Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_16.13na 1ON35335317640.0
YPL264Cna 1ON35335316780.0
Smik_6.472na 1ON35335316690.0
Suva_16.41na 1ON35335316470.0
YMR253C8.804ON41433511501e-156
Skud_13.4258.804ON42433211481e-156
Suva_13.4388.804ON41833511391e-155
Smik_13.4678.804ON41933511341e-154
Kpol_2002.22na 2ON40334510661e-144
TDEL0B009308.804ON37035210541e-143
NDAI0K006608.804ON48735110481e-140
KNAG0J005008.804ON39133610251e-138
CAGL0H02519g8.804ON38435210151e-136
NCAS0C006308.804ON46034010031e-134
KLTH0C04752g8.804ON3723569921e-133
ZYRO0G13288g8.804ON3733589911e-133
KNAG0J00490singletonON4393509721e-129
Kwal_27.104338.804ON3823549511e-127
SAKL0D02442g8.804ON3803519461e-126
Kpol_543.758.804ON3943379451e-126
TPHA0E03870na 2ON4323299401e-124
TBLA0B026908.804ON4553329271e-122
KAFR0B038308.804ON3893298951e-118
TPHA0G010508.804ON3143257931e-104
TDEL0A041405.551ON38253780.29
TPHA0D025005.551ON45056770.42
KNAG0B035605.551ON40565770.43
TBLA0D014805.551ON44066770.44
ZYRO0D13090g5.551ON37063760.51
KLLA0B01177g5.551ON41456741.2
NCAS0F012005.551ON36773731.2
Suva_13.1415.551ON40053731.4
YML018C5.551ON39353721.7
SAKL0G05456g5.551ON39453712.2
Kpol_1060.276.272ON342151703.4
CAGL0M04499g8.348ON46993685.4
KAFR0C055105.551ON40351686.0
CAGL0G07018g5.551ON39153686.2
Smik_13.1335.551ON39353676.4
NDAI0C009405.551ON44765676.7
AER331C5.551ON44465678.1
Skud_13.1335.551ON39353668.4
Kpol_1004.395.551ON39156669.3
NCAS0H026805.551ON42365669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_16.13
         (353 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_16.13 Chr16 complement(22375..23436) [1062 bp, 353 aa] {ON}...   684   0.0  
YPL264C Chr16 complement(43283..44344) [1062 bp, 353 aa] {ON} Pu...   650   0.0  
Smik_6.472 Chr6 (776811..777872) [1062 bp, 353 aa] {ON} YPL264C ...   647   0.0  
Suva_16.41 Chr16 complement(58881..59942) [1062 bp, 353 aa] {ON}...   639   0.0  
YMR253C Chr13 complement(775946..777190) [1245 bp, 414 aa] {ON} ...   447   e-156
Skud_13.425 Chr13 complement(749944..751218) [1275 bp, 424 aa] {...   446   e-156
Suva_13.438 Chr13 complement(755253..756509) [1257 bp, 418 aa] {...   443   e-155
Smik_13.467 Chr13 complement(759048..760307) [1260 bp, 419 aa] {...   441   e-154
Kpol_2002.22 s2002 complement(44306..45517) [1212 bp, 403 aa] {O...   415   e-144
TDEL0B00930 Chr2 (174436..175548) [1113 bp, 370 aa] {ON} Anc_8.8...   410   e-143
NDAI0K00660 Chr11 (143969..145432) [1464 bp, 487 aa] {ON} Anc_8....   408   e-140
KNAG0J00500 Chr10 (79669..80844) [1176 bp, 391 aa] {ON} Anc_8.80...   399   e-138
CAGL0H02519g Chr8 (229511..230665) [1155 bp, 384 aa] {ON} simila...   395   e-136
NCAS0C00630 Chr3 (100913..102295) [1383 bp, 460 aa] {ON} Anc_8.804    390   e-134
KLTH0C04752g Chr3 (410449..411567) [1119 bp, 372 aa] {ON} simila...   386   e-133
ZYRO0G13288g Chr7 complement(1062258..1063379) [1122 bp, 373 aa]...   386   e-133
KNAG0J00490 Chr10 (78039..79358) [1320 bp, 439 aa] {ON}               379   e-129
Kwal_27.10433 s27 (342780..343928) [1149 bp, 382 aa] {ON} YMR253...   370   e-127
SAKL0D02442g Chr4 (193585..194727) [1143 bp, 380 aa] {ON} simila...   369   e-126
Kpol_543.75 s543 complement(184341..185525) [1185 bp, 394 aa] {O...   368   e-126
TPHA0E03870 Chr5 (815023..816321) [1299 bp, 432 aa] {ON}              366   e-124
TBLA0B02690 Chr2 (618919..620286) [1368 bp, 455 aa] {ON} Anc_8.8...   361   e-122
KAFR0B03830 Chr2 (792859..794028) [1170 bp, 389 aa] {ON} Anc_8.8...   349   e-118
TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.80...   310   e-104
TDEL0A04140 Chr1 (737337..738485) [1149 bp, 382 aa] {ON} Anc_5.5...    35   0.29 
TPHA0D02500 Chr4 (515403..516755) [1353 bp, 450 aa] {ON} Anc_5.5...    34   0.42 
KNAG0B03560 Chr2 complement(687312..688529) [1218 bp, 405 aa] {O...    34   0.43 
TBLA0D01480 Chr4 complement(363558..364880) [1323 bp, 440 aa] {O...    34   0.44 
ZYRO0D13090g Chr4 (1102902..1104014) [1113 bp, 370 aa] {ON} simi...    34   0.51 
KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar ...    33   1.2  
NCAS0F01200 Chr6 (234603..235706) [1104 bp, 367 aa] {ON} Anc_5.5...    33   1.2  
Suva_13.141 Chr13 complement(225107..226309) [1203 bp, 400 aa] {...    33   1.4  
YML018C Chr13 complement(234771..235952) [1182 bp, 393 aa] {ON} ...    32   1.7  
SAKL0G05456g Chr7 (448553..449737) [1185 bp, 394 aa] {ON} simila...    32   2.2  
Kpol_1060.27 s1060 complement(66241..67269) [1029 bp, 342 aa] {O...    32   3.4  
CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highl...    31   5.4  
KAFR0C05510 Chr3 (1102100..1103311) [1212 bp, 403 aa] {ON} Anc_5...    31   6.0  
CAGL0G07018g Chr7 (668453..669628) [1176 bp, 391 aa] {ON} simila...    31   6.2  
Smik_13.133 Chr13 complement(223651..224832) [1182 bp, 393 aa] {...    30   6.4  
NDAI0C00940 Chr3 complement(180857..182200) [1344 bp, 447 aa] {O...    30   6.7  
AER331C Chr5 complement(1245399..1246733) [1335 bp, 444 aa] {ON}...    30   8.1  
Skud_13.133 Chr13 complement(221096..222277) [1182 bp, 393 aa] {...    30   8.4  
Kpol_1004.39 s1004 (83150..84325) [1176 bp, 391 aa] {ON} (83150....    30   9.3  
NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551     30   9.8  

>Skud_16.13 Chr16 complement(22375..23436) [1062 bp, 353 aa] {ON}
           YPL264C (REAL)
          Length = 353

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/353 (96%), Positives = 340/353 (96%)

Query: 1   MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS 60
           MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS
Sbjct: 1   MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS 60

Query: 61  ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXV 180
           TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFG             V
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGQQSQDQESSQNDSV 180

Query: 181 ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240
           ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI
Sbjct: 181 ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240

Query: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED 353
           LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED
Sbjct: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED 353

>YPL264C Chr16 complement(43283..44344) [1062 bp, 353 aa] {ON}
           Putative membrane protein of unknown function;
           physically interacts with Hsp82p; YPL264C is not an
           essential gene
          Length = 353

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/353 (90%), Positives = 332/353 (94%)

Query: 1   MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS 60
           M LQRISKDYLKPNYGL+LLIVSYFFNSSMVVSTKVLE+DPLETSQSRINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKVLENDPLETSQSRINPLQILLVRMS 60

Query: 61  ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTL YM WNKQ++PDIPWG   CRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKQSVPDIPWGPAPCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXV 180
           TFMSPTLTIFLSFLLLGEPFSK EALGSLISFSGVVLIIRPTFLFG             V
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGEQTQGQQSPQDDIV 180

Query: 181 ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240
           ET+NPKLRLIAIGVSLLGVCGLSSVYIIIR+IGNKAHAIMSVSYFSLVTTVVAALGV+LI
Sbjct: 181 ETQNPKLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVLLI 240

Query: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           P+++LQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMSLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED 353
           LFHHWPN+WTWCGMAVIVSSTIWVINMRASKQN+VAT ELLSTSDFELD+LED
Sbjct: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATAELLSTSDFELDDLED 353

>Smik_6.472 Chr6 (776811..777872) [1062 bp, 353 aa] {ON} YPL264C
           (REAL)
          Length = 353

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/353 (88%), Positives = 333/353 (94%)

Query: 1   MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS 60
           M LQRISKDYLKPNYGL+LLIVSYFFNSSMVVSTK+LE+DPL+TSQ RINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENDPLKTSQPRINPLQILLVRMS 60

Query: 61  ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTL YM WNK+++PDIPWG  SCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKKSVPDIPWGPASCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXV 180
           TFMSPTLTIFLSFLLLGEPFSK EALGS+ISFSGVVLIIRPTFLFG             V
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSIISFSGVVLIIRPTFLFGQQTQGQEASQDDIV 180

Query: 181 ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240
           ET+NPKLRL+AIGVSLLGVCGLSSVYIIIR+IGNKAHAIMSVSYFSLVTTVVAALGV+LI
Sbjct: 181 ETQNPKLRLVAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240

Query: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           P++TLQLPHSWKQWGLFLNLG+SGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED 353
           LFHHWPN+WTWCGMAVIV+STIWVINMRASKQN+VAT+ELLSTSDFELDELED
Sbjct: 301 LFHHWPNIWTWCGMAVIVTSTIWVINMRASKQNVVATSELLSTSDFELDELED 353

>Suva_16.41 Chr16 complement(58881..59942) [1062 bp, 353 aa] {ON}
           YPL264C (REAL)
          Length = 353

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/353 (88%), Positives = 330/353 (93%)

Query: 1   MILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMS 60
           M LQRISKDYLKPNYGL+LLIVSYFFNSSMVVSTK+LE++PLE SQSRINPLQILLVRMS
Sbjct: 1   MTLQRISKDYLKPNYGLILLIVSYFFNSSMVVSTKILENEPLEASQSRINPLQILLVRMS 60

Query: 61  ITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120
           ITYCCTL YM WNK+++PDIPWG    RKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI
Sbjct: 61  ITYCCTLVYMHWNKRSVPDIPWGPLPYRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLI 120

Query: 121 TFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXV 180
           TFMSPTLTIFLSFLLLGEPFSK EALGSLISFSGVVLIIRPTFLFG             V
Sbjct: 121 TFMSPTLTIFLSFLLLGEPFSKLEALGSLISFSGVVLIIRPTFLFGQLNKTQETSEDNIV 180

Query: 181 ETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240
           ET+NP LRLIAIGVSLLGVCGLSSVYIIIR+IGNKAHAIMSVSYFSLVTTVVAALGV+LI
Sbjct: 181 ETQNPTLRLIAIGVSLLGVCGLSSVYIIIRYIGNKAHAIMSVSYFSLVTTVVAALGVILI 240

Query: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           P++TLQLPHSWKQWGLFLNLG+SGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV
Sbjct: 241 PSMTLQLPHSWKQWGLFLNLGVSGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300

Query: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDELED 353
           LFHHWPN+WTWCGMAVIVSSTIWVINMRASKQN+VAT++LLSTSDFELDELED
Sbjct: 301 LFHHWPNIWTWCGMAVIVSSTIWVINMRASKQNVVATSDLLSTSDFELDELED 353

>YMR253C Chr13 complement(775946..777190) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern; YMR253C is not an essential gene
          Length = 414

 Score =  447 bits (1150), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 266/335 (79%), Gaps = 3/335 (0%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSR-INPLQILLVRMSI 61
           LQRISKDYLKPN GLVLL VSYFFNS+MVVSTKVLE+DP + +  R I PLQILLVRM I
Sbjct: 57  LQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPDDIANDRQIKPLQILLVRMVI 116

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM  NK  I D+P+G P  RKWL+LRG  GFFGVFGMY+SLMYL+ISDAVLIT
Sbjct: 117 TYIGTLIYMYINKSTISDVPFGKPEVRKWLVLRGCTGFFGVFGMYYSLMYLTISDAVLIT 176

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F++P+LTIFLS+++L E F+K EALGSLIS  GVVLI+RP+FLFG             VE
Sbjct: 177 FLAPSLTIFLSWVILRERFTKVEALGSLISLLGVVLIVRPSFLFGTPELTDSSSQI--VE 234

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           + +PK RLIA  V L GV G+S VYIIIR+IG +AHAIMSVSYFSL+T +V+ +G+  IP
Sbjct: 235 SSDPKSRLIATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTIP 294

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++  Q+PHS KQW LF NLG+SGFI Q+LLTMGIQRERAGRGSLMTYTQ++YAVFWDV L
Sbjct: 295 SMKFQIPHSKKQWILFGNLGVSGFIFQLLLTMGIQRERAGRGSLMTYTQLLYAVFWDVAL 354

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVA 336
           + HWPN+W+W GM +I+S+T+WVI +RA+     A
Sbjct: 355 YKHWPNIWSWIGMIIIISATLWVIRIRAANNETTA 389

>Skud_13.425 Chr13 complement(749944..751218) [1275 bp, 424 aa] {ON}
           YMR253C (REAL)
          Length = 424

 Score =  446 bits (1148), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 221/332 (66%), Positives = 265/332 (79%), Gaps = 4/332 (1%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSR-INPLQILLVRMSI 61
           LQRISKDYLKPN GLVLL VSYFFNS+MVVSTKVLE+DP + +  R I PLQILLVRM I
Sbjct: 68  LQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPEDIANDRQIKPLQILLVRMVI 127

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM  NK  IP++P+G P  RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLIT
Sbjct: 128 TYIGTLIYMYINKSTIPNVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLIT 187

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F+SP+LTIFLS+++L E F+K EALGSLIS  GVVLI+RP+FLFG             VE
Sbjct: 188 FLSPSLTIFLSWVILRERFTKVEALGSLISLMGVVLIVRPSFLFGTPEMTDSSRI---VE 244

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           + +PK RL+A  V L GV G+S VYIIIR+IG +AHAIMSVSYFSL+T +V+ +G+  IP
Sbjct: 245 SSDPKSRLVATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTIP 304

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++  Q+PHS KQW LF NLG+SGFI Q+LLT+GIQRERAGRGSLM YTQ++YAVFWDV L
Sbjct: 305 SMKFQIPHSRKQWILFGNLGVSGFIFQLLLTLGIQRERAGRGSLMAYTQLLYAVFWDVTL 364

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRASKQN 333
           + HWPN+W+W GM VI+S+T+WVI +RA+   
Sbjct: 365 YKHWPNVWSWVGMIVIISATLWVIRIRAANSE 396

>Suva_13.438 Chr13 complement(755253..756509) [1257 bp, 418 aa] {ON}
           YMR253C (REAL)
          Length = 418

 Score =  443 bits (1139), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/335 (65%), Positives = 267/335 (79%), Gaps = 3/335 (0%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLE-TSQSRINPLQILLVRMSI 61
           LQRISKDYLKPN GLVLL VSYFFNS+MVVSTKVLE+DP +  + ++I PLQILLVRM I
Sbjct: 61  LQRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPEDIANDTQIKPLQILLVRMVI 120

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM  N+  I D+P+G P  RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLIT
Sbjct: 121 TYIGTLIYMYINRSTISDVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLIT 180

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F+SP+LTIFLS+L+L E F+K EALGSL+S  GVVLI+RP+FLFG             VE
Sbjct: 181 FLSPSLTIFLSWLILRERFTKVEALGSLVSLMGVVLIVRPSFLFGVPEMTDSSSQI--VE 238

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           + +P+ RLIA  V L GV G+S VYIIIR+IG +AHAIMSVSYFSL+T +V+ +G+  IP
Sbjct: 239 SSDPRSRLIATLVGLWGVFGMSCVYIIIRYIGKRAHAIMSVSYFSLITALVSFVGINTIP 298

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++  Q+PHS KQW LF NLGISGFI Q+LLT+GIQRERAGRGSLM YTQ+IYAVFWDV L
Sbjct: 299 SMKFQIPHSKKQWILFGNLGISGFIFQLLLTLGIQRERAGRGSLMAYTQLIYAVFWDVAL 358

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVA 336
           + HWPNMW+W GM +I+++T+WVI +R++    +A
Sbjct: 359 YKHWPNMWSWFGMIIIITATLWVIRIRSANNEAIA 393

>Smik_13.467 Chr13 complement(759048..760307) [1260 bp, 419 aa] {ON}
           YMR253C (REAL)
          Length = 419

 Score =  441 bits (1134), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 218/335 (65%), Positives = 266/335 (79%), Gaps = 3/335 (0%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSR-INPLQILLVRMSI 61
           L RISKDYLKPN GLVLL VSYFFNS+MVVSTKVLE+DP + +  R I PLQILLVRM I
Sbjct: 62  LHRISKDYLKPNIGLVLLTVSYFFNSAMVVSTKVLENDPDDIANERQIKPLQILLVRMVI 121

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM  NK  I D+P+G P  RKWLILRG  GFFGVFGMY+SLMYL+ISDAVLIT
Sbjct: 122 TYVGTLIYMYINKNTISDVPFGKPEVRKWLILRGCTGFFGVFGMYYSLMYLTISDAVLIT 181

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F++P+LTIFLS+++L E F+K EALGSLIS  GVVLI+RP+F+FG             +E
Sbjct: 182 FLAPSLTIFLSWIILRERFTKVEALGSLISLMGVVLIVRPSFIFGTPESTDSSSQI--IE 239

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           + +PK RLIA  V L GV G+S VYIIIR+IG +AHAIMSVSYFSL+T +V+ +G+  IP
Sbjct: 240 SSDPKSRLIATLVGLWGVLGMSCVYIIIRYIGKRAHAIMSVSYFSLITAIVSFIGINTIP 299

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++  Q+PHS KQW LF NLG+SGFI Q+LLT+GIQRERAGRGSLMTYTQ++YAVFWDV L
Sbjct: 300 SMKFQIPHSKKQWILFGNLGVSGFIFQLLLTLGIQRERAGRGSLMTYTQLLYAVFWDVSL 359

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVA 336
           + HWP++W+W GM +I+S+T+WVI +RA+    +A
Sbjct: 360 YKHWPSIWSWIGMIIIISATLWVIRIRAANSETIA 394

>Kpol_2002.22 s2002 complement(44306..45517) [1212 bp, 403 aa] {ON}
           complement(44306..45517) [1212 nt, 404 aa]
          Length = 403

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 259/345 (75%), Gaps = 5/345 (1%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSIT 62
           L+R + ++L PN GLVLL  +Y FNS MVVSTKV+E+DP +  + RI PLQIL+VRM IT
Sbjct: 48  LKRFADEHLMPNLGLVLLSGAYLFNSIMVVSTKVMETDPDKLKEDRIKPLQILVVRMVIT 107

Query: 63  YCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL YM W +  I  +P+G P  RKWL+LRG +GFFGVFGMYFSLMYL+ISDAVLITF
Sbjct: 108 YIGTLIYMYWKRDVIEHVPFGPPELRKWLLLRGCVGFFGVFGMYFSLMYLTISDAVLITF 167

Query: 123 MSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVET 182
           +SP+LTI L++L+L E  ++FE +GS+IS  GVVLI+RP FLFG             VET
Sbjct: 168 LSPSLTIILAWLILREKITRFEVMGSIISLFGVVLIVRPCFLFGARVNLSQINDH--VET 225

Query: 183 KNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIPA 242
            NP+ RL+A  V+LLGV G S VYIIIR IGN+AHAIMSVSYFSLVTTVV+ +G++ IP+
Sbjct: 226 SNPQERLVATLVALLGVIGASCVYIIIRFIGNRAHAIMSVSYFSLVTTVVSLVGILTIPS 285

Query: 243 LTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           +  Q+P S K+W LF NLGI GFI Q+LLTMGIQRERAGRGSLM Y Q+IYA+FWDV ++
Sbjct: 286 IRFQIPSSLKEWLLFGNLGICGFIFQLLLTMGIQRERAGRGSLMQYVQLIYAIFWDVSIW 345

Query: 303 HHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFE 347
             WP+ W+WCGM +IV STIWV+N+   K ++ A  + L   D E
Sbjct: 346 KRWPSFWSWCGMVLIVGSTIWVVNI---KNSLAAQKDTLHMQDLE 387

>TDEL0B00930 Chr2 (174436..175548) [1113 bp, 370 aa] {ON} Anc_8.804
           YMR253C
          Length = 370

 Score =  410 bits (1054), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 206/352 (58%), Positives = 268/352 (76%), Gaps = 12/352 (3%)

Query: 2   ILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSR--INPLQILLVRM 59
           +++RIS++YLKPN GLVLL+VSYFFNS MVV+TKVLE+D  E  + R  I PLQILLVRM
Sbjct: 29  VVRRISREYLKPNIGLVLLVVSYFFNSGMVVATKVLETDH-EGVEDREPIKPLQILLVRM 87

Query: 60  SITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVL 119
           SITY  TL YM  N++ I ++P+G P  RKWLILRG+MGF GVFG+Y SL+YLSISDA+L
Sbjct: 88  SITYVGTLLYMLKNRKTIENVPFGPPEVRKWLILRGLMGFLGVFGLYSSLVYLSISDAIL 147

Query: 120 ITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXX 179
           ITF++PT+T+ L++++L E F+  EA+GSL+SF GV+LI+RP+FLFG             
Sbjct: 148 ITFLTPTVTVILAWIVLRERFTVIEAVGSLLSFGGVILIVRPSFLFGTATTSTDA----- 202

Query: 180 VETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVML 239
            E++N + RLIA  +SL+GV G SSVYIIIRHIG +AHAI+SVSYFSL+ T+++  GV L
Sbjct: 203 AESENTRDRLIATIMSLVGVFGASSVYIIIRHIGQRAHAILSVSYFSLIVTIISIAGVAL 262

Query: 240 IPALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDV 299
           +P++ +Q+P + KQW LF NLGI GFI Q LLTMGIQRERAGRGS+M YTQ+IYAVFWDV
Sbjct: 263 VPSMHIQMPSNTKQWLLFANLGICGFIFQYLLTMGIQRERAGRGSVMAYTQLIYAVFWDV 322

Query: 300 VLFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDEL 351
            L+H+WP +W+W GM +IV ST+ VI  +  +       E     ++ELDE+
Sbjct: 323 ALWHNWPKLWSWLGMLIIVGSTLAVIKFKPKESASPPDEE----ENYELDEI 370

>NDAI0K00660 Chr11 (143969..145432) [1464 bp, 487 aa] {ON} Anc_8.804
          Length = 487

 Score =  408 bits (1048), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 200/351 (56%), Positives = 266/351 (75%), Gaps = 4/351 (1%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSR-INPLQILLVRMSI 61
           +QRI+KDYLKPN GL+LL ++  FNS MV STKVLE+DP + +  + I PLQILLVRM I
Sbjct: 93  IQRINKDYLKPNVGLLLLTLAQLFNSLMVTSTKVLETDPYDIAHDQQIKPLQILLVRMVI 152

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM  N+  I  +P+G P  RKWLILRG +GFFGVFGMYFSLMYLSISDAVLIT
Sbjct: 153 TYLGTLIYMFINRHTIQFVPFGDPKIRKWLILRGCVGFFGVFGMYFSLMYLSISDAVLIT 212

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F++P++TI +S+++L E F+K EA+G ++S  GVVLI+RPTF+FG             VE
Sbjct: 213 FLAPSVTIIMSWVILRERFTKTEAIGCIVSLFGVVLIVRPTFIFGVPDDDDGKIDPEMVE 272

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           +KNP+ RLIA  V LLGV G+S VY++IR IG +AHAIMSVSYFSL+TT+++ LG++ +P
Sbjct: 273 SKNPEERLIATFVGLLGVVGMSMVYVVIRFIGKRAHAIMSVSYFSLITTIISFLGIVFLP 332

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++   +PHS KQW LF NLG  GFI Q+LLT+GIQ+ERAGRGSL++YTQ+IYA+FWDV L
Sbjct: 333 SMKFHVPHSLKQWLLFANLGFCGFIFQLLLTLGIQKERAGRGSLISYTQLIYAIFWDVTL 392

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRASKQ---NIVATTELLSTSDFELD 349
           + HWPN+W+WCGM +I+ +T+ ++ ++  +    N++ T  + S S  + D
Sbjct: 393 YRHWPNIWSWCGMLIIIGTTLLIVKLKPKQDENGNVIETKSMTSLSSSKTD 443

>KNAG0J00500 Chr10 (79669..80844) [1176 bp, 391 aa] {ON} Anc_8.804
           YMR253C
          Length = 391

 Score =  399 bits (1025), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/336 (57%), Positives = 252/336 (75%), Gaps = 4/336 (1%)

Query: 7   SKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSITYCCT 66
            + Y+ PN GL+LL+VSYFF+SSMVVSTKVLE+DP   S+++I PLQIL VRMSITY   
Sbjct: 53  KEKYIDPNVGLILLVVSYFFSSSMVVSTKVLETDP--GSETKIQPLQILAVRMSITYLGC 110

Query: 67  LAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPT 126
           L YM  N+  IPD+P+G  S RKWLILRG MGFF VFG YFSLMYLSISD+ LI F+ P+
Sbjct: 111 LLYMYINRNTIPDVPFGERSVRKWLILRGCMGFFSVFGTYFSLMYLSISDSTLIMFLEPS 170

Query: 127 LTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVETKNPK 186
           L I +++L L E   + E +G ++S  GVVLI+RP FLFG             VE++NP+
Sbjct: 171 LIIVMAWLFLNERIQRMEIVGCVVSLIGVVLIVRPPFLFGPATFDPDSDQS--VESRNPR 228

Query: 187 LRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIPALTLQ 246
            RL+A  V++ G  G+ SVYIIIRHIG++AHAIM+VSYFSLVT VV+ +G+++IP++  Q
Sbjct: 229 ERLLATLVAVWGTVGMGSVYIIIRHIGDRAHAIMNVSYFSLVTFVVSIVGILVIPSMRFQ 288

Query: 247 LPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHHWP 306
           +PH+WK+W LF NLG+SGF HQ LLT+GIQRERAGRGSL+TYT ++YA+FWD+ L+HH+P
Sbjct: 289 IPHTWKEWILFANLGVSGFYHQFLLTLGIQRERAGRGSLITYTLLVYALFWDIFLYHHFP 348

Query: 307 NMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLS 342
            +W+WCGM +IV ST++V+ M+        T E L 
Sbjct: 349 PLWSWCGMFLIVGSTVYVVKMKMDDAEQDGTGEALE 384

>CAGL0H02519g Chr8 (229511..230665) [1155 bp, 384 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253c and
           similar to uniprot|Q08980 Saccharomyces cerevisiae
           YPL264c
          Length = 384

 Score =  395 bits (1015), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 197/352 (55%), Positives = 262/352 (74%), Gaps = 6/352 (1%)

Query: 2   ILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESD--PLETSQSRINPLQILLVRM 59
           ++ R++++YLKPN GL+ LIVS  FNS MVVSTKVLE D   LE  +  I PLQILLVRM
Sbjct: 33  MVARLNQEYLKPNVGLIFLIVSQLFNSLMVVSTKVLELDREGLEPDEPSIQPLQILLVRM 92

Query: 60  SITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVL 119
            ITY  TL YM+ N  +I  +P+G P+ R WLI+RG MGFFGVFGMYFSLMYL+ISDAVL
Sbjct: 93  IITYIGTLIYMKINSSSIEYVPFGNPAVRPWLIMRGAMGFFGVFGMYFSLMYLTISDAVL 152

Query: 120 ITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXX 179
           ITF++P++TI L++++L E FSK E +GS +S +GVVLI+RPTFLFG             
Sbjct: 153 ITFLAPSVTIILAWIILRESFSKAEGIGSFVSLAGVVLIVRPTFLFGNPTTSDGDID--- 209

Query: 180 VETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVML 239
            ET +P  RLIA  V+L GV G+SSV+IIIR+IG +AHAI++VSYFSL+T ++A  G++ 
Sbjct: 210 -ETTDPHKRLIATLVALWGVVGISSVWIIIRYIGKRAHAIINVSYFSLITGLIALFGILF 268

Query: 240 IPALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDV 299
           +P++  Q P + KQW LF NLGI GF HQ+LLT+GIQ+ERAGRG+LM+YT +IYAVFWDV
Sbjct: 269 VPSVHFQTPRTLKQWLLFANLGICGFCHQLLLTIGIQKERAGRGTLMSYTNLIYAVFWDV 328

Query: 300 VLFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDEL 351
           +LF HWP+ W+ CGM +I  ST++++ M+A+     A       ++F+L++L
Sbjct: 329 LLFGHWPSFWSICGMILITGSTLYIVKMKANDAKPQAVNNNSIQTEFDLEDL 380

>NCAS0C00630 Chr3 (100913..102295) [1383 bp, 460 aa] {ON} Anc_8.804
          Length = 460

 Score =  390 bits (1003), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 196/340 (57%), Positives = 254/340 (74%), Gaps = 10/340 (2%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETS-QSRINPLQILLVRMSI 61
           LQRI+K+YLKPN GL+LLI +  FNS MV STKVLE+DP + +  + I P QILLVRM+I
Sbjct: 66  LQRINKEYLKPNIGLILLIFAQLFNSLMVTSTKVLETDPEDKALGTSIKPFQILLVRMAI 125

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM  N+  I  +P+G P  RKWLILRG +GF+GVFGMYFSLMYLSISDAVLIT
Sbjct: 126 TYLGTLIYMYLNRSTIDYVPFGDPKVRKWLILRGCVGFWGVFGMYFSLMYLSISDAVLIT 185

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXX----- 176
           F++PT+TI L++++L E F+K EA G+L+S  GVVLI+RPTFLFG               
Sbjct: 186 FLAPTVTIILAWIILRERFTKVEAAGALVSLLGVVLIVRPTFLFGSDMTTPSDVELDVDL 245

Query: 177 ---XXXVETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVA 233
                  E+ NP  RL+A  V L GV G+SSVYIIIR IG +AHAIMSVSYFSL+T +++
Sbjct: 246 NPMRDQAESSNPADRLMASIVGLCGVLGMSSVYIIIRFIGKRAHAIMSVSYFSLITLIIS 305

Query: 234 ALGVMLIPALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIY 293
            + ++++P++ LQ PHS KQW LF NLG  GF  Q+LLT+GIQ+ERAGRGSLM+YTQ++Y
Sbjct: 306 TVCIIVMPSMRLQFPHSLKQWLLFANLGFCGFFFQLLLTLGIQKERAGRGSLMSYTQLVY 365

Query: 294 AVFWDVVLFHHWPNMWTWCGMAVIVSSTIWVINMRASKQN 333
           A+FWDV L+ +WP++W+W GM +I+ ST+ V+ ++  KQN
Sbjct: 366 AIFWDVTLYKNWPSIWSWLGMIIIIGSTLVVMRLKP-KQN 404

>KLTH0C04752g Chr3 (410449..411567) [1119 bp, 372 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 372

 Score =  386 bits (992), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 188/356 (52%), Positives = 255/356 (71%), Gaps = 10/356 (2%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSIT 62
           LQR+S +YLKPN GL+ L++S  FNS MVVSTK+LE+DP    +  I PLQIL+VRM IT
Sbjct: 19  LQRLSSEYLKPNIGLLYLLISNLFNSVMVVSTKLLETDP--ELEEPITPLQILVVRMFIT 76

Query: 63  YCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITF 122
           Y  TL YM +N+  I  +PWG P  RKWLILRG  GFFGVFGMY+SLMYLS+ DA +ITF
Sbjct: 77  YIGTLIYMLYNRDRIDHVPWGPPDMRKWLILRGCTGFFGVFGMYYSLMYLSVPDATIITF 136

Query: 123 MSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVET 182
           + P+ T  L++ +L E +SK EA G+L+S  GV+LI+RP+FLFG              E+
Sbjct: 137 LGPSFTGLLAWAILRERYSKVEATGALVSLMGVILIVRPSFLFGSSATDDSGGT---AES 193

Query: 183 KNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIPA 242
           ++P  RL+A  V+L+GV G S+VYIIIR+IG +AHAIMSVSYF+L+   V+ +G+ +IP+
Sbjct: 194 RDPHARLVATIVALVGVIGASNVYIIIRYIGQRAHAIMSVSYFALIACCVSLVGICVIPS 253

Query: 243 LTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLF 302
           +  Q+P + KQW LF  +G SGF  Q+LLTMGIQRERAGRG++M+Y+Q+IYA+FWDV ++
Sbjct: 254 MGFQIPQTSKQWFLFTLIGFSGFFMQLLLTMGIQRERAGRGAIMSYSQIIYAIFWDVFIW 313

Query: 303 HHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATT-----ELLSTSDFELDELED 353
           HH P +W+WCG+ VI+ S IWV+  +   + I   T     +++   DFE+ + ED
Sbjct: 314 HHLPGLWSWCGIIVILGSAIWVVKCKPKSEFIATATTDQESQVIQMEDFEIHDDED 369

>ZYRO0G13288g Chr7 complement(1062258..1063379) [1122 bp, 373 aa]
           {ON} similar to uniprot|Q04835 Saccharomyces cerevisiae
           YMR253C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 373

 Score =  386 bits (991), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 198/358 (55%), Positives = 261/358 (72%), Gaps = 21/358 (5%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESD---------PLETSQSRINPLQ 53
           LQR S+DYLKPN GLV LI +  FNS MVVSTKVLE+D         PL+     I PLQ
Sbjct: 28  LQRFSQDYLKPNLGLVYLIAAQLFNSLMVVSTKVLETDKTIDPNTGDPLKP----IKPLQ 83

Query: 54  ILLVRMSITYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLS 113
           ILL RMSITY   L YM  N+++IPD P+GAP  R WL LRG +GFFGVFG+YFSLMYL+
Sbjct: 84  ILLSRMSITYAGALLYMLINRRSIPDAPFGAPGLRIWLFLRGAVGFFGVFGLYFSLMYLT 143

Query: 114 ISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXX 173
           +SDAVLITF++PT+T+ L+ L+L E F++ EA+G+L+S  GVVLI+RP+FLFG       
Sbjct: 144 VSDAVLITFLTPTVTVVLAALILKERFTRAEAVGTLVSLLGVVLIVRPSFLFGQPDDPDN 203

Query: 174 XXXXXXVETKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVA 233
                  E+ +P  RL+A  V LLGV G S+VYI++R+IG++AHAI+SV+YFSL  T+V+
Sbjct: 204 SP----AESADPAKRLLATLVGLLGVLGASTVYIVLRYIGDRAHAIISVAYFSLTVTIVS 259

Query: 234 ALGVMLIPALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIY 293
           ++G+++IP++    PH  +QW L +NLG+ GFI Q+LLTMGIQRERAGRGS M+YTQ++Y
Sbjct: 260 SIGILVIPSMQFSWPHGSRQWFLLINLGVCGFIFQLLLTMGIQRERAGRGSAMSYTQLVY 319

Query: 294 AVFWDVVLFHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLSTSDFELDEL 351
           AV WDV+L+HHWP+MW+W GM VIV +T+ V   + SK+ I    EL      EL+++
Sbjct: 320 AVIWDVMLWHHWPSMWSWLGMLVIVGATVAVARYK-SKEPI---PELPLEESMELEDI 373

>KNAG0J00490 Chr10 (78039..79358) [1320 bp, 439 aa] {ON} 
          Length = 439

 Score =  379 bits (972), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 258/350 (73%), Gaps = 4/350 (1%)

Query: 4   QRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSITY 63
           Q+  + Y+  N GL+LL+V+ FFN+ M+VSTK+LE++P+  +  +I PLQIL+VRM+ITY
Sbjct: 78  QQFKEKYVDTNVGLILLVVAQFFNTLMIVSTKLLETNPV--AGQKIKPLQILVVRMAITY 135

Query: 64  CCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFM 123
              L YM  N+  +  +P+G P  RKWLILRG  GFFGVFG YFSLMYLSISD+VLI+F+
Sbjct: 136 IGCLVYMYVNRATVKYVPFGDPKVRKWLILRGCTGFFGVFGSYFSLMYLSISDSVLISFL 195

Query: 124 SPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVETK 183
           SP++TI L++ +L E   ++E  G  +S  GVVLIIRP FLFG             VE+ 
Sbjct: 196 SPSITILLAWAVLRERIHRYEVAGCFVSLLGVVLIIRPPFLFGVDALDSSADPSP-VESH 254

Query: 184 NPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIPAL 243
           +P+ RLIA  V+LLG  G+S VYIIIR IG++AHAIMSVSYFSL+T +V+ +GV+ IP++
Sbjct: 255 HPRDRLIATLVALLGCFGMSCVYIIIRFIGDRAHAIMSVSYFSLITLIVSIIGVLTIPSM 314

Query: 244 TLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFH 303
             Q+PHS K+W LF NLGISGF  Q++LTMGIQRERAGRGSL+TYTQ++YA+FWDV L+H
Sbjct: 315 KFQMPHSSKEWLLFANLGISGFCFQLMLTMGIQRERAGRGSLITYTQLVYAIFWDVWLYH 374

Query: 304 HWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTELLST-SDFELDELE 352
           H P++W+ CGM +I+ ST++V+ ++ S   +    +  ST S+ + DELE
Sbjct: 375 HPPSIWSVCGMFIIIGSTLYVVRLKNSGPTVSDDADTPSTVSEQDGDELE 424

>Kwal_27.10433 s27 (342780..343928) [1149 bp, 382 aa] {ON} YMR253C -
           1:1 [contig 36] FULL
          Length = 382

 Score =  370 bits (951), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 255/354 (72%), Gaps = 12/354 (3%)

Query: 3   LQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDP-LETSQSRINPLQILLVRMSI 61
           LQR+S DYLKPN GL+ L++S  FNS M+VSTK+LE+DP LET    I PLQIL+VRM I
Sbjct: 26  LQRLSDDYLKPNIGLMYLLISNLFNSLMIVSTKLLETDPELETP---ITPLQILVVRMFI 82

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM W + +I ++PWG P  RKWLILRG  GFFGVFG+Y+SLMYLS+ DA +IT
Sbjct: 83  TYLGTLIYMYWKRNSIGNVPWGPPEMRKWLILRGCTGFFGVFGLYYSLMYLSVPDATVIT 142

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F++P+ T  L++ +L E +SK EA+G+L S  GV+LI+RP FLFG             VE
Sbjct: 143 FLAPSFTGMLAWAVLRERYSKVEAMGALTSLFGVILIVRPAFLFGQSSMDTATGS---VE 199

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           + NP+ R IA  ++LLGV G+ +VYIIIR+IG +AHA+MSVSYF+L+  +V+ +G+ +IP
Sbjct: 200 SSNPRDRFIATLIALLGVVGVCNVYIIIRYIGQRAHAVMSVSYFALIVCIVSLVGICVIP 259

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++T Q+P + +QW LF  +G SGF  Q+LLTMGIQ+ERAGRG+L++Y+Q+I+A+FWD+++
Sbjct: 260 SMTFQVPQTTRQWFLFSVIGFSGFFMQLLLTMGIQKERAGRGALVSYSQIIFALFWDMLI 319

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRASKQNIVATTE-----LLSTSDFELDE 350
           +HH P  W+WCG+  I+ S   V+  +   +  V  T+     ++   DFE+ +
Sbjct: 320 WHHLPGFWSWCGIITILGSAFCVLKYKPKPEPTVLITDDQESQIIQMQDFEIPD 373

>SAKL0D02442g Chr4 (193585..194727) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q04835 Saccharomyces cerevisiae YMR253C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 380

 Score =  369 bits (946), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 192/351 (54%), Positives = 263/351 (74%), Gaps = 10/351 (2%)

Query: 5   RISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSITYC 64
           RIS++YLKPN GL+ L+ S+FFNS MVVSTK+LE+DPL   +  I PLQIL+VRM IT+ 
Sbjct: 25  RISEEYLKPNIGLLFLMTSHFFNSIMVVSTKLLETDPL--LEEPIKPLQILVVRMFITFI 82

Query: 65  CTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMS 124
            TL YM+ NK  IP +P+G P  RKWLILRG  GFFGVFG+YFSLMYLS+SDAV+ITF++
Sbjct: 83  GTLIYMQLNKDKIPHVPFGPPEVRKWLILRGFTGFFGVFGLYFSLMYLSVSDAVMITFLA 142

Query: 125 PTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVETKN 184
           P+ T  L++++L E +SK EALG L+S  GV+LIIRPTF+FG              E+ +
Sbjct: 143 PSFTGLLAWMILHERYSKIEALGGLVSLFGVILIIRPTFMFGAQSRTSSDES---FESSD 199

Query: 185 PKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIPALT 244
           P+ RL+A  VSLLGV G+SSVYIIIR+IG++AHAIMSV+YF+ +T +++  G++LIP++ 
Sbjct: 200 PRDRLVATLVSLLGVLGVSSVYIIIRYIGHRAHAIMSVTYFAFITCMISLFGILLIPSMI 259

Query: 245 LQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVLFHH 304
            Q+P + KQW LF  +G+SGF  Q+LLT+GIQRERAGRG+LM Y Q+IYA+FWD++++HH
Sbjct: 260 FQIPKTPKQWFLFFLIGVSGFFMQLLLTLGIQRERAGRGALMAYGQMIYAIFWDILIWHH 319

Query: 305 WPNMWTWCGMAVIVSSTIWVINMRASKQNIVAT-----TELLSTSDFELDE 350
            P +W+ CGM +I++ST+ VI  +  ++  V       T++    DFE+D+
Sbjct: 320 PPGLWSLCGMTIIIASTVTVIKFKPKQEEAVINDEENGTQVYHMEDFEIDD 370

>Kpol_543.75 s543 complement(184341..185525) [1185 bp, 394 aa] {ON}
           complement(184341..185525) [1185 nt, 395 aa]
          Length = 394

 Score =  368 bits (945), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 182/337 (54%), Positives = 242/337 (71%), Gaps = 6/337 (1%)

Query: 2   ILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSI 61
           +  R+   Y +PN G+ LLIVSYFFNS M VSTKVLE+   +  + RI PLQILL+RM I
Sbjct: 42  LFNRLKDQYWEPNAGIFLLIVSYFFNSVMQVSTKVLETFGDKPDEDRIKPLQILLIRMVI 101

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           T    + Y+  N++ IP +P+G P  R+WLILRGI GF GVFGMYFSLMYL+ISDAVLI+
Sbjct: 102 TSIGIIVYVYMNRRTIPYVPFGNPQVRQWLILRGIFGFIGVFGMYFSLMYLTISDAVLIS 161

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           FM+P+ T+FL++ +LGEPFSK E +GS++S +GV+ I+RP+F+FG             + 
Sbjct: 162 FMAPSFTLFLAWFVLGEPFSKLEGVGSILSLTGVLFIVRPSFIFG---GSIENEKSHDLS 218

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
               + R IA  ++L G   LS VYI+IR IG KAHAIM+VSYFS+VT +V+ LGV+ IP
Sbjct: 219 IATGRTRFIATTIALFGAASLSGVYIVIRFIGAKAHAIMNVSYFSVVTGIVSLLGVLFIP 278

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++  Q+P    +W LF  +G+ GFIHQ+LLTMGIQ+ RAG+GSLM+YTQVIYA+FWDV L
Sbjct: 279 SMKFQVPEGSTEWILFCTIGVCGFIHQLLLTMGIQKVRAGKGSLMSYTQVIYAIFWDVTL 338

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRA---SKQNIV 335
           +  WPN W+  GM +I+ STIWVI ++    S+Q+ V
Sbjct: 339 WGRWPNAWSIFGMFLIIGSTIWVIRLKEQEVSRQSTV 375

>TPHA0E03870 Chr5 (815023..816321) [1299 bp, 432 aa] {ON} 
          Length = 432

 Score =  366 bits (940), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/329 (55%), Positives = 249/329 (75%), Gaps = 1/329 (0%)

Query: 2   ILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSI 61
           IL++ + + LKPN GLV+L +++F NS M+VSTKVL ++P  +S+ RI PLQILLVRM +
Sbjct: 67  ILRKFTSESLKPNIGLVILALAFFCNSLMIVSTKVLVTNPERSSEERIKPLQILLVRMVL 126

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY  TL YM  N+  IP++P+G P  RKWL+LRG  GFFGVFGMYFSLMYL +SDA++IT
Sbjct: 127 TYIGTLIYMYLNRATIPNVPFGPPEVRKWLLLRGACGFFGVFGMYFSLMYLCLSDALIIT 186

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F+SP++TI L++++L E  +K+E   SLIS  GVVLIIRP F+FG             V 
Sbjct: 187 FLSPSVTIILAWVVLRENLTKYEVTSSLISLLGVVLIIRPEFIFGSRGMSSDGNDLSVV- 245

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           + +P  RLIA  V L GV G S VYI+IR IGNKAHAIMSVSYFS+VT V++ +G+++IP
Sbjct: 246 SSDPHERLIASLVGLAGVFGASIVYIVIRFIGNKAHAIMSVSYFSMVTAVISLIGIIIIP 305

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           ++T Q+P S K+W LF NLG+ GF  Q+LLT+GIQ+E+AGRG+LM YTQ+IYA+FWDV+L
Sbjct: 306 SMTFQIPSSLKEWLLFANLGVCGFFFQLLLTLGIQKEKAGRGTLMQYTQIIYAIFWDVLL 365

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRAS 330
           +  WPN+W+W GM +I+ ST+++  ++ S
Sbjct: 366 WDVWPNIWSWGGMVLIIGSTLFMFILKKS 394

>TBLA0B02690 Chr2 (618919..620286) [1368 bp, 455 aa] {ON} Anc_8.804
           YMR253C
          Length = 455

 Score =  361 bits (927), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 182/332 (54%), Positives = 240/332 (72%), Gaps = 8/332 (2%)

Query: 6   ISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSITYCC 65
           ++KDYLK N GL+LLI++  FNS M+VSTK+LE++P  + +  I PLQ+LLVRMSITY  
Sbjct: 103 VNKDYLKANTGLILLIIAELFNSIMIVSTKLLETNPSRSEEDTIKPLQVLLVRMSITYLF 162

Query: 66  TLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSP 125
           TL YM  NK  +P  P+G  S R  LI RG  GF GVFG+YFSLMYL+ISDA+LI F+ P
Sbjct: 163 TLIYMYINK--VPHAPFGEKSIRHLLIFRGCTGFIGVFGLYFSLMYLTISDAILIRFIVP 220

Query: 126 TLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVETKNP 185
           T+T+FL+F++L E FS  E +GS+ISF GV+LIIRP  +FG              E  NP
Sbjct: 221 TITVFLAFIVLRERFSFKEMVGSIISFCGVILIIRPKSIFGKYSDTESALGSDG-ENDNP 279

Query: 186 -----KLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLI 240
                  RL+AI V+L GV G S+VYIIIR+IG +AHA++SV+YFSL+TT+V+ LG++ I
Sbjct: 280 VTSDYNQRLVAIMVALFGVVGASNVYIIIRYIGKRAHAVLSVAYFSLLTTIVSFLGILTI 339

Query: 241 PALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVV 300
           P++  Q P   K+W L  NLG+ GFI+Q+LLTMGIQRERA RGSL++Y Q+++A+ WDV 
Sbjct: 340 PSMRFQAPRDLKEWLLMGNLGLCGFIYQLLLTMGIQRERAARGSLISYLQLLFAIMWDVS 399

Query: 301 LFHHWPNMWTWCGMAVIVSSTIWVINMRASKQ 332
           L+  WPN ++W GM VI+SSTIWVI  +  +Q
Sbjct: 400 LWDKWPNFFSWMGMVVIISSTIWVIRAKQERQ 431

>KAFR0B03830 Chr2 (792859..794028) [1170 bp, 389 aa] {ON} Anc_8.804
           YMR253C
          Length = 389

 Score =  349 bits (895), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 172/329 (52%), Positives = 238/329 (72%), Gaps = 9/329 (2%)

Query: 2   ILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSI 61
           IL+      +K N G+V L ++ FFNS+M+VSTKVLE     T +S+I PLQ+L+VRM I
Sbjct: 44  ILRDKINSKIKSNIGIVFLAIAQFFNSTMIVSTKVLE-----TGESKIKPLQVLVVRMVI 98

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLIT 121
           TY   L YM  ++  I +IP+G P  RKWL+LRG+ GFFGVFGMY+SL +LSIS+A+LIT
Sbjct: 99  TYLGCLIYMYLHRDTIKNIPFGDPPVRKWLLLRGMTGFFGVFGMYYSLQHLSISNAILIT 158

Query: 122 FMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVE 181
           F++P+LTI L+ + L E  + +E  GSL S  GV+LIIRP FLFG              E
Sbjct: 159 FLAPSLTIVLAAMFLHERINLWEIAGSLTSLFGVILIIRPPFLFGQTEGGANEK----AE 214

Query: 182 TKNPKLRLIAIGVSLLGVCGLSSVYIIIRHIGNKAHAIMSVSYFSLVTTVVAALGVMLIP 241
           + NP+ RL+   + LLG  G+S VYIIIR IG +AHAIM+V+YFSLVT V++  G++ IP
Sbjct: 215 SSNPEERLVGSMIGLLGTLGISCVYIIIRRIGKRAHAIMNVAYFSLVTAVISLFGIIFIP 274

Query: 242 ALTLQLPHSWKQWGLFLNLGISGFIHQILLTMGIQRERAGRGSLMTYTQVIYAVFWDVVL 301
           +++ Q+P +  +W LF NLG  GF +Q++LT+GIQ+ERAGRGSL+TYTQ+IYA+FWD+VL
Sbjct: 275 SMSFQIPQTLTEWLLFSNLGFCGFFYQLILTIGIQKERAGRGSLLTYTQLIYALFWDLVL 334

Query: 302 FHHWPNMWTWCGMAVIVSSTIWVINMRAS 330
           +H WP++W+W GM +I+ ST+ V+  ++S
Sbjct: 335 YHFWPSIWSWSGMFLIIGSTLVVLKFKSS 363

>TPHA0G01050 Chr7 (210214..211158) [945 bp, 314 aa] {ON} Anc_8.804
           YMR253C
          Length = 314

 Score =  310 bits (793), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 221/325 (68%), Gaps = 14/325 (4%)

Query: 30  MVVSTKVLESDPLETSQSRINPLQILLVRMSITYCCTLAYMRWNKQNIPDIPWGAPSCRK 89
           M VSTKVLE+   +T + RI PLQILL+RM +T    + YM +N++ IP +P+G P+ R 
Sbjct: 1   MQVSTKVLETMGDKTEEDRIKPLQILLLRMVVTSIALVVYMYYNRRTIPYVPFGNPAVRG 60

Query: 90  WLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSL 149
           WLILRGI GF GVFGMY+SLMYL+ISDAVLI+FM+P+ TI  ++L+L E  S  E +GS 
Sbjct: 61  WLILRGIFGFIGVFGMYYSLMYLTISDAVLISFMAPSFTIISAWLVLHESISPIECMGSA 120

Query: 150 ISFSGVVLIIRPTFLFGXXXXXXXXXXXXXVETKNPKLRLIAIGVSLLGVCGLSSVYIII 209
           +S SGV+LI+RPTF+FG                 +P  R IAI  +L G   LS VYI+I
Sbjct: 121 LSLSGVILIVRPTFIFGAANDSGNSDSTF---NHDPAGRCIAIVFALFGAMSLSGVYIVI 177

Query: 210 RHIGNKAHAIMSVSYFSLVTTVVAALGVMLIPALTLQLPHSWKQWGLFLNLGISGFIHQI 269
           R IG++AHAIM+V+YFS VT VV+  G+++IP    Q   ++K   LFL +GI GFIHQ+
Sbjct: 178 RFIGDRAHAIMNVNYFSFVTGVVSFFGILVIPGFKFQKIDNFKGLNLFLLIGICGFIHQL 237

Query: 270 LLTMGIQR-ERAGRGSLMTYTQVIYAVFWDVVLFHHWPNMWTWCGMAVIVSSTIWVINMR 328
           LL+MGIQR  +A +GSLM+YTQ+IYA+FWDV+++  WPN+++  GM +I+ STI VI M+
Sbjct: 238 LLSMGIQRVTKASKGSLMSYTQLIYAIFWDVIIWGKWPNVFSIIGMILIIGSTITVIKMK 297

Query: 329 ASKQNIVATTELLSTSDFELDELED 353
                     E LS    E  EL++
Sbjct: 298 ----------EKLSERQSEYIELQE 312

>TDEL0A04140 Chr1 (737337..738485) [1149 bp, 382 aa] {ON} Anc_5.551
           YML018C
          Length = 382

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIR 160
           SL Y S++   +++  S   T+F+  L   E  SK + +GS++SF G++L+ R
Sbjct: 135 SLSYTSVASQTILSSTSSFFTLFVGALCRVEKISKVKVIGSMVSFFGILLVTR 187

>TPHA0D02500 Chr4 (515403..516755) [1353 bp, 450 aa] {ON} Anc_5.551
           YML018C
          Length = 450

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTF 163
           SL Y S++   +++  S   T+F+ ++   E  +K + LGSL+SF G++L+    +
Sbjct: 180 SLAYTSVASQTILSSTSSFFTLFIGYIWNIEKITKSKTLGSLVSFIGIILVTHSDY 235

>KNAG0B03560 Chr2 complement(687312..688529) [1218 bp, 405 aa] {ON}
           Anc_5.551 YML018C
          Length = 405

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGV 155
           I+ F   F    +L Y S+S   +++  S   T+F+  L   E  ++ + +G++ISF G+
Sbjct: 150 ILWFLANFATNAALAYTSVSSQTILSSTSSFFTLFIGALCNVESINRLKLIGAVISFVGI 209

Query: 156 VLIIR 160
            L+ R
Sbjct: 210 TLVTR 214

>TBLA0D01480 Chr4 complement(363558..364880) [1323 bp, 440 aa] {ON}
           Anc_5.551 YML018C
          Length = 440

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%)

Query: 99  FFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLI 158
           F   F    SL Y S++   +++  S   T+F+  L   E  +K +  GS++SF G++L+
Sbjct: 173 FVANFATNASLAYTSVASQTILSSTSSFFTLFVGGLFHVECVTKIKVFGSVVSFVGILLV 232

Query: 159 IRPTFL 164
            +  ++
Sbjct: 233 TKTDYV 238

>ZYRO0D13090g Chr4 (1102902..1104014) [1113 bp, 370 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 370

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGV 155
           I+ F   F    SLMY S++   +++  S   T+F+  L   E  +K + +GSL+SF G+
Sbjct: 125 IIWFLANFVTNASLMYTSVASQTILSSTSSFFTLFVGSLCNVESVNKAKVVGSLVSFMGI 184

Query: 156 VLI 158
           +L+
Sbjct: 185 MLV 187

>KLLA0B01177g Chr2 (94268..95512) [1245 bp, 414 aa] {ON} similar to
           uniprot|Q03730 YML018C Saccharomyces cerevisiae
          Length = 414

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 33/56 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTF 163
           SL Y S++   +++  S   T+ +S L   E  +K + LGS++SF G++++ +  +
Sbjct: 161 SLSYTSVASQTILSSTSSFFTLLVSALCHVESVNKIKVLGSIVSFIGIIMVTKSDY 216

>NCAS0F01200 Chr6 (234603..235706) [1104 bp, 367 aa] {ON} Anc_5.551
           YDR438W
          Length = 367

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGV 155
           I+ F   F    SL + SIS   +++  S   T+F+S LL  E  +  + +G L+SF G+
Sbjct: 120 ILWFMANFMTNSSLQFTSISSQTILSSTSSFFTLFISALLKIEKINNLKIVGLLLSFFGI 179

Query: 156 VLIIR-----PTF 163
           +++ +     PTF
Sbjct: 180 IILTKSDNNSPTF 192

>Suva_13.141 Chr13 complement(225107..226309) [1203 bp, 400 aa] {ON}
           YML018C (REAL)
          Length = 400

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIR 160
           SL + S++   +++  S   T+F+  L   E  S+ + LGS ISF G++++ R
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGALCHVESLSRSKILGSFISFIGIIMVTR 199

>YML018C Chr13 complement(234771..235952) [1182 bp, 393 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the membrane
           of the vacuole; physical interaction with Atg27p
           suggests a possible role in autophagy; YML018C is not an
           essential gene
          Length = 393

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIR 160
           SL + S++   +++  S   T+F+  +   E  SK + LGS ISF G++++ +
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLSKSKVLGSFISFVGIIMVTK 199

>SAKL0G05456g Chr7 (448553..449737) [1185 bp, 394 aa] {ON} similar
           to uniprot|Q03730 YML018C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 394

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIR 160
           SL Y S++   +++  S   T+ +  L   E  ++ + +GS++SF G+VL+ R
Sbjct: 142 SLSYTSVASQTILSSTSSFFTLLVGALCHAEVINRIKVIGSIVSFIGIVLVTR 194

>Kpol_1060.27 s1060 complement(66241..67269) [1029 bp, 342 aa] {ON}
           complement(66241..67269) [1029 nt, 343 aa]
          Length = 342

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 68/151 (45%), Gaps = 13/151 (8%)

Query: 16  GLVLLIVSYFFNS-SMVVSTKVLESDPLETSQSRIN----------PLQILLVRMSITYC 64
           G V+L+ S F +  +     K+L+S+    S++  +           L + ++  +++Y 
Sbjct: 173 GFVMLLSSLFMDGLTNATQDKMLKSNRKNNSKNSKDRLITGAHLMFALNMFIIIWNLSYL 232

Query: 65  CTLAYMRWNKQNIPDIPWGAPSCRKWLILRGIMGFFGVFGMYFSLMYLSISDAVLITFMS 124
             +   +W  Q+   +    P   K+LI   I G  G   ++F+L        V+IT   
Sbjct: 233 MFIDKSQW--QHSLKMMTLDPVIVKYLITYAICGAIGQCFIFFTLQNYGSLVLVMITVTR 290

Query: 125 PTLTIFLSFLLLGEPFSKFEALGSLISFSGV 155
             +++ LS ++ G+    F+ +G  + F+G+
Sbjct: 291 KMVSMLLSIVVFGKSIKPFQWIGIFVVFAGI 321

>CAGL0M04499g Chr13 (494202..495611) [1410 bp, 469 aa] {ON} highly
           similar to uniprot|P09368 Saccharomyces cerevisiae
           YLR142w PUT1 Proline oxidase
          Length = 469

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 2   ILQRISKDYLKPNYGLVLLIVSYFFNSSMVVSTKVLESDPLETSQSRINPLQILLVRMSI 61
           ++Q + K+  K  YG  L++ S+ + S M+ +TK+L+  P    ++ I   Q+L +  ++
Sbjct: 352 VIQDLLKNGTKSYYGH-LVVASHNYGSQML-ATKILKDAPENVGKANIVLGQLLGMSDNV 409

Query: 62  TYCCTLAYMRWNKQNIPDIPWGAPSCRKWLILR 94
           T+   L      K  I  +PWG P   K  +LR
Sbjct: 410 TH--DLITKHGAKNIIKYVPWGPPLETKDYLLR 440

>KAFR0C05510 Chr3 (1102100..1103311) [1212 bp, 403 aa] {ON}
           Anc_5.551 YML018C
          Length = 403

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLI 158
           SL Y S++   +++  S   T+F+  L   E  +  + +GS+ISF G++L+
Sbjct: 162 SLAYTSVASQTILSSTSSFFTLFIGALCQVETLNHSKIVGSIISFGGIILV 212

>CAGL0G07018g Chr7 (668453..669628) [1176 bp, 391 aa] {ON} similar
           to uniprot|Q03730 Saccharomyces cerevisiae YML018c
          Length = 391

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIR 160
           SL Y S++   +++  S   T+F+      E   + + +GSLISF G++L+ +
Sbjct: 154 SLGYTSVASQTILSSTSSFFTLFIGAAFRVETIDRVKVIGSLISFIGILLVTK 206

>Smik_13.133 Chr13 complement(223651..224832) [1182 bp, 393 aa] {ON}
           YML018C (REAL)
          Length = 393

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIR 160
           SL + S++   +++  S   T+F+  +   E  +K + LGS ISF G++++ +
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLNKSKILGSFISFVGIIMVTK 199

>NDAI0C00940 Chr3 complement(180857..182200) [1344 bp, 447 aa] {ON}
           Anc_5.551
          Length = 447

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGV 155
           I+ F   F    SL Y S++   +++  S   T+F+  L   E  +  + +GS +SF G+
Sbjct: 185 ILWFLANFATNASLAYTSVASQTILSSTSSFFTLFIGALFHVEMINPLKVIGSTVSFIGI 244

Query: 156 VLIIR 160
           + +I 
Sbjct: 245 MSVIE 249

>AER331C Chr5 complement(1245399..1246733) [1335 bp, 444 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML018C and
           YDR438W
          Length = 444

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGV 155
           ++ F   F    SL + S+  A +++  S   T+ L  L+  E  S  + LGS++S  G+
Sbjct: 194 VLWFVANFVTNASLGFTSVGSATILSSTSSFFTLLLGVLMKTESASVLKVLGSVVSSLGI 253

Query: 156 VLIIR 160
           VL+ +
Sbjct: 254 VLVTK 258

>Skud_13.133 Chr13 complement(221096..222277) [1182 bp, 393 aa] {ON}
           YML018C (REAL)
          Length = 393

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 31/53 (58%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIR 160
           SL + S++   +++  S   T+F+  +   E  +K + LGS ISF G++++ +
Sbjct: 147 SLAFTSVASQTILSTTSSFFTLFIGAICHVESLNKSKILGSFISFIGIIMVTK 199

>Kpol_1004.39 s1004 (83150..84325) [1176 bp, 391 aa] {ON}
           (83150..84325) [1176 nt, 392 aa]
          Length = 391

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%)

Query: 108 SLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGVVLIIRPTF 163
           SL Y S++   +++  S   T+F+  +   E  +K + LGSLISF G++ +    +
Sbjct: 144 SLAYTSVASQTILSSTSSFFTLFIGAIWKVESVTKSKLLGSLISFIGILFVTHSDY 199

>NCAS0H02680 Chr8 (529371..530642) [1272 bp, 423 aa] {ON} Anc_5.551
          Length = 423

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%)

Query: 96  IMGFFGVFGMYFSLMYLSISDAVLITFMSPTLTIFLSFLLLGEPFSKFEALGSLISFSGV 155
           I+ F   F    SL Y S++   +++  S   T+F+  L   E  ++ + +GS+ISF G 
Sbjct: 161 ILWFLANFVTNASLAYTSVASQTILSSTSSFFTLFIGSLCHVEQINRSKIIGSIISFLGT 220

Query: 156 VLIIR 160
           +L+ +
Sbjct: 221 MLVTK 225

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,527,349
Number of extensions: 1154003
Number of successful extensions: 3607
Number of sequences better than 10.0: 64
Number of HSP's gapped: 3656
Number of HSP's successfully gapped: 64
Length of query: 353
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 242
Effective length of database: 40,753,473
Effective search space: 9862340466
Effective search space used: 9862340466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)