Query: 144 AVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRII 203
             + S + +  G              +D +++D A+  +  +E  G    P     H  +
Sbjct: 303 ISYDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTIETSGEKPPPVQE--HATV 353

Query: 204 AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEARSGHCFIPTDN 261
            + +   + GG     +   +YLN ++  ++  +KW KL       P+ RSGH      N
Sbjct: 354 VYNDLMCVVGG----KDEHDAYLNTVYFLNLKTHKWFKLPIFAAGIPQGRSGHSLTLLKN 409

Query: 262 SAIL-MGG 268
             +L MGG
Sbjct: 410 DKVLIMGG 417

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 106/267 (39%), Gaps = 49/267 (18%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLH 154
             +FGG+ T    +     +D+Y  ++ +  W        P P     +  +   I+++ 
Sbjct: 194 FVVFGGD-THKVNREGLMDDDIYLLNVNSYKW------TVPAPVGPRPLGRYGHKISIIA 246

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCAERKFTKLEFGGRDS----------SPSARSGH 200
             +     ++K Y     + DT+  D A    +   F   DS          +P   +  
Sbjct: 247 TTQM----KTKLYVFGGQFDDTYFNDLAVYDLSS--FRRPDSHWDFLKPMTFTPPPMTNF 300

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPT 259
            +I++ +   +FGG  D   G    +ND++ +D +   W  +ET+  KP     H  +  
Sbjct: 301 TMISYDSKLWVFGG--DTLQG---LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVY 355

Query: 260 DNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVG 318
           ++   ++GG  +  A           LN  + LNL    K  +W KL  F    P  R G
Sbjct: 356 NDLMCVVGGKDEHDA----------YLNTVYFLNL----KTHKWFKLPIFAAGIPQGRSG 401

Query: 319 YSFNLWKQNKSVAFGG-VYDLQETEES 344
           +S  L K +K +  GG  +D    EES
Sbjct: 402 HSLTLLKNDKVLIMGGDKFDYARAEES 428

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 51/129 (39%), Gaps = 19/129 (14%)

Query: 239 WTKLETNTKPEARSGH---CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    +    N   ++GG           L    +  D W L+  
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGG-----------LHDQSVYGDTWILSAF 161

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            D  K+    +   +  P PRVG++  L   N  V FGG  D  +     E +  +D+Y+
Sbjct: 162 DDATKFSTTTIDISEATPPPRVGHAAVLCG-NAFVVFGG--DTHKVNR--EGLMDDDIYL 216

Query: 356 FHLELNKWS 364
            ++   KW+
Sbjct: 217 LNVNSYKWT 225

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 83/206 (40%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCAER--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+        +FT       D++P  R GH      N F++FGG     N +    
Sbjct: 112 YGDTWILTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMD 171

Query: 227 NDLWCFDISNYKWT-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI 285
           +D++ F+I++YKWT       +P  R GH        +++     K              
Sbjct: 172 DDVYLFNINSYKWTIPHPVGPRPLGRYGHKI------SVIATSQMKTKLYVFGGQFDDTY 225

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   W++ K ++F   P      V Y + LW       FGG    
Sbjct: 226 FNDLCVYDLSSFRRPD-SHWEFLKPQSFVPPPLTNHTMVSYDYKLW------IFGG---- 274

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+++M+   +N W+
Sbjct: 275 -DTAQGL----INEVFMYDPTVNDWT 295

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 81/171 (47%), Gaps = 27/171 (15%)

Query: 92  KRELFIFGGEFTDPETKLTHFYNDLYSYSIK-----NNSWKKYVSKN-APLPRSSAAVAV 145
           K +L++FGG+F D       ++NDL  Y +      ++ W+    ++  P P ++  +  
Sbjct: 211 KTKLYVFGGQFDD------TYFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVS 264

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAW 205
           +   + +  GG+ +          ++ +++D     +T +E  G  S P A   H  + +
Sbjct: 265 YDYKLWIF-GGDTAQ------GLINEVFMYDPTVNDWTVVETTG--SKPPAIQEHAAVVY 315

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE--TNTKPEARSGH 254
           K+   + GG     + Q SY ND++  ++ ++KW KL    N  P+ RSGH
Sbjct: 316 KDLMCVTGG----KDEQDSYSNDVYFLNLKSFKWFKLPFFKNGVPQGRSGH 362

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 97/259 (37%), Gaps = 58/259 (22%)

Query: 126 WKKYVSKNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAER--K 181
           W +   K +P PR    A+     SG   + GG      QS    Y DTW+    +    
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHD---QSV---YGDTWIIKSLDNATS 146

Query: 182 FTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTK 241
           F  +     D++P  R GH      N F++FGG     N      +D++ F+I+++KWT 
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNINSHKWT- 205

Query: 242 LETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI-----------LNDAW 290
                          IPT      +G Y   I+    N MK K+            ND  
Sbjct: 206 ---------------IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFDDTYFNDLA 250

Query: 291 KLNLTPDPKK-WQWEKLKNFKNQPSP-----RVGYSFNLWKQNKSVAFGGVYDLQETEES 344
           + +L+   +    WE +K     P P      + +   LW       FGG     +T + 
Sbjct: 251 EFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLW------VFGG-----DTPQG 299

Query: 345 LESVFYNDLYMFHLELNKW 363
           L     N+++MF    N W
Sbjct: 300 L----TNEVFMFDPAANDW 314

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 94/200 (47%), Gaps = 34/200 (17%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSI----KNNSWKKYVSKNAPL 136
           H +        K +L++FGG+F D       ++NDL  + +    +++S  +++     +
Sbjct: 220 HKISIIAANQMKTKLYVFGGQFDD------TYFNDLAEFDLSSFRRSDSHWEFIKPATFM 273

Query: 137 PRSSAAVAVHPSGIALLH-----GGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRD 191
           P     +A H + I+  H     GG+  +P+       ++ ++FD A   +  ++  G  
Sbjct: 274 P---PPLANH-TMISFDHKLWVFGGD--TPQGLT----NEVFMFDPAANDWCVVQTTG-- 321

Query: 192 SSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET--NTKPE 249
           + P     H  I +++   +FGG     + Q +Y N ++  +  + KW KL T  N  P 
Sbjct: 322 NIPPPLQEHAAIIYRDLMCVFGG----KDAQDNYSNAVYFLNFRSLKWFKLPTFNNMIPR 377

Query: 250 ARSGHCF-IPTDNSAILMGG 268
           ARSGH   + ++N  ++MGG
Sbjct: 378 ARSGHSLTLLSNNKLLIMGG 397

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 102/257 (39%), Gaps = 50/257 (19%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLH 154
             IFGG+ T          +D+Y ++I ++ W        P P+    +  +   I+++ 
Sbjct: 174 FVIFGGD-THKVNDAGLMDDDIYLFNINSHKW------TIPTPQGPRPLGRYGHKISIIA 226

Query: 155 GGEFSSPKQSKFY----HYSDTWLFDCAERKFTKLEFGGRDSS----------PSARSGH 200
             +     ++K Y     + DT+  D AE  F    F   DS           P   + H
Sbjct: 227 ANQM----KTKLYVFGGQFDDTYFNDLAE--FDLSSFRRSDSHWEFIKPATFMPPPLANH 280

Query: 201 RIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET--NTKPEARSGHCFIP 258
            +I++ +   +FGG  D   G T   N+++ FD +   W  ++T  N  P  +     I 
Sbjct: 281 TMISFDHKLWVFGG--DTPQGLT---NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIY 335

Query: 259 TDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRV 317
            D    LM  +    A++N +       N  + LN     +  +W KL  F N  P  R 
Sbjct: 336 RD----LMCVFGGKDAQDNYS-------NAVYFLNF----RSLKWFKLPTFNNMIPRARS 380

Query: 318 GYSFNLWKQNKSVAFGG 334
           G+S  L   NK +  GG
Sbjct: 381 GHSLTLLSNNKLLIMGG 397

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 89/194 (45%), Gaps = 28/194 (14%)

Query: 83  LMFANPQHNKRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSKNAPLPR 138
           ++  NP   K  L++FGG+        T+F +    DL S+  +N+ W+ ++     +P 
Sbjct: 202 IIAYNPMQTK--LYLFGGQLDK-----TYFNDLAMFDLSSFRRRNSHWE-FLEPATTVPP 253

Query: 139 SSAAVAVHPSGIAL-LHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSAR 197
             A   +   G  L + GGE  +PK       ++T+ +D  +  ++K+E  G    P   
Sbjct: 254 PLANHTMVTYGNKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQE 307

Query: 198 SGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEARSGHC 255
             H  + +K+   +FGG         +Y ND++  D+ ++KW KL    +  P  RSGH 
Sbjct: 308 --HASVVYKHIMCVFGG----KYTHNAYSNDVYFLDLLSFKWYKLPHIKEGIPRERSGHS 361

Query: 256 FIPTDNSAIL-MGG 268
                N  IL MGG
Sbjct: 362 LTLMKNEKILIMGG 375

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 121/311 (38%), Gaps = 56/311 (18%)

Query: 75  RLSCRTHPLM--------FANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSW 126
           +++ RT PLM         A P + +R   I G   T P        + +   + K   W
Sbjct: 22  QIASRTMPLMDNSTRIVTPALPPNQQRS--ISGASTTLP--------SPIERENAKKYVW 71

Query: 127 KKYVSKNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLF--DCAERKF 182
            +   K++P PR   S++  V       + GG ++   QS    Y D W    +     F
Sbjct: 72  NRIKLKDSPFPRYRHSSSPIVSSENRIFVTGGLYN---QSV---YGDVWQITANADGTSF 125

Query: 183 TKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKL 242
           T        ++P  R GH      N +++FGG     N      +D++ F++++YKWT  
Sbjct: 126 TPKAIQIDRNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWTIP 185

Query: 243 E-TNTKPEARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTP 296
           +   ++P  R GH      + P      L GG            +     ND    +L+ 
Sbjct: 186 QPIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQ-----------LDKTYFNDLAMFDLSS 234

Query: 297 DPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
             ++   WE L+     P P   ++   +  NK   FGG     ET +++     N+ Y 
Sbjct: 235 FRRRNSHWEFLEPATTVPPPLANHTMVTYG-NKLWVFGG-----ETPKTVS----NETYC 284

Query: 356 FHLELNKWSKL 366
           +    N WSK+
Sbjct: 285 YDPIQNDWSKI 295

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 99/253 (39%), Gaps = 57/253 (22%)

Query: 130 VSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGG 189
           + +N P PR   A  +  +   +  GG+     + K     D +LF+    K+T  +  G
Sbjct: 132 IDRNTPPPRVGHASTLCGNAYVVF-GGDTHKLNEDKLLD-DDIYLFNVNSYKWTIPQPIG 189

Query: 190 RDSSPSARSGHRI--IAW---KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----W 239
             S P  R GH+I  IA+   +    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 190 --SRPLGRYGHKISIIAYNPMQTKLYLFGGQLD-----KTYFNDLAMFDLSSFRRRNSHW 242

Query: 240 TKLE-TNTKPEARSGHCFIPTDNSAILMGG----------YC------------------ 270
             LE   T P   + H  +   N   + GG          YC                  
Sbjct: 243 EFLEPATTVPPPLANHTMVTYGNKLWVFGGETPKTVSNETYCYDPIQNDWSKIETTGEIP 302

Query: 271 -------KIIAKNNKNLMKGKILNDAWKLNLT-PDPKKWQWEKLKNFKNQ-PSPRVGYSF 321
                   ++ K+   +  GK  ++A+  ++   D   ++W KL + K   P  R G+S 
Sbjct: 303 PPVQEHASVVYKHIMCVFGGKYTHNAYSNDVYFLDLLSFKWYKLPHIKEGIPRERSGHSL 362

Query: 322 NLWKQNKSVAFGG 334
            L K  K +  GG
Sbjct: 363 TLMKNEKILIMGG 375

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 101/252 (40%), Gaps = 45/252 (17%)

Query: 130 VSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGG 189
           + +N P PR   A  +  +   +  GG+      ++     D +LF+    K+T  +  G
Sbjct: 134 IGQNTPPPRVGHASTICGNAYVVF-GGDTHKLNMNRLLD-DDLYLFNINSYKWTIPQPVG 191

Query: 190 RDSSPSARSGHRIIAWKN-----YFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----W 239
             + P  R GH+I    N        LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 192 --TRPLGRYGHKISIIANNPMQTKLFLFGGQID-----ETYFNDLAMFDLSSFRRPNSHW 244

Query: 240 TKLE-TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDP 298
             L+  +  P   + H  +  DN   + GG               K  N         DP
Sbjct: 245 VFLKPVSIVPPPLTNHTMVTFDNKLWVFGG---------------KTPNTLSNETFCYDP 289

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHL 358
            +  W K++    +P P V    ++  ++    FGG        + +++ + ND+Y  +L
Sbjct: 290 VQNDWSKIQTTGERP-PAVQEHASVVYKHLMCIFGG--------KDIQNAYSNDVYFLNL 340

Query: 359 ELNKWSKL-RIK 369
              KW KL RIK
Sbjct: 341 ITFKWYKLPRIK 352

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 92/195 (47%), Gaps = 30/195 (15%)

Query: 83  LMFANPQHNKRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWK--KYVSKNAPL 136
           ++  NP   K  LF+FGG+  +     T+F +    DL S+   N+ W   K VS   P 
Sbjct: 204 IIANNPMQTK--LFLFGGQIDE-----TYFNDLAMFDLSSFRRPNSHWVFLKPVSI-VPP 255

Query: 137 PRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSA 196
           P ++  +    + + +  G       ++     ++T+ +D  +  ++K++  G    P A
Sbjct: 256 PLTNHTMVTFDNKLWVFGG-------KTPNTLSNETFCYDPVQNDWSKIQTTGE--RPPA 306

Query: 197 RSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEARSGH 254
              H  + +K+   +FGG +D+   Q +Y ND++  ++  +KW KL    +  P+ RSGH
Sbjct: 307 VQEHASVVYKHLMCIFGG-KDI---QNAYSNDVYFLNLITFKWYKLPRIKEGLPKERSGH 362

Query: 255 CFIPTDNSA-ILMGG 268
                 N   ++MGG
Sbjct: 363 SLTLIKNDKLVIMGG 377

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 81/206 (39%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCAER--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+    E   KFT       +++P  R GH      N F++FGG     N +    
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMD 256

Query: 227 NDLWCFDISNYKWT-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI 285
           +D++  +I+++KWT       +P  R GH        +I+     K              
Sbjct: 257 DDVYLLNINSHKWTIPRPVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDTY 310

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   WQ+ K  +F   P      V Y + LW       FGG    
Sbjct: 311 FNDLAVYDLSSFRRPD-SHWQFLKPVSFVPPPLTNHTMVSYDYKLW------VFGG---- 359

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+L+M+    N WS
Sbjct: 360 -DTPQGL----INELFMYDPTTNDWS 380

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 67/143 (46%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET-NTKPEARS 252
           P   + H ++++     +FGG    G      +N+L+ +D +   W+ ++T   KP    
Sbjct: 339 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFMYDPTTNDWSVVDTTGVKPPPLQ 393

Query: 253 GHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKN- 311
            H  +   +   ++GG      K++++    ++    + LNL    K ++W KL +F++ 
Sbjct: 394 EHAALLYKDLMCIVGG------KDDQDNYSQEV----YFLNL----KSFRWFKLPHFRSL 439

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 440 VPSPRSGHSVTLLSNKKLLIMGG 462

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 239 WTKLETNTKPEARSGHC---FIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    +    N   ++GG           L    +  D W +   
Sbjct: 158 WNRVKLLQSPFPRYRHVASSYASDSNEVFVIGG-----------LHDQSVYGDTWIIKSH 206

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            +  K+  + ++  +  P PRVG++  L   N  V FGG  D  +T  + E +  +D+Y+
Sbjct: 207 ENGNKFTSKTVEITETTPPPRVGHASTLCG-NAFVIFGG--DTHKT--NAEGLMDDDVYL 261

Query: 356 FHLELNKWSKLR 367
            ++  +KW+  R
Sbjct: 262 LNINSHKWTIPR 273

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 99/255 (38%), Gaps = 49/255 (19%)

Query: 126 WKKYVSKNAPLPRSSAAVAVHPS--GIALLHGGEFSSPKQSKFYHYSDTWLFDCAERK-F 182
           W ++    +P PR     + H S      + GG     +QS    Y D W  +  + K F
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGLR---EQSV---YGDVWSINHKDDKSF 90

Query: 183 TKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKL 242
           +        ++P  R GH      N  ILFGG     N      +DL+ F++++YKWT  
Sbjct: 91  SASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIP 150

Query: 243 E-TNTKPEARSGH-----CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT- 295
           E    +P  R GH        PT     L GG                  ND    +L+ 
Sbjct: 151 EPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQ-----------FDDTYFNDLSMFDLST 199

Query: 296 ---PDPKKWQWEKLKNFKNQPSPR---VGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349
              PD  +W++ K K+F   P      + Y   LW       FGG        E+L+ + 
Sbjct: 200 FRKPD-AQWEFIKPKSFFPPPVSNHTMISYDNKLW------VFGG--------ETLQGLI 244

Query: 350 YNDLYMFHLELNKWS 364
            N+++++   +N WS
Sbjct: 245 -NEVFVYDPIVNDWS 258

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 90/198 (45%), Gaps = 30/198 (15%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSI----KNNSWKKYVSKNA-- 134
           H +     Q  K +LF+FGG+F D       ++NDL  + +    K ++  +++   +  
Sbjct: 163 HKISIIATQPTKTKLFLFGGQFDD------TYFNDLSMFDLSTFRKPDAQWEFIKPKSFF 216

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSP 194
           P P S+  +  + + + +  G              ++ +++D     ++ +E  G  SSP
Sbjct: 217 PPPVSNHTMISYDNKLWVFGGETLQG-------LINEVFVYDPIVNDWSVIETTG--SSP 267

Query: 195 SARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKP---EAR 251
                H  + +KN   + GG     + + +Y+N ++  +++  KW KL  +  P   + R
Sbjct: 268 PPIQEHAAVVYKNLMCVVGG----KDSKDNYMNSVYFLNLNTLKWFKL-PHINPGIMQGR 322

Query: 252 SGH-CFIPTDNSAILMGG 268
           SGH   +  D+S +++ G
Sbjct: 323 SGHTATLLNDDSILILSG 340

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 99/259 (38%), Gaps = 54/259 (20%)

Query: 126 WKKYVSKNAPLPRSSAAVAVHPS--GIALLHGGEFSSPKQSKFYHYSDTWLFDCAER--- 180
           W +    N+P PR     + H +  G   + GG      QS    Y DTW+   ++    
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHD---QSV---YGDTWILTASDIDKT 200

Query: 181 ------KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDI 234
                 K T +E    +S+P  R GH      N F++FGG     N      +DL+  +I
Sbjct: 201 GAINSFKSTTIEI--TESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNI 258

Query: 235 SNYKWT-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293
           ++YKWT       +P  R GH  +              I A+  K  + G   +D +  +
Sbjct: 259 NSYKWTIPKPVGQRPLGRYGHKIV-------------TISAEQTKLYLFGGQFDDTYFGD 305

Query: 294 LT---------PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEES 344
           L          PD   W + K   F   P P   ++   + Q+K   FGG        ++
Sbjct: 306 LAVFDLSSFRRPD-SHWVFLKPSGF--NPPPLTNHTMVTY-QDKIWVFGG--------DT 353

Query: 345 LESVFYNDLYMFHLELNKW 363
           LE    N +Y++    N W
Sbjct: 354 LEEGLINRVYLYSPTNNSW 372

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 78/183 (42%), Gaps = 27/183 (14%)

Query: 95  LFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWK--KYVSKNAPLPRSSAAVAVHPS 148
           L++FGG+F D     T+F +    DL S+   ++ W   K    N P P ++  +  +  
Sbjct: 291 LYLFGGQFDD-----TYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPP-PLTNHTMVTYQD 344

Query: 149 GIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNY 208
            I +  G        ++ Y YS T         +  +E  G    P     H  I +K+ 
Sbjct: 345 KIWVFGGDTLEEGLINRVYLYSPT------NNSWEIVETTG--DIPPPMQEHAAIVYKDL 396

Query: 209 FILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE--TNTKPEARSGHCFIPTDNSAIL- 265
             + GG     + + +YLN L+  ++ + KW KL    N  P+ RSGH      N  IL 
Sbjct: 397 MCVVGG----KDAEDNYLNTLYFLNLQSLKWFKLPFYKNNIPQGRSGHSVTLLKNDQILI 452

Query: 266 MGG 268
           MGG
Sbjct: 453 MGG 455

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 89/212 (41%), Gaps = 38/212 (17%)

Query: 160 SPKQSKFY----HYSDTWLFDCAERKFTKLEFGGRDS----------SPSARSGHRIIAW 205
           S +Q+K Y     + DT+  D A   F    F   DS          +P   + H ++ +
Sbjct: 285 SAEQTKLYLFGGQFDDTYFGDLA--VFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTY 342

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK-PEARSGHCFIPTDNSAI 264
           ++   +FGG       +   +N ++ +  +N  W  +ET    P     H  I   +   
Sbjct: 343 QDKIWVFGG----DTLEEGLINRVYLYSPTNNSWEIVETTGDIPPPMQEHAAIVYKDLMC 398

Query: 265 LMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ-PSPRVGYSFNL 323
           ++GG     A++N        LN  + LNL    +  +W KL  +KN  P  R G+S  L
Sbjct: 399 VVGGKD---AEDN-------YLNTLYFLNL----QSLKWFKLPFYKNNIPQGRSGHSVTL 444

Query: 324 WKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            K ++ +  GG  D  +   S E++  +D+ M
Sbjct: 445 LKNDQILIMGG--DKYDYSSSTENMHISDVDM 474

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 98/246 (39%), Gaps = 41/246 (16%)

Query: 130 VSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGG 189
           ++++ P PR   A  +   G A +  G  +    S      D +L +    K+T  +  G
Sbjct: 213 ITESTPPPRVGHASTL--CGNAFVVFGGDTHKVNSDGLMDDDLYLLNINSYKWTIPKPVG 270

Query: 190 RDSSPSARSGHRII---AWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----WTK 241
           +   P  R GH+I+   A +    LFGG  D      +Y  DL  FD+S+++     W  
Sbjct: 271 Q--RPLGRYGHKIVTISAEQTKLYLFGGQFD-----DTYFGDLAVFDLSSFRRPDSHWVF 323

Query: 242 LE-TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKK 300
           L+ +   P   + H  +   +   + GG          + ++  ++N  +  +    P  
Sbjct: 324 LKPSGFNPPPLTNHTMVTYQDKIWVFGG----------DTLEEGLINRVYLYS----PTN 369

Query: 301 WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLEL 360
             WE ++   + P P   ++  ++K    V  G         +  E  + N LY  +L+ 
Sbjct: 370 NSWEIVETTGDIPPPMQEHAAIVYKDLMCVVGG---------KDAEDNYLNTLYFLNLQS 420

Query: 361 NKWSKL 366
            KW KL
Sbjct: 421 LKWFKL 426

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 83/218 (38%), Gaps = 56/218 (25%)

Query: 169 YSDTWLFDCAER--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+    +   +F        +++P  R GH      N F+LFGG     N +    
Sbjct: 180 YGDTWIISTNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMD 239

Query: 227 NDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI- 285
           +DL+ F++++YKWT                IP       +G Y   I+    N MK K+ 
Sbjct: 240 DDLYLFNVNSYKWT----------------IPHPIGPRPLGRYGHKISIMAANQMKTKLY 283

Query: 286 ----------LNDAWKLNLT----PDPKKWQWEKLKNFKNQPSP-----RVGYSFNLWKQ 326
                      ND    +L+    PD     WE LK     P P      + Y  +LW  
Sbjct: 284 LFGGQFDDTYFNDLAVFDLSSFRRPD---SHWEFLKPTTFSPPPLTNHTMISYDNHLW-- 338

Query: 327 NKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWS 364
                FGG        ++L+ +  N ++ + +  N WS
Sbjct: 339 ----VFGG--------DTLQGLI-NQVFKYDVANNDWS 363

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 86/194 (44%), Gaps = 28/194 (14%)

Query: 83  LMFANPQHNKRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSKN-APLP 137
           +M AN    K +L++FGG+F D     T+F +    DL S+   ++ W+       +P P
Sbjct: 272 IMAAN--QMKTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPP 324

Query: 138 RSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSAR 197
            ++  +  + + + +  G              +  + +D A   ++  E  G  + P   
Sbjct: 325 LTNHTMISYDNHLWVFGGDTLQG-------LINQVFKYDVANNDWSIAETTG--TKPPPM 375

Query: 198 SGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET--NTKPEARSGHC 255
             H  + +K+  ++ GG  +      +YLN ++  ++  ++W KL T     P+ RSGH 
Sbjct: 376 QEHAAVVYKHVMVVVGGKDE----HDTYLNSVYFLNLKTHEWFKLPTFKAGIPQGRSGHS 431

Query: 256 FIPTDNSAIL-MGG 268
               +N  +L MGG
Sbjct: 432 LTLLNNDKLLIMGG 445

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 64/149 (42%), Gaps = 17/149 (11%)

Query: 113 YNDLYSYSIKNNSWKKYVSKNAPLPR--SSAAVAVHPSGIALLHGGEFSSPKQSKFYHYS 170
           Y+ L+  +I    W +   +N+P PR    A+  V   G   + GG      QS    Y 
Sbjct: 151 YHKLHPTTI----WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHD---QSV---YG 200

Query: 171 DTWLF----DCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           DTW+     +      T       +++P  R GH      N F++FGG     N   S  
Sbjct: 201 DTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD 260

Query: 227 NDLWCFDISNYKWT-KLETNTKPEARSGH 254
           +D++ F+I++YKWT       +P  R GH
Sbjct: 261 DDIYLFNINSYKWTIPKPVGQRPLGRYGH 289

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 90/215 (41%), Gaps = 36/215 (16%)

Query: 92  KRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSKN-APLPRSSAAVAVH 146
           K +L++FGG+F D     T+F +    DL S+   ++ W+    K+  P P ++  +  +
Sbjct: 300 KTKLYLFGGQFDD-----TYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSY 354

Query: 147 PSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSS----PSARSGHRI 202
              + +  G          F       ++D  +  +  +E    ++     P     H  
Sbjct: 355 DHKLWVFGGDTLQGLTNQVF-------MYDPVDNDWCVVETFANNNDVSNIPPPIQEHAA 407

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE--TNTKPEARSGHCFIPTD 260
           + +K+   + GG  +  N    YLND++  ++   KW KL       P+ RSGH      
Sbjct: 408 VLYKDLMCVIGGKDESDN----YLNDVYFLNLKTLKWFKLPFYKEGVPQGRSGHSVTLLK 463

Query: 261 NSAIL-MGG----YCKIIA----KNNKNLMKGKIL 286
           N  IL MGG    Y  I +     ++ N+ KG IL
Sbjct: 464 NDKILIMGGDKFDYANIDSFDFHTSDTNMGKGTIL 498

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 99/263 (37%), Gaps = 71/263 (26%)

Query: 130 VSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGG 189
           +S+N P PR   A  +  +   +  G      K        D +LF+    K+T  +  G
Sbjct: 223 ISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMD--DDIYLFNINSYKWTIPKPVG 280

Query: 190 RDSSPSARSGHRI--IA---WKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYK-----W 239
           +   P  R GH+I  IA    K    LFGG  D      +Y NDL  FD+S+++     W
Sbjct: 281 Q--RPLGRYGHKISIIATSQMKTKLYLFGGQFD-----DTYFNDLVVFDLSSFRRPDSHW 333

Query: 240 TKLETNT-KPEARSGHCFIPTDNSAILMGG-------------------YCKI--IAKNN 277
             +   +  P   + H     D+   + GG                   +C +   A NN
Sbjct: 334 EFIRPKSFIPPPLTNHTMCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDWCVVETFANNN 393

Query: 278 -----------------KNLM---KGK-----ILNDAWKLNLTPDPKKWQWEKLKNFKNQ 312
                            K+LM    GK      LND + LNL    K  +W KL  +K  
Sbjct: 394 DVSNIPPPIQEHAAVLYKDLMCVIGGKDESDNYLNDVYFLNL----KTLKWFKLPFYKEG 449

Query: 313 -PSPRVGYSFNLWKQNKSVAFGG 334
            P  R G+S  L K +K +  GG
Sbjct: 450 VPQGRSGHSVTLLKNDKILIMGG 472

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 83/216 (38%), Gaps = 52/216 (24%)

Query: 169 YSDTWLF--DCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+   D +  +F+       + +P  R GH      N F++FGG     N +    
Sbjct: 133 YGDTWIINVDDSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMD 192

Query: 227 NDLWCFDISNYKWT-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI 285
           +DL+ F+I+++KWT       +P  R GH                 IIA N    MK K+
Sbjct: 193 DDLYLFNINSFKWTIPHPVGPRPLGRYGHKI--------------SIIATNQ---MKTKL 235

Query: 286 -----------LNDAWKLNLTP---DPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNK 328
                       ND    +L+        W++ K K F   P      V Y   LW    
Sbjct: 236 YLFGGQFDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLW---- 291

Query: 329 SVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWS 364
              FGG     +T + L     N ++++ +  N WS
Sbjct: 292 --IFGG-----DTMQGL----INKVFVYDIMSNDWS 316

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 102/263 (38%), Gaps = 62/263 (23%)

Query: 95  LFIFGGEFTDPETKLTHFYN-------DLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHP 147
             IFGG+        TH  N       DLY ++I +  W        P P     +  + 
Sbjct: 175 FVIFGGD--------THKVNSEGLMDDDLYLFNINSFKW------TIPHPVGPRPLGRYG 220

Query: 148 SGIALLHGGEFSSPKQSKFY----HYSDTWLFDCAERKFTKLEFGGRDSS---------- 193
             I+++   +     ++K Y     + DT+  D A    +   F   DS           
Sbjct: 221 HKISIIATNQM----KTKLYLFGGQFDDTFFNDLAVYDLSS--FRRSDSHWEFLKPKTFV 274

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARS 252
           P   + H ++++ +   +FGG  D   G    +N ++ +DI +  W+ +ET   +P    
Sbjct: 275 PPPLANHTMVSYDHKLWIFGG--DTMQG---LINKVFVYDIMSNDWSLVETTGARPPPLQ 329

Query: 253 GHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-N 311
            H  +      I     C +  K+ +++     LN  + LNL    K  +W K   FK  
Sbjct: 330 EHAAL------IYKDLMCVVGGKDEQDIY----LNSIYFLNL----KSCRWFKFPVFKAG 375

Query: 312 QPSPRVGYSFNLWKQNKSVAFGG 334
            P  R G+S  L K NK +  GG
Sbjct: 376 IPQGRSGHSITLLKNNKILIMGG 398

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 28/197 (14%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSI-----KNNSWKKYVSKN-A 134
           H +        K +L++FGG+F D       F+NDL  Y +      ++ W+    K   
Sbjct: 221 HKISIIATNQMKTKLYLFGGQFDD------TFFNDLAVYDLSSFRRSDSHWEFLKPKTFV 274

Query: 135 PLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSP 194
           P P ++  +  +   + +  G              +  +++D     ++ +E  G  + P
Sbjct: 275 PPPLANHTMVSYDHKLWIFGGDTMQG-------LINKVFVYDIMSNDWSLVETTG--ARP 325

Query: 195 SARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTK--PEARS 252
                H  + +K+   + GG     + Q  YLN ++  ++ + +W K        P+ RS
Sbjct: 326 PPLQEHAALIYKDLMCVVGG----KDEQDIYLNSIYFLNLKSCRWFKFPVFKAGIPQGRS 381

Query: 253 GHCFIPTDNSAIL-MGG 268
           GH      N+ IL MGG
Sbjct: 382 GHSITLLKNNKILIMGG 398

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 19/129 (14%)

Query: 239 WTKLETNTKPEARSGHC---FIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    ++  DN   ++GG           L    +  D W +N+ 
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGG-----------LHDESVYGDTWIINVD 142

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
               ++  + +   +  P PRVG++  L   N  V FGG  D  +     E +  +DLY+
Sbjct: 143 DSGTQFSSKTVDISEFTPPPRVGHAATLCG-NAFVIFGG--DTHKVNS--EGLMDDDLYL 197

Query: 356 FHLELNKWS 364
           F++   KW+
Sbjct: 198 FNINSFKWT 206

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 82/206 (39%), Gaps = 32/206 (15%)

Query: 169 YSDTWLFDCAE--RKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL 226
           Y DTW+    +  ++F+       +++P  R GH      N F++FGG     N +    
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD 150

Query: 227 NDLWCFDISNYKWT-KLETNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKI 285
           +D++  +++++KWT       +P  R GH        +I+     K              
Sbjct: 151 DDVYLLNVNSHKWTIPHPVGPRPLGRYGHKI------SIIATSQMKTKLYVFGGQFDDTY 204

Query: 286 LNDAWKLNLT----PDPKKWQWEKLKNFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDL 338
            ND    +L+    PD   W + K  +F   P      V Y + LW       FGG    
Sbjct: 205 FNDLAVYDLSSFRRPD-SHWVFVKPASFVPPPLTNHTMVSYDYKLW------VFGG---- 253

Query: 339 QETEESLESVFYNDLYMFHLELNKWS 364
            +T + L     N+L+++   +N WS
Sbjct: 254 -DTPQGL----INELFVYDPVVNDWS 274

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 21/143 (14%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET-NTKPEARS 252
           P   + H ++++     +FGG    G      +N+L+ +D     W+ +ET   KP    
Sbjct: 233 PPPLTNHTMVSYDYKLWVFGGDTPQG-----LINELFVYDPVVNDWSVVETTGAKPPPLQ 287

Query: 253 GHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQ 312
            H  +      +     C +  K++++        D + +N+    K ++W KL +F++ 
Sbjct: 288 EHAAV------LYRDLMCVVGGKDDQD----NYSQDVYFMNM----KTFRWFKLPHFQDM 333

Query: 313 -PSPRVGYSFNLWKQNKSVAFGG 334
            PSPR G+S  L    K +  GG
Sbjct: 334 VPSPRSGHSVTLLANRKLLIMGG 356

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 19/129 (14%)

Query: 239 WTKLETNTKPEARSGH---CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT 295
           W +++    P  R  H    +    N  I++GG           L    +  D W L   
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGG-----------LHDQSVYGDTWILRAQ 100

Query: 296 PDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYM 355
            + K++    ++  +  P PRVG++  L   N  V FGG  D  +T    E +  +D+Y+
Sbjct: 101 DNGKQFSARTIEITETTPPPRVGHAATLCG-NAFVIFGG--DTHKTNN--EGLMDDDVYL 155

Query: 356 FHLELNKWS 364
            ++  +KW+
Sbjct: 156 LNVNSHKWT 164

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 95/260 (36%), Gaps = 48/260 (18%)

Query: 126 WKKYVSKNAPLPRSSAAVAVHPSG------IALLHGGEFSSPKQSKFYHYSDTWLFDCAE 179
           W +    N+P PR     + + S       I  LH              Y DTW      
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV----------YGDTWSITSTN 191

Query: 180 R--KFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237
              +F        D SP  R GH      N F++FGG     N      +D++ F+I+++
Sbjct: 192 NGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSH 251

Query: 238 KWT-KLETNTKPEARSGH--CFIPTDNSAI---LMGGYCKIIAKNNKNLMKGKILNDAWK 291
           KWT       +P  R GH    I T +S     L GG                  ND   
Sbjct: 252 KWTIPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ-----------FDDTYFNDIAV 300

Query: 292 LNLTPDPKK-WQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350
            +L+   +    WE +K     P P   ++   +  NK   FGG     +T++ L     
Sbjct: 301 FDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTY-DNKLWVFGG-----DTKDGL----I 350

Query: 351 NDLYMFHL--ELNKWSKLRI 368
           ND+Y F     +N W+K+ +
Sbjct: 351 NDIYAFDPADSINTWTKIDV 370

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 86/198 (43%), Gaps = 28/198 (14%)

Query: 81  HPLMFANPQHNKRELFIFGGEFTDPETKLTHFYN----DLYSYSIKNNSWKKYVSKN-AP 135
           H +       +K +L++FGG+F D     T+F +    DL S+   ++ W+    K   P
Sbjct: 269 HKISIIATSSSKTKLYLFGGQFDD-----TYFNDIAVFDLSSFRRADSHWEFIKPKGLIP 323

Query: 136 LPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAE--RKFTKLEFGGRDSS 193
            P ++  +  + + + +  GG+      +K    +D + FD A+    +TK++  G    
Sbjct: 324 PPMTNHTMVTYDNKLWVF-GGD------TKDGLINDIYAFDPADSINTWTKIDVTG--DI 374

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLET--NTKPEAR 251
           P     H  + + N   + GG     +    YLN +  F+    KW K     +   + R
Sbjct: 375 PCPVQEHSALIYDNLMCVIGG----KDENDMYLNSVHFFNFDKLKWFKFPIFKSGIMQGR 430

Query: 252 SGHCFIPTDNSAIL-MGG 268
           SGH     +N+ IL MGG
Sbjct: 431 SGHSISLLNNNKILIMGG 448

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 108/254 (42%), Gaps = 44/254 (17%)

Query: 95  LFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKNA---PLPRSSAAVAVHPSGIA 151
             IFGG+ T    K     +D+Y ++I  NS+K  + +     PL R    +++  +   
Sbjct: 155 FVIFGGD-THKTNKDGLMDDDIYLFNI--NSYKWTIPQPVGPRPLGRYGHKISIIATSQM 211

Query: 152 ----LLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLE-----FGGRDSSPSARSGHRI 202
                + GG+F         +++D  ++D +   F K E        +   P   + H +
Sbjct: 212 KTKLYVFGGQFDD------SYFNDLCVYDLSS--FRKPESHWEFLKPKSFIPPPLTNHTM 263

Query: 203 IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN-TKPEARSGHCFIPTDN 261
           +++     +FGG     + Q   +N L+ FD     W  +ET   KP     H  +  ++
Sbjct: 264 VSYDYKLWVFGG-----DTQQGLINQLFMFDPVINDWRVVETTGEKPPPVQEHAAVMFND 318

Query: 262 SAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK-NQPSPRVGYS 320
              +MGG      K+ +++     LN  + LNL    K  +W K  ++K N P  R G+S
Sbjct: 319 LMCIMGG------KDEQDVY----LNSVYFLNL----KSLKWFKFNDYKLNIPQGRSGHS 364

Query: 321 FNLWKQNKSVAFGG 334
             L K N+ +  GG
Sbjct: 365 ITLLKNNRLLIMGG 378

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 72/179 (40%), Gaps = 30/179 (16%)

Query: 193 SPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE-TNTKPEAR 251
           +P  R GH      N F++FGG     N      +D++ F+I++YKWT  +    +P  R
Sbjct: 139 TPPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQPVGPRPLGR 198

Query: 252 SGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLT----PDPKKWQWEKLK 307
            GH        +I+     K               ND    +L+    P+   W++ K K
Sbjct: 199 YGHKI------SIIATSQMKTKLYVFGGQFDDSYFNDLCVYDLSSFRKPE-SHWEFLKPK 251

Query: 308 NFKNQP---SPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKW 363
           +F   P      V Y + LW       FGG     +T++ L     N L+MF   +N W
Sbjct: 252 SFIPPPLTNHTMVSYDYKLW------VFGG-----DTQQGL----INQLFMFDPVINDW 295

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 92/212 (43%), Gaps = 36/212 (16%)

Query: 92  KRELFIFGGEFTDPETKLTHFYNDLYSYSIKN-----NSWKKYVSKN-APLPRSSAAVAV 145
           K +L++FGG+F D       ++NDL  Y + +     + W+    K+  P P ++  +  
Sbjct: 212 KTKLYVFGGQFDD------SYFNDLCVYDLSSFRKPESHWEFLKPKSFIPPPLTNHTMVS 265

Query: 146 HPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAW 205
           +   + +  GG+      ++ +      +FD     +  +E  G    P     H  + +
Sbjct: 266 YDYKLWVF-GGDTQQGLINQLF------MFDPVINDWRVVETTGEKPPPVQE--HAAVMF 316

Query: 206 KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETN--TKPEARSGHCF-IPTDNS 262
            +   + GG     + Q  YLN ++  ++ + KW K        P+ RSGH   +  +N 
Sbjct: 317 NDLMCIMGG----KDEQDVYLNSVYFLNLKSLKWFKFNDYKLNIPQGRSGHSITLLKNNR 372

Query: 263 AILMGG----YCKI----IAKNNKNLMKGKIL 286
            ++MGG    Y ++    +  ++ ++ KG IL
Sbjct: 373 LLIMGGDKFDYARLDESDLQTSDVDMGKGTIL 404

>SAKL0C13530g Chr3 complement(1192946..1195039) [2094 bp, 697 aa]
           {ON} similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 697

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 22/112 (19%)

Query: 240 TKLETNTKPEARSGHCFIPTD-NSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDP 298
           + ++++  P+ R  H F   D N+ IL GG     A N       K L D W L      
Sbjct: 423 SAIDSSRIPQERMCHTFTYVDDNTCILAGGRT---APN-------KTLEDVWILTRKQSE 472

Query: 299 KKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGG--------VYDLQETE 342
             W+W++  N    P PR  +S  L  +++ + +GG        VYD+++ E
Sbjct: 473 GAWEWQQGLNL---PDPRFRHSACLLNEHQLLIYGGKTRGSTFLVYDMRKNE 521

>YOL141W Chr15 (56452..58539) [2088 bp, 695 aa] {ON}
           PPM2AdoMet-dependent tRNA methyltransferase also
           involved in methoxycarbonylation; required for the
           synthesis of wybutosine (yW), a modified guanosine found
           at the 3'-position adjacent to the anticodon of
           phe-tRNA; similarity to Ppm1p
          Length = 695

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 194 PSARSGHRI--IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEAR 251
           P AR  H    I+  N  +L GG +    G    L+D W FD+   +W+ +++ +    R
Sbjct: 437 PVARMCHTFTTISRNNQLLLIGGRKAPHQG----LSDNWIFDMKTREWSMIKSLSHTRFR 492

Query: 252 SGHCFIPTDNSAILMGG 268
              C +P D + +++GG
Sbjct: 493 HSACSLP-DGNVLILGG 508

>Smik_15.13 Chr15 (24574..26733) [2160 bp, 719 aa] {ON} YOL141W
           (REAL)
          Length = 719

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 194 PSARSGHRI--IAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEAR 251
           P AR  H    +   +  +L GG +    G    L D W FDI   +W+ +++ +    R
Sbjct: 437 PDARMCHTFTTLCSNDQLLLVGGRKAPHQG----LCDNWIFDIKKREWSMIQSLSHTRFR 492

Query: 252 SGHCFIPTDNSAILMGG 268
              C +P D + ++MGG
Sbjct: 493 HSACNLP-DGNVLIMGG 508

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 16/94 (17%)

Query: 255 CFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEK--------- 305
            FIPT  S+ +     K + + N+   +G      + +N+ P+ +K + EK         
Sbjct: 281 MFIPTSTSSKIHQKLSKAVVRKNQRQNQGP---GTYIINMDPEVEKRELEKKQSQILRDR 337

Query: 306 ----LKNFKNQPSPRVGYSFNLWKQNKSVAFGGV 335
               LK  + Q SP VG+     KQ+   A+G  
Sbjct: 338 RKRQLKEKEKQESPDVGFETAFRKQSSPTAYGAT 371

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 209 FILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARS-----------GHCFI 257
            +L GG  D     T+   D+W FD+  ++WTK+ T  KP+ +            GH  +
Sbjct: 696 IVLHGGSDD-----TNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMM 750

Query: 258 PTDNSAILMGG 268
            +   A+ +GG
Sbjct: 751 TSGCMAVCVGG 761

>ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL056W
           (KRH1) and YOR371C (KRH2)
          Length = 784

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 13/72 (18%)

Query: 151 ALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSARS-------GHRII 203
            ++HGG   S        Y D W FD A+ +++++    RD     R        GH I 
Sbjct: 611 VIIHGGSDGS------RVYGDMWWFDLADERWSRIALYSRDPDSGERRPIGLPAVGHSIF 664

Query: 204 AWKNYFILFGGF 215
             ++ F+L+GG 
Sbjct: 665 HSRDEFLLYGGL 676

>TBLA0D02120 Chr4 (535081..539520) [4440 bp, 1479 aa] {ON} Anc_8.157
           YGL197W
          Length = 1479

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 78/200 (39%), Gaps = 33/200 (16%)

Query: 93  RELFIFGGEFTDP----ETKLTHFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPS 148
           R  F   G  T P    E  L   Y +L  Y     S KK   KN+   R+++    + S
Sbjct: 53  RSNFFVNGGLTIPLNLKEYTLKQIYQELIRYF----SIKKTAEKNS---RANSNKRKNSS 105

Query: 149 GIALLHGGEFSS----PKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSSPSA------RS 198
            I L    ++ +    P     Y  S+T+  D  ER + ++     ++S +       R 
Sbjct: 106 TIQLYQDDDYYNIDIIPDLHS-YISSETFNLDLVERTWVRVSTTVVNNSENTGPFFKPRI 164

Query: 199 GHRIIAWKNYFILFGGFRDLGNGQTSYL---NDLWCFDISNYKWTKLETNTKPEARSGHC 255
            H I     Y  LFGG   + +G    L   N+LW  ++   KW+ +  ++   AR  H 
Sbjct: 165 LHTICYTNAYLYLFGGLT-ISDGDPKILVPSNELWKLNLQTKKWSLVAKDSNIPARFSHT 223

Query: 256 FI-------PTDNSAILMGG 268
            +         D   +++GG
Sbjct: 224 MVVKYEDDDSHDTKLVIIGG 243

>Smik_1.9 Chr1 (22221..24845) [2625 bp, 874 aa] {ON} YAL056W (REAL)
          Length = 874

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 210 ILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNSAILM 266
           I+FGG+R  G+ +   +NDLW          K+E       + G+C      +AILM
Sbjct: 500 IIFGGYRQTGDDRYEAMNDLW----------KIEIPVTRRGKKGYCKFSETANAILM 546

>Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W
           (REAL)
          Length = 708

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 194 PSARSGHRIIAW--KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEAR 251
           P AR  H + ++   +  +L GG +    G    L+D W FD    +W+ ++  +    R
Sbjct: 450 PLARMCHTLTSFCGSSQLLLVGGRKAPHQG----LSDNWIFDTKTNEWSMVQKLSHTRFR 505

Query: 252 SGHCFIPTDNSAILMGGYCK 271
              C + +DNS ++ GG  K
Sbjct: 506 HSACNL-SDNSVLIFGGVTK 524

>Suva_1.10 Chr1 (16429..19107) [2679 bp, 892 aa] {ON} YAL056W (REAL)
          Length = 892

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 10/58 (17%)

Query: 209 FILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNSAILM 266
            I+FGG+R  G+ +   +NDLW          K+E       + G+C      +AILM
Sbjct: 510 IIIFGGYRQTGDDRYEAMNDLW----------KIEIPVIRRGKKGYCKFSETANAILM 557

>Skud_15.13 Chr15 (21709..23796) [2088 bp, 695 aa] {ON} YOL141W
           (REAL)
          Length = 695

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 189 GRDSSPSARSGHRIIAW--KNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNT 246
           G    P AR  H + A       +L GG +    G    L+D W FD    +W+ +++  
Sbjct: 432 GSSELPVARMCHTLTALYGNEQLLLIGGRKAPHQG----LSDNWIFDTKKREWSMIQSLP 487

Query: 247 KPEARSGHCFIPTDNSAILMG 267
               R   C +  DN  IL G
Sbjct: 488 HTRFRHSACNLSDDNVLILGG 508

>SAKL0D14740g Chr4 complement(1212855..1215377) [2523 bp, 840 aa]
           {ON} similar to gnl|GLV|KLLA0F00374g Kluyveromyces
           lactis KLLA0F00374g and weakly similar to YOR371C
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 840

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 36/90 (40%), Gaps = 16/90 (17%)

Query: 219 GNGQTSYLNDLWCFDISNYKWTKLETNTKPEARS----------GHCFIPTDNSAILMGG 268
           G+ +     D+W FD+    WT ++T  + E             GH  I    +A+ +GG
Sbjct: 668 GSDKDHVYGDMWWFDLDTETWTHVDTYCQEEKDGGFIPIEFTLVGHTLIQLGKNAVCIGG 727

Query: 269 YCK------IIAKNNKNLMKGKILNDAWKL 292
             +      +  KN KN  KG   N   KL
Sbjct: 728 LSQEDVNDFLGVKNKKNESKGAFNNSGSKL 757

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 219 GNGQTSYLNDLWCFDISNYKWTKLETNTKPEARS---------GHCFIPTDNSAILMGG 268
           G+ +T    D+W +DI    W+++ T+ K EA           GH  +     A+ +GG
Sbjct: 676 GSNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVGGMAVFVGG 734

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 28/110 (25%)

Query: 170 SDTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYL--- 226
           SDT   D  +  F +L+       P AR+ H              F  LG+G+T+ +   
Sbjct: 417 SDTLKIDTQKNTFIQLQ--NHSVLPPARACHT-------------FTRLGDGETAMVIGG 461

Query: 227 --------NDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNSAILMGG 268
                   ND W ++++  +W K      PE R  H  + TD + +L+ G
Sbjct: 462 RNAPHRAVNDCWFYNLNTNEWQK--GPELPEPRFRHSCVATDKNTLLVCG 509

>CAGL0I00704g Chr9 complement(51136..51966) [831 bp, 276 aa] {ON}
           similar to uniprot|Q02795 Saccharomyces cerevisiae
           YMR149w SWP1
          Length = 276

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 338 LQETEESLESVF-----YNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQE 392
           L   ++SLE V+       D+Y+F + ++K  K  +  Q++  NK   +T    S  D E
Sbjct: 81  LGHPDKSLEVVYPIKERAGDIYLFEINMDKLDKNLLAVQKELGNKPLAVTVVAASKDDSE 140

Query: 393 KELQDLLNSILAKSNL 408
             L+ L    L +S L
Sbjct: 141 GVLKTLFYMQLQESML 156

>YAL056W Chr1 (39259..41901) [2643 bp, 880 aa] {ON}  GPB2Multistep
           regulator of cAMP-PKA signaling; inhibits PKA downstream
           of Gpa2p and Cyr1p, thereby increasing cAMP dependency;
           inhibits Ras activity through direct interactions with
           Ira1p/2p; regulated by G-alpha protein Gpa2p; homolog of
           Gpb1p
          Length = 880

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 210 ILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSGHCFIPTDNSAILM 266
           I+FGG+R  G+ +   +NDLW          K+E       + G+C      +AIL+
Sbjct: 503 IIFGGYRQTGDDRYEAMNDLW----------KIEIPVIRRGKKGYCKFSETANAILL 549

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 9/59 (15%)

Query: 219 GNGQTSYLNDLWCFDISNYKWTKLETNTKPE---------ARSGHCFIPTDNSAILMGG 268
           G+  T   +D+W FD     W ++ET  + E         A +GH      +++I +GG
Sbjct: 664 GSNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>KLLA0F00374g Chr6 complement(20124..22511) [2388 bp, 795 aa] {ON}
           weakly similar to uniprot|Q08886 Saccharomyces
           cerevisiae YOR371C GPB1 Proposed beta subunit of the
           heterotrimeric G protein that interacts with the
           receptor Grp1p has signaling role in response to
           nutrients involved in regulation of pseudohyphal growth
           through cAMP levels homolog of Gpb2p
          Length = 795

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 10/51 (19%)

Query: 228 DLWCFDISNYKWTKLETNTKPEAR----------SGHCFIPTDNSAILMGG 268
           D+WC+D+    WTKL    K +            +GH F+      +++GG
Sbjct: 630 DMWCYDLDEGTWTKLSLKAKDKETGELKIVEFPLTGHTFVHNKQITVVIGG 680

>NDAI0A08860 Chr1 complement(2037552..2040122) [2571 bp, 856 aa]
           {ON} Anc_7.9 YAL056W
          Length = 856

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 17/89 (19%)

Query: 189 GRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKP 248
           G    P  ++G+     K+  +L GG     +       D+W F+I    W+K++T+ K 
Sbjct: 657 GHQQHPQKKNGY---GDKSVLVLHGG-----SNNNKVFGDMWWFNIETKIWSKIDTHAKT 708

Query: 249 EARS---------GHCFIPTDNSAILMGG 268
           E            GH  + T+  +I +GG
Sbjct: 709 EKDELIPIEMKLVGHTMVDTNFMSINIGG 737

>KNAG0E04180 Chr5 complement(833612..836071) [2460 bp, 819 aa] {ON} 
          Length = 819

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 207 NYFILFGGFRDLGNGQTSYLNDLWCFDI 234
           N  ++FGG++ +G+ +   +NDLW  DI
Sbjct: 496 NRILIFGGYKQVGDDEYEAMNDLWQVDI 523

>KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15
           YOL141W
          Length = 676

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 5/75 (6%)

Query: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLETNTKPEARSG 253
           P AR+ H      N  +L  G R   N      ND+W +D  +  W   +  + P  R  
Sbjct: 418 PDARTCHTWTKLGNGKVLLVGGR---NAPHRPYNDIWIYDTEHNLWE--QKTSLPYPRFR 472

Query: 254 HCFIPTDNSAILMGG 268
           HC    D + +L+ G
Sbjct: 473 HCTAQVDENCVLIYG 487

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,108,441
Number of extensions: 3011030
Number of successful extensions: 9266
Number of sequences better than 10.0: 87
Number of HSP's gapped: 9125
Number of HSP's successfully gapped: 179
Length of query: 652
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 536
Effective length of database: 40,180,143
Effective search space: 21536556648
Effective search space used: 21536556648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)